GenomeNet

Database: Pfam
Entry: DUF4088
LinkDB: DUF4088
Original site: DUF4088 
#=GF ID   DUF4088
#=GF AC   PF13317.7
#=GF DE   Protein of unknown function (DUF4088)
#=GF AU   Aldam G;0000-0003-3039-8438
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   Pfam-B_3345 (release 24.0)
#=GF GA   23.80 23.80;
#=GF TC   24.80 292.60;
#=GF NC   23.50 22.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR025146;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are typically between 258 and 300 amino acids in length.
#=GF SQ   60
#=GS A4JCM2_BURVG/16-241      AC A4JCM2.1
#=GS Q63S60_BURPS/54-279      AC Q63S60.1
#=GS A0A063BG37_9BURK/16-241  AC A0A063BG37.1
#=GS A0A221A9A3_9BURK/16-241  AC A0A221A9A3.1
#=GS C5AD63_BURGB/16-241      AC C5AD63.1
#=GS G8M632_9BURK/16-241      AC G8M632.1
#=GS A0A0Q5PGH9_9BURK/16-241  AC A0A0Q5PGH9.1
#=GS A0A160FMR1_9BURK/16-241  AC A0A160FMR1.1
#=GS A0A0A6QHW4_9BURK/16-241  AC A0A0A6QHW4.1
#=GS A0A1I3JDC5_9BURK/16-241  AC A0A1I3JDC5.1
#=GS A0A1N6KZL8_9BURK/16-241  AC A0A1N6KZL8.1
#=GS A0A0C4YW57_9BURK/17-243  AC A0A0C4YW57.1
#=GS A0A372K368_9BURK/16-241  AC A0A372K368.1
#=GS A0A2N7W5R0_9BURK/16-241  AC A0A2N7W5R0.1
#=GS F2L801_BURGS/16-241      AC F2L801.1
#=GS A0A1H1DD79_9BURK/16-241  AC A0A1H1DD79.1
#=GS Q46PI6_CUPNJ/17-243      AC Q46PI6.1
#=GS A0A1N7RSU7_9BURK/16-241  AC A0A1N7RSU7.1
#=GS A0A2W7FDJ3_9BURK/16-241  AC A0A2W7FDJ3.1
#=GS A0A3N6NE38_9BURK/16-241  AC A0A3N6NE38.1
#=GS A0A1N7RZG1_9BURK/16-241  AC A0A1N7RZG1.1
#=GS A0A1I1JYJ4_9BURK/17-243  AC A0A1I1JYJ4.1
#=GS A0A2J6MQK7_9BURK/16-241  AC A0A2J6MQK7.1
#=GS Q1LH20_CUPMC/17-243      AC Q1LH20.1
#=GS J2V7F0_9BURK/16-239      AC J2V7F0.1
#=GS A0A0H3KD58_BURM1/16-241  AC A0A0H3KD58.1
#=GS A0A1D9H693_9BURK/17-243  AC A0A1D9H693.1
#=GS A0A1A5XAC9_9BURK/16-241  AC A0A1A5XAC9.1
#=GS V2ID58_9BURK/17-243      AC V2ID58.1
#=GS A0A494XQW1_9BURK/16-241  AC A0A494XQW1.1
#=GS A0A1H3ZIQ7_9BURK/16-241  AC A0A1H3ZIQ7.1
#=GS A0A370N6T7_9BURK/16-241  AC A0A370N6T7.1
#=GS A0A1L6HYQ5_9BURK/16-241  AC A0A1L6HYQ5.1
#=GS D8IS03_HERSS/16-239      AC D8IS03.1
#=GS A0A2N7VQN7_9BURK/16-241  AC A0A2N7VQN7.1
#=GS J2LQ39_9BURK/16-240      AC J2LQ39.1
#=GS A0A2N7X239_9BURK/16-241  AC A0A2N7X239.1
#=GS A0A0F0G1G0_9BURK/17-243  AC A0A0F0G1G0.1
#=GS A0A346BED4_9BURK/16-241  AC A0A346BED4.1
#=GS A0A158HSP4_9BURK/16-241  AC A0A158HSP4.1
#=GS A0A1Q8IU99_9BURK/16-241  AC A0A1Q8IU99.1
#=GS A0A0J1D5S0_9BURK/16-241  AC A0A0J1D5S0.1
#=GS A0A069PQP5_9BURK/16-241  AC A0A069PQP5.1
#=GS A0A103EG03_9BURK/16-241  AC A0A103EG03.1
#=GS A0A0L0MHH2_9BURK/16-241  AC A0A0L0MHH2.1
#=GS E1T5P5_BURSG/16-241      AC E1T5P5.1
#=GS A0A1H7MHW8_9BURK/16-241  AC A0A1H7MHW8.1
#=GS A0A3N8LF39_9BURK/16-241  AC A0A3N8LF39.1
#=GS A0A239STQ1_9BURK/16-240  AC A0A239STQ1.1
#=GS Q13VI8_PARXL/16-241      AC Q13VI8.1
#=GS A0A1G6VMH0_9BURK/16-241  AC A0A1G6VMH0.1
#=GS A0A1X7DU95_PARCY/16-241  AC A0A1X7DU95.1
#=GS Q0K4N9_CUPNH/17-243      AC Q0K4N9.1
#=GS A0A0C2C5H0_9BURK/16-241  AC A0A0C2C5H0.1
#=GS A0A316EN77_9BURK/17-243  AC A0A316EN77.1
#=GS A0A1X7ILN8_9BURK/16-241  AC A0A1X7ILN8.1
#=GS B2JFG3_PARP8/16-241      AC B2JFG3.1
#=GS A0A2S4LU87_9BURK/16-241  AC A0A2S4LU87.1
#=GS A0A1N6IJ03_9BURK/16-241  AC A0A1N6IJ03.1
#=GS A0A3D8JVG1_9BURK/16-241  AC A0A3D8JVG1.1
A4JCM2_BURVG/16-241                 LRKDYDAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLEGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFASRAEWTPDELAKACRDWAKAIVAEAQGDASLVDPMAAQIKSAVQDIQALEEMMQTPAWRLAESLRQRIYEAKLACEMSV.GSAA.RDKLGELRGLLRLALSHGSFQKQEAQQLMEYLRLLKPEIFVEEPYDVFARLAAWLRSVFA.
Q63S60_BURPS/54-279                 LRKDYDAFVRVSLKLDPQFVTPSFEDFLRAKLLDSMVPLTEHAVQRLLQGGQYAWAKRTLDKEFPDVVSILIRQAGDFGFGFASRSEWTPDELAKACRDWAAAVVSGAQGDAALVDPLAAQIKSAVTDIQTLEERMQTPAWRLAESLRQRVYEAKLACEMSV.GSVA.REKLGELRGLLRLGIAHGSFQKQEAQQIMEYLRLLKPEIFIEEPYDIFTRIAAWLRSMF-m
A0A063BG37_9BURK/16-241             LRKDYDAFVRVSQKLDPHFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRALDKEFPDVVAILMRQAGEFGFGFASRSEWTPDELAKACRDWARAIVSEAQGEEELVDPLAAQIKSAVLDIQTLEERMQTPAWRLAESLRQRIYEAKLACEMSS.GSTA.RDKLGELRGLLRLGLAHGSFQKPEAQQIMEYLRLLKPEIFVDEPDDVFARLASWLRSMFT.
A0A221A9A3_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDAALIDPLAAQIKSAAQDIQALEEVMQTPAWRLVESLRQRVYEAKVGCETGV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
C5AD63_BURGB/16-241                 LRKDFEAFVRVSQKLDPQFATPSFEDFLRAKLLDNMVPLTENAVQRMLQGGQYAWAKRTLDKEFPDVLAIMMRQAESFGFGFASRSEWTPDELVKACQDWATALVTEAQGDPAQIEPLAAQIKSAVHDIQTLEERMQTPAWRLAESLRQRVYEAKLACEMSV.GSLA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDIFSRLAGWLRGIF-l
G8M632_9BURK/16-241                 LERDFEAFLRLSLKLDPQFVTPSFEDFLRAKLLDNNTPLTEQAVQRMLTHGQYAWAKRALDKEFPDVVEILIRQAAEHGFAFAIRADWTAEDLVKASREWATAIVTEAKGDLSQVDMLASQIKSAAADIREVEEKMQTPAWRLADSLRQRVYETKISVETSV.GSTA.REKLGELRCLLRLGIVYGSIQKQEAQQVLEYLRSLRPELFVEEPHDGFTRFAAWLRSIFA.
A0A0Q5PGH9_9BURK/16-241             LRRDFDTFIRLSLKFDPQFVTPSFEDFLRAKLLDNPTPLTEQAVQRMLQNGQYAWAKRALDKEFPDVVDMMMRQAAEHGFGFAVRSDWSTDDLVKAARTWATSIVTEAKGDPAQIESLAAQIKSAATDIQDLEQKMQTPAWRLADSLRQRVYETRIATEHSV.GSTA.REKLGELRCLLRLGMFHGSVSKQEAQQVLEQLRSLKPEIFIEEPYDGFTRFGNWLRAIFT.
A0A160FMR1_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNIVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAEEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDAALIDPLAAQIKGAAQDIQALEEVMQTPAWRLVESLRQRVYEAKVACETGV.GSSA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
A0A0A6QHW4_9BURK/16-241             LRKDFDAFLRVSLKLDPQFLTPSFEDFLRAKLLDNMTPLTEQAVQRLLQGGQYAWAKRTLDKEFPEVVSILLRQAGEFGFGFASRPEWTPDERAKQCREWAAAIVREADAGQTLIDPLAAQIQSGVQDIQMLEESMQTPAWRLAESVRQRVYEAKIGCEQAS.GSLA.RERLGELRGLLRLAIAHGTFQKQEAQQIMEYLRLLKPEIFVEEPDDVFTRLAAWLRNFFV.
A0A1I3JDC5_9BURK/16-241             LRKDFEAFLRVSLKLDPQFATPPFEDFLRAKLLDNMVPLTENAVQRMLAGGQYAWAKRTLGKEFPDVVAILMRQATEFGFGFAVRTEWTPEELAKQARSWAAAIVEEAQGDALMVDPLATQIKSAAQDIQTLEETMQTPAWRLAESLRQRVYEAKVACEASV.GSAA.REKLGELRGLLRLGIAHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDIFARLAAWLRNFF-t
A0A1N6KZL8_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVKRMLQGGQYAWAKRTLDKEFPDVVAILMQQASEFGFGFASRSEWTPEELAKQCHDWAAAIVKESEGDASLVDPLAAQIKGAAQDIQALEEAMQTPAWRLVESLRQRVYEAKVACETSI.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRAFF-t
A0A0C4YW57_9BURK/17-243             LRAEFEHFVKLSTGLDNEFTPPGFDDFLRARLLHHDGPLTERAVTRLLSGGEYAWAKRVFNKQLPNAMATLMRDAQRYGYGLAVRYEWTPQERLAHARDWSRQILEDAGADLAFTDPLASQLATSAVDIRTLEEQMQTPAWRVAQSLRRRVYDLMYMVQTER.TAGAaRSRLGELRALLGLSMDYGTVSAEEAARVMEQVEQTCPHLFREEPDDLFARVAAWLRRVL-v
A0A372K368_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMLPLTEHAVKRMLQGGQYAWAKRTLDKEFPDVVAILMQQATEFGFGFAARSEWTPEELAKQCRDWAAAIVKESEGDASLVDPLAAQIKGAARDIQALEEEMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFTRLATWLRNFF-t
A0A2N7W5R0_9BURK/16-241             LHKDFEAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLEKEFPDVVAILMRQAEEFGFSFAVRSEWTPEELAKAARDWASAIVKEAGGDVALVDPLAAQIKSAARDIQSLEEKMQTPAWRLAESLRQRVYEAKIACETSV.GSTA.REKLGELRGLLKLGLAHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDIFTRMATWMRNFF-m
F2L801_BURGS/16-241                 LRKDFDAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPNVVEILMRQAETFGFGFASRSEWTPEELAKACHDWAAAIVSEAQGDAALVDPLAGQIKSAVHDIQTLEERMQTPAWRLAESLRQRVYEAKLACEMSV.GSTA.REKLGELRGLLRLGLAHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRGIF-m
A0A1H1DD79_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDATLIDPLASQIKSAAQDIQALEETMQTPAWRLVESLRQRVYEAKVACEVSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRMAAWLRNFF-t
Q46PI6_CUPNJ/17-243                 LRREFDDFVSLSTGFDKDFLPPEFNDFLRARLLQHDGPLTERAVMRLLASGEYGWARKVFDKQLPNALSSLMRDARRFGFGLAVQSDWNPQQRFEHAREWAAQVLAECGADAAFTDALASQVAASAEDVRVLEERMRTPAWVLAESLRQRAYDLMYALQTED.NETLgRSRVGELRATLTLALQYGSIQLEEANRVLEQAARARPHLFQDAPDDVFARLAAWLRRLF-n
A0A1N7RSU7_9BURK/16-241             LRKDFEAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMKQASEFGFGFAARSEWTPEELAKQSREWAAAIVKEAEGAPALVDPLAAQIKSAAQDIQALEEVMQTPAWRLAESLRQRVYEAKVACETSV.GSSA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFTRLAAWLRNFF-m
A0A2W7FDJ3_9BURK/16-241             LRKDFDAFVRVSLKLDPYFATPSFEDFLRAKLLDSMVPLTENAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGQFGFGFASRPEWTPDELAKQCRDWAAAIVSEAQGDAALVDPLAAQIKSATQDIETLEEQMQTSAWRLALSLRQRIYEAKTGCESST.GSAA.RERLGELRGLLRLAISHGTFQKQEAQQMMEYLRLLKPEIFVEEPDDVFARLAAWLRNTF-t
A0A3N6NE38_9BURK/16-241             LRKDFEAFLRVSVKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLTGGQYAWAKRTLDKEFPEVVSILMRQASEFGFGFASRTEWTPEELTKQCREWATAIVHEAQGDAMLVDPLASQIKASVQDMQTLEEAMQTPAWRLSESLRQRIYEAKIDCETST.GSTA.RERLGELRGLLRLAITHGVFQKQEAQQIMEYLRLLKPDIFVEEPDDVFARLAAWLRNFFV.
A0A1N7RZG1_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDATLIDPLAAQIKSAVQDIQALEEVMQTPAWRLAESLRQRVYEAKVACESSV.GSAA.REKLGELRGLLRLGISHGSFQKQEAQQIMEFLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
A0A1I1JYJ4_9BURK/17-243             LRADFDAFVKVSTGIDPQFVPPAFDDFLRARLMQQDGPLTERAVMRLLASGEYGWAKKVFDKQLPNALAALMRDAQRFGFGLAIQPDWTPQQRVEHAREWATQILTEAGADAAFTEALAAQISASAIDIRTLEERMRTPAWRISDSLRQRAYDVMYALQTEQ.SEALgRSKVGEMRALLGLALEYGSVSADEAARMLEQVERARPQLFREAPDDVFARLAAWLRRVFS.
A0A2J6MQK7_9BURK/16-241             LRRDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAVLMQQAAGFGFGFAARSEWTPDELTKQCRDWAEAIVAGSQADASLVDPLAAQIKATVQDIQTLEEAMQTPAWRLSESLRQRIYEAKIGCETSA.GSAA.REKLGELRGLLRLAITHGSFQKQEAQQIMEYLRLLKPEIFVEEPEDIFSRFAAWLRAIFS.
Q1LH20_CUPMC/17-243                 LRADFDAFVKVSTGLDAQFIPPAFDDFLRARLMQQDGPLTERAVMRLLASGEYGWAKKVFDKQLPNALAALMRDAQRFGFGLAVQPDWTPQQRVEHARQWATQILSEAGADAAFTEALAAQISASAVDIRTLEERMKTPAWRVADGLRQRAYDVMYGLQTEQ.SEALgRSKVGELRVLLGLALEYGSIGAEEAARVLEQVERACPHLFREAPDDVFARLAAWLRRVFS.
J2V7F0_9BURK/16-239                 LQREFKNFVRLSTKVDSGFVAPSFDAFLMARLSDNTNFLTEEAVQHLMMSGQYAWARRAMDRDFPDVVAILIAEAANYGFHIAVRHDWSSEDLTEAARAWALAIIKQSQGDETQVDVLAAQIKSAAVSITVVQEKLKTPATRLAHALGQQMNDTQVALQHAR.GVLA.REQLGAFRTLLKLGVAYGSIKEQAEKDALAKLQAQRPYLFHQPSEGVFAKLAAWWRL---l
A0A0H3KD58_BURM1/16-241             LRKDYDAFLRVSLKLDPHFATPSFEDFLRAKLLDNMTPLTEHAVQRMLEGGQYAWAKRTLDKEFPDVVAILMRQAGEYGFGFASRAEWTPDELAKACRDWAKAIVAEAQADASMVDPLAAQIKGAVHDIRTLEEMMQTPAWRLAESLRQRIYEAKLACEMSV.GSAA.RDKLGELRGLLRLGLSHGSFQKQEAQQIMEYLRLLKPEIFVDEPYDIFARLAAWLRSVFT.
A0A1D9H693_9BURK/17-243             LRTAYEQFVRLSTGMDHAFEPPTFEAFLRARLLEQESPLTERAVGRLLSSGEYAWLKRVLDKQLPNTVSALMRDAERFGFALATQCDWTPQQKQEQARQWSRQILADSGVDAAFAESLASQIASSAVDVRVVEQRMLTPSWRLAESLRQRAYDLMYAVQTER.NVVRaRTHVGEVKALLGLALEYGSVSADEFERVMAQLAHVRPELFRDEPDDIFSRLAAWFRRLL-v
A0A1A5XAC9_9BURK/16-241             LRKDFDAFLRVSLKLDPQFLTPSFEDFLRAKLLDNMTPLTEQAVQRLLQGGQYAWAKRTLDKEFPEVVSMLLRQAGDFGFGVASRPEWTPDELSKKCREWAAAIVQEAQGEEAQIDPLAAQIKSGVQDIQTLEEIMQTPAWRLAESVRQRVYEAKIGCEQAT.GSLA.RERLGELRGLLRLGIAHGTFQKQEAQQIMEYLRLLKPEIFVEEPDDVFTRLAAWLRNFFV.
V2ID58_9BURK/17-243                 LRGEFDHFVRLSTGLDRQFVPPSFEDFLRARVMHQDGPLTERAVTRLLTGGEYAWAKRVFDKQLPHALANLMRDAERFGFGLAVRSEWSQSERLAQARKWAVEILDHAGADPALADTLAEHIANAAIDVRTIEEQMQTPAWRLADSLRRRVYDLLYLVQTER.GTGAaLTRLGELRAMVGLALDYGAIDAQEAGRVMEQIEHARPHLFRDEPDDVFARLAAWLRRVF-k
A0A494XQW1_9BURK/16-241             LHKDFEAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLEGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFSLAVRSEWTPEELAKACRDWAAAIVKEAGGDAALVDPLAAQIKASAQDIQGLEEKMQTPAWRLAESLRQRAYEAKIACETSV.GSTA.REKLGELRGLLKLGLAHGSFQKQEAQQIMEFLRLLKPEIFVEEPYDIFSRMAAWLRNFF-m
A0A1H3ZIQ7_9BURK/16-241             LRKDFEAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQATEFGFGFAARSEWTPEELAKQCRDWATAIVSEAQGDPTLVDPLAAQIKSAAQDIQTLEETMQTPAWRLAESLRQRVYEAKIGCETSV.GSMA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPDIFVEEPYDMFTRLAAWLRSIFT.
A0A370N6T7_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVKRMLQGGQYAWAKRTLDKEFPDVVAILMQQAGEFGFGFAARSEWTPEELAKQCREWAAAIVKEAEGDAVLIDPLAAQIKGAVQDIQALEEIMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
A0A1L6HYQ5_9BURK/16-241             LRKDFDAFVRVSLKLDAQFATPSFEDFLRAKLLDSMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQATDFGFAFASRSEWTPEELAKQCREWATAIVNEAQCSPNLVDPLAAQIKSAAQDIQTVEESMQTPAWRLAESLRQRVYEAKVACETSF.GSTA.REKLGELRGLLRLGITHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFTRLAAWLRNFF-m
D8IS03_HERSS/16-239                 LERDYQNFVRFSTKIDSGFVKPSFDNYLLAKLSENSNFLTEEAVQHLMLSGQYAWARRAMDKDFPDVVQILIEQAANYGFWIAVRHDWGTDELVAASKAWAMAIIKQAKGDESQVDVLAAQIKASATSIAVVQERLKTPASQLAHAMVQELRETHIAIEHAS.GMVA.REKLGAMRTLLKLGRAYGNVSEKAEQDMMEKLKREKPWLFDEGPKGFWGHVAAWWRG---v
A0A2N7VQN7_9BURK/16-241             LQKDFEAFMRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLEKEFPDVVAILMRQAEEFGFSFAVRSEWTSEEVAKAARDWAAAIVKEAGGDESLVDPLSAQIKSTARDIQSLEEKMQTPAWRLAESLRQRVYEAKIACETSV.GSTA.REKLGELRGLLKLGLAHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDIFSRMAAWMRNFF-m
J2LQ39_9BURK/16-240                 LDREFKNFIRLSLKCDSGFVSPSFDNFLLAKLSDNTTFLTEEAVQHLMMSGQYAWAKRALDKDFPDVVAILISQASTYGFHIAVRQDWGSDDLTTAAKAWAAAIVKQAKGDESQIDILAAQIKSAAVSIAHVEEKLKTPAWRLAASLAQQLHDAKIAVEHAR.GSVA.HEKLGALRSLLKLGIAHGSVKEKDEKEILERLRVKKPYLFEEE-EGFLARAIAWWRSVFA.
A0A2N7X239_9BURK/16-241             LQKDFEAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILVRQAEDHGFAFAVRSEWTPDELAKACREWAAAIVKEAGGDASLIDPLAAQIKSSARDIQSLEEKMQTPAWRLAESLRQRVYEAKIACETSV.GSTA.REKLGELRGLLKLGLSHGSFQKQEAQQIMEFLRLLKPEIFVEEPYDIFSRMAAWLRNFF-m
A0A0F0G1G0_9BURK/17-243             LRSEFEHFVKLSTGLDSEFSPPSFDDFLRARLLQHDGPLTERAVTRLLSGGEYAWAKRVFNKQLPNAMATLMRDAQRFGYGLATRYEWTPQERLAHARDWSRQILEDAGADLAFIELLASQLATSAVDIRALEEQMQTPAWRVAESLRRRVYDLMYMVQTERiAGTA.RSRLGELRAVVALAMDYGTVSAEEAARVMEQVEQTCPHLFSEEPNDLLARVAAWLRRVL-v
A0A346BED4_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDAALIDPLAAQIKSAVQDIQALEEVMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
A0A158HSP4_9BURK/16-241             LHRDFESFVRLSLKIDPHFFTPTFEDFLRAKLLDNPTPLTEQAVQHMLQNGQYAWAKRTLDKEFPEVVEILIQQAAEHGFSFAIRSDWTAEDLIMASRAWAMAIVTEAKGDASQVDALASQIKSAAMDVREVEEKMQTPAWRLADSLRQRVYDTKIAVEHSV.GSSA.REKLGELRCLLRLGISYGSIQKHEAQQVLEYLRSMRPELFIEEPYDGFTRFANWLRSVFA.
A0A1Q8IU99_9BURK/16-241             LRKDFEAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVSILMRQASEFGFGFAARSEWTPEELAKQCHDWAAAIVKEAEGDATLVDPLASQIKGSVQDIQALEELMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGTFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
A0A0J1D5S0_9BURK/16-241             LRRDFDTFLRLSLKFDPQFVTPSFEDFLRAKLLDNPTPLTEQAVQRMLQNGQYAWAKRALDKEFPDVIEMMMRQAAEHGFGFAVRSDWKPDDLVKASRAWAAVIVTEANGDPAQIDTLASQIKAAASDIQELEMKMQTPAWRLADSLRQRVYETKIATEHSV.GSTS.REKLGELRCLLRLGMFHGSIAKQEAQQVLEQLRMLKPEIFIEEPYDGFTRFGNWLRAIFT.
A0A069PQP5_9BURK/16-241             LHRDFEAFVRLSLKIDPQFVTPSFEDFLRAKLLDNPTPLTEQAVQRMLQHGQYAWAKRALDKEFPDVVEILIRQAAEHGFSFAIRSDWTAEDLVKASRAWATAIVTEAKGDMSQIDVLASQIKSAAMDITEVEERMQTPAWRLADSLRQRVYETKIAVEHSV.GSNA.REKLGELRCLLRLGIFHGSIQKQEAQQVLEYLRSVRPELFVEEPYDGFTRFAGWLRSIFV.
A0A103EG03_9BURK/16-241             LRKDYDAFVRVSLKLDPHFATPSFEDFLRAKLLDSMVPLTEHAVQRLLQGGQYAWAKRTLDKEFPDVVAILIRQAGEFGFGFASRSEWTPDELAQACRNWAAALVSGAQGDAALVDPLAAQIKAAVTDIQILEERMQTPAWRLAESLRQRVYEAKLACEMSI.GSAA.REKLGELRALLRLGISHGSFQKQEAQQMMEYLRLLKPEIFMEEPHDVFARLAAWLRGVFT.
A0A0L0MHH2_9BURK/16-241             LQRDFETFLRLSLKLDPHFVTPSFEDFLRAKLLDNPTPLTEQAVQRMLTHGQYAWAKRALDKEFPEVVEILIRQAAEHGFAFAIRPDWTAEDLITASRELATAIVTEAKGDASQIEALATQIKSATEDIRDVETRMQTPAWRLADSLRQRVYETKIAVENSV.GSNA.REKLGELRCLLRLGIYFGSIQKQEAQQVLEYMRSLRPELFVDEPYDGFTRFASWLRAIFA.
E1T5P5_BURSG/16-241                 LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDAVLVDPLAAQIKGAVQDIQALEEIMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRMAAWLRNFFV.
A0A1H7MHW8_9BURK/16-241             LRKDFDAFLRVSLKLDPHFATPSFEDFLRAKLLDNMVPLTENAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAAQFGFGFASRPEWTPDELAKQCRDWATAIVNEAQADESLIDPLASQIKSAAQDIQALEEQMQTPAWRLSESLRQRIYEAKLACESST.GSVA.RERLGELRGLLRLAITHGAFQKQEAQQIMEYMRLLKPEIFVEEPDDMFTRLASWLRNFFS.
A0A3N8LF39_9BURK/16-241             LRKDYDAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQASEFGFGFASRSEWTPDELAKACRDWAKAIVTEAQGDPALVDPLAAQIKSAVLDIQVLEEQMQTPAWRLAESLRQRIYEAKLACEMSV.GSAA.RDKLGELRGLLRLGLAHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFARLAAWLRSVFA.
A0A239STQ1_9BURK/16-240             LQKDFDAFVRISAAVDRHFTPPPFDDFLRARLLDSTVPLTEAAVAQLLAGGHYAWAKRTFDKQFPDVVSIILNQARQHGFYFVSRPEWSREDMARQASRWAEGIVREAKGEERIVESLAGQIVTSAQDLRTLEATLQTPAWRTASVLRERVFEAKRAVETAR.SLQA.REKLGELRALLDLAVIYGSVGAQEADQILEYLGVLRPELFNDDP-GVFERIAAWLRRLL-t
Q13VI8_PARXL/16-241                 LRKDFEAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCREWAAAIVKEAEGDAALIDPLAAQIKSAAQDIQALEEVMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEFLRLLKPEIFVEEPYDVFSRMAAWLRNFFV.
A0A1G6VMH0_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDYLRAKLLDNMTPLTEHAVQRLLQGGQYAWAKRTLDKEFPEVVSILMRQAGEFGFGFASRPEWTPDELSKQCRDWAAAIVSEAQGDDSLVDPLAAQIKSGVQDIQALEESMQTPAWRLSESLRQRVYEAKIGCEQAS.GSAA.RERLGELRGLLRMGVTHGAFQKQEAQQIMEYLRLLKPEIFVEEPDDVFARFAAWLRNFF-m
A0A1X7DU95_PARCY/16-241             LHKDFEAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILVRQAEEHGFSFAYRSQWTSDELAKACHDWASAIVKEAGGDAALVDPLSAQIKSSARDIESLEEKMQTPAWRLAESLRQRVYEAKIACETSI.GSTA.REKLGELRGLLKLGLSHGSFQKQEAQQIMEFLRLLKPEIFVEEPYDIFSRMAAWLRNFF-n
Q0K4N9_CUPNH/17-243                 LRKEFEQFVGVSSGLDREFLPPDFQEFLRARLLQHDGPLTERAVSRLLSGGEYGWARRVFDKQLPNALAALMRDARRFGFGLAVQPDWTPDQRLAHAREWAAQVLSECGADAAFTEALATQVAASAEDVRVLEERMRTPAWRLAESLRQRAYELMYALQTED.SEAAgRARVGELRGMLGLALEYGSVRPEEASRVLEQVERMRPALFREAPDDVFDRLAAWLRRMFG.
A0A0C2C5H0_9BURK/16-241             LQRDFEAFLRLSLKLDPQFITPSFEDYLRAKLLDNDTPLTEQAVQRMLTHGQYAWAKRALDKEFPDVVEILIRQAAEHGFAFAIRSDWSAEDLLKASRAWATAIVTEAKGDESQVDVLASQIKSAAMDIREVEEKMHTPAWRLADSLRQRVYEGKIAVETNV.GSAA.REKLGELRALLRLAIFYGSVQKQEAQQLLEYLRSLRPELFIDEPYDGFTRFAAWLRSIFG.
A0A316EN77_9BURK/17-243             LRADFDAFVRVSTGLDAEFVPPAFDDFLRARLLQQDGPLTERAVMRLLASGEYGWARKVFDKQLPNALSALMRDAQRFGFGLAVQPEWTPTQRVEHAREWAQQILSEAGADAAFTEALAAQIAASAVDIRTIEERMRTPAWRIAESLRQRAYDLMYALQTEQ.SEALgRSKVGEMRALLGLALEYGSVSADEAARVLEQVERARPHLFREAPEDVFSRLAAWLRGLFS.
A0A1X7ILN8_9BURK/16-241             LRKDFEAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARPEWTPEELAKQCRDWAAAIVKEAEGDAVLVDPLAAQIKSAAQDIQTLEEVMQTPAWRLVESLRQRVYEAKVACETSV.GSTA.REKLGELRGLLRLGIAHGTFQKQEAQQIMEYLRLLKPEIFVEEPYDVFSRLAAWLRNFFV.
B2JFG3_PARP8/16-241                 LRKDFEAFVRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTENAVQRMLQGGQYAWAKRTLDKEFPDVVAILMKQANEFGFGFASRSEWTPEELAKQSREWAAAIVKEAEGAPSLVDPLAAQIKSAAQDIQALEEVMQTPAWRLAESLRQRVYEAKVACETSV.GSAA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDVFTRLAAWLRNFF-m
A0A2S4LU87_9BURK/16-241             LRKDFDAFLRVSLKLDPQFLTPSFEDFLRAKLLDNMTPLTEQAVQRLLQGGQYAWAKRTLDKEFPEVVSMLMRHAGEFGFGFASRAEWTPEELAKQCREWAAAIVHEAQAEETLIDPLAAQIKSGVEDIQALEEKMQTPAWRLAESLRQRVYEAKIGCEQAS.GSLA.RERLGELRGLLRMGITHGTFQKQEAQQIMEYLRLLKPEIFVEEPDDVFTRLAAWLRNFFV.
A0A1N6IJ03_9BURK/16-241             LRKDFDAFLRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEHAVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAGEFGFGFAARSEWTPEELAKQCRDWAAAIVKEAEGDAALIDPLAAQIKSEAQDIQALEEIMQTPAWRLVESLRQRVYEAKVACETGE.GSTA.REKLGELRGLLRLGISHGSFQKQEAQQIMEYLRLLKPEIFVDEPYDVFSRLAAWLRNFFV.
A0A3D8JVG1_9BURK/16-241             LQKDFDAFMRVSLKLDPQFATPSFEDFLRAKLLDNMVPLTEAAVQRMLQGGQYAWAKRTLEKEFPDVVAILMRQAEEFGFSFAVRSEWTSDEVAKAARDWASAIVKEAGGDAALVDPLAAQIKSTARDILSLEEKMQTPAWRLAESLRQRVYEAKIACETSI.GSTA.REKLGELRGLLKLGLAHGSFQKQEAQQILEYLRLLKPEIFVEEPYDIFSRMAAWMRSFF-m
#=GC seq_cons                       LRKDF-AFlRVSLKLDPQFATPSFEDFLRAKLLDNMlPLTE+AVQRMLQGGQYAWAKRTLDKEFPDVVAILMRQAuEFGFGFAsRSEWTP-ELAKpsR-WAsAIVpEApGDsuLlDPLAAQIKSAApDIQsLEEpMQTPAWRLAESLRQRVYEAKlACEoSl.GSsA.REKLGELRGLLRLGluHGSFQKQEAQQIMEYLRLLKPEIFVEEPYDlFoRLAAWLRshF..
//
DBGET integrated database retrieval system