GenomeNet

Database: Pfam
Entry: DUF3935
LinkDB: DUF3935
Original site: DUF3935 
#=GF ID   DUF3935
#=GF AC   PF13071.6
#=GF DE   Protein of unknown function (DUF3935)
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Aldam G;0000-0003-3039-8438
#=GF SE   Pfam-B_1715 (release 24.0)
#=GF GA   81.00 81.00;
#=GF TC   137.00 136.80;
#=GF NC   25.20 21.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025176;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 90 amino acids in length. There are two
#=GF CC   conserved sequence motifs: FVF and LGV.
#=GF SQ   8
#=GS Q3EPG4_BACTI/2-71      AC Q3EPG4.1
#=GS C2WES7_BACCE/5-74      AC C2WES7.1
#=GS A0A073KGP9_9BACI/2-71  AC A0A073KGP9.1
#=GS Q814U6_BACCR/2-71      AC Q814U6.1
#=GS A0A073KG05_9BACI/2-71  AC A0A073KG05.1
#=GS R8PV56_BACCE/2-71      AC R8PV56.1
#=GS Q81JX7_BACAN/24-93     AC Q81JX7.1
#=GS A7GV73_BACCN/2-71      AC A7GV73.1
Q3EPG4_BACTI/2-71                 TRLKQVFGIIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
C2WES7_BACCE/5-74                 TRIKQSFGIIISFFVFWFSMLGVQMFAEFLDIDALKFIEGNTGAARTFYSPYPFLIVFLITLLSLYFFVV
A0A073KGP9_9BACI/2-71             TKIKQFFGIILSFFIFWFSVLGIQRFAEFFDVSSLKFVEGKTAAARVFHSPYPFLIVFIITLLSLYFFVV
Q814U6_BACCR/2-71                 TRLKQVFGIIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
A0A073KG05_9BACI/2-71             TRVKQLCGIIISFFVFWFSMLGVQMFAEFLDIDSLKFIEGKTEAARMFYSPYPFFIVFIITLLSLYFFVL
R8PV56_BACCE/2-71                 TRVKQIFGIIISFFVFWFSMLGVQMFAEFLDISSLKFIEGKTEAARMFYSPYPFFIVFLITLLSLYFFVV
Q81JX7_BACAN/24-93                TRLKQVFGVIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
A7GV73_BACCN/2-71                 TRVKQIFGIMISFFVFWFSMLGVQMFAEFLDIDSFKFIVGKTETARAFYSPYPFLIVFLLTLLSLYFFVI
#=GC seq_cons                     TRlKQlFGIIISFFVFWFSMLGVQMFAEFLDI-SLKFltGKTEAARsFYSPYPFLIVFLITLLSLYFFVl
//
DBGET integrated database retrieval system