GenomeNet

Database: Pfam
Entry: DUF4677
LinkDB: DUF4677
Original site: DUF4677 
#=GF ID   DUF4677
#=GF AC   PF15726.6
#=GF DE   Domain of unknown function (DUF4677)
#=GF AU   Eberhardt R;0000-0001-6152-1369
#=GF SE   Jackhmmer:Q52MB2
#=GF GA   27.00 27.00;
#=GF TC   27.70 237.70;
#=GF NC   26.10 23.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR031458;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is found in eukaryotes. Proteins in this
#=GF CC   family are typically between 157 and 195 amino acids in length.
#=GF SQ   57
#=GS I3LZH7_ICTTR/1-195      AC I3LZH7.1
#=GS G5BWC1_HETGA/1-194      AC G5BWC1.1
#=GS F7H6F2_MACMU/1-193      AC F7H6F2.1
#=GS G1SC66_NOMLE/1-193      AC G1SC66.1
#=GS E2QST5_CANLF/1-194      AC E2QST5.1
#=GS A0A2U3V9D9_TURTR/1-194  AC A0A2U3V9D9.1
#=GS H2NH41_PONAB/1-193      AC H2NH41.1
#=GS M3Z5G3_MUSPF/1-192      AC M3Z5G3.1
#=GS A0A2K5PH90_CEBCA/1-193  AC A0A2K5PH90.1
#=GS A0A2K5HIS7_COLAP/1-193  AC A0A2K5HIS7.1
#=GS A0A452Q7M3_URSAM/1-194  AC A0A452Q7M3.1
#=GS A0A384D788_URSMA/1-179  AC A0A384D788.1
#=GS A0A2K6AM40_MACNE/1-193  AC A0A2K6AM40.1
#=GS A0A2I2ZAR5_GORGO/1-193  AC A0A2I2ZAR5.1
#=GS A0A383ZW23_BALAS/1-194  AC A0A383ZW23.1
#=GS A0A2K5XCQ6_MANLE/1-193  AC A0A2K5XCQ6.1
#=GS G1PXK5_MYOLU/1-194      AC G1PXK5.1
#=GS W5Q8G2_SHEEP/1-190      AC W5Q8G2.1
#=GS CC184_RAT/1-192         AC Q4V8F1.1
#=GS L8YDN3_TUPCH/1-194      AC L8YDN3.1
#=GS H2R7D2_PANTR/1-193      AC H2R7D2.1
#=GS A0A2Y9KNQ5_ENHLU/1-192  AC A0A2Y9KNQ5.1
#=GS A0A1U7UBF6_TARSY/1-193  AC A0A1U7UBF6.1
#=GS A0A2K6N7M4_RHIRO/1-193  AC A0A2K6N7M4.1
#=GS A0A1S2ZA97_ERIEU/1-192  AC A0A1S2ZA97.1
#=GS A0A2U3XCX6_LEPWE/1-195  AC A0A2U3XCX6.1
#=GS A0A1U7Q9Q3_MESAU/1-193  AC A0A1U7Q9Q3.1
#=GS CC184_HUMAN/1-193       AC Q52MB2.2
#=GS A0A2Y9N4L3_DELLE/1-194  AC A0A2Y9N4L3.1
#=GS K7E4S1_MONDO/1-185      AC K7E4S1.1
#=GS A0A3Q7SKM7_VULVU/1-194  AC A0A3Q7SKM7.1
#=GS A0A340Y4S5_LIPVE/1-194  AC A0A340Y4S5.1
#=GS CC184_BOVIN/1-194       AC Q0VC19.1
#=GS A0A2K6JZL5_RHIBE/1-193  AC A0A2K6JZL5.1
#=GS A0A1A6HMI2_NEOLE/1-195  AC A0A1A6HMI2.1
#=GS A0A096MLZ4_PAPAN/1-193  AC A0A096MLZ4.1
#=GS A0A2K6S7N3_SAIBB/1-193  AC A0A2K6S7N3.1
#=GS A0A287BN44_PIG/1-194    AC A0A287BN44.1
#=GS A0A2R8ZCN5_PANPA/1-193  AC A0A2R8ZCN5.1
#=GS A0A2K5BYX2_AOTNA/1-193  AC A0A2K5BYX2.1
#=GS A0A091DWS4_FUKDA/1-197  AC A0A091DWS4.1
#=GS U3D6I1_CALJA/1-193      AC U3D6I1.1
#=GS H0VC73_CAVPO/1-193      AC H0VC73.1
#=GS A0A2U3VLZ9_ODORO/1-193  AC A0A2U3VLZ9.1
#=GS A0A3Q2GW23_HORSE/1-194  AC A0A3Q2GW23.1
#=GS G3IDJ6_CRIGR/1-193      AC G3IDJ6.1
#=GS G1TUJ9_RABIT/1-158      AC G1TUJ9.1
#=GS A0A0D9SD21_CHLSB/1-193  AC A0A0D9SD21.1
#=GS H0XIS6_OTOGA/1-190      AC H0XIS6.1
#=GS D2HE79_AILME/1-194      AC D2HE79.1
#=GS M3X8M3_FELCA/1-194      AC M3X8M3.1
#=GS A0A3Q7X5C5_URSAR/1-194  AC A0A3Q7X5C5.1
#=GS A0A2K5US86_MACFA/1-193  AC A0A2K5US86.1
#=GS A0A1S3FE41_DIPOR/1-195  AC A0A1S3FE41.1
#=GS L5KCC8_PTEAL/1-192      AC L5KCC8.1
#=GS CC184_MOUSE/1-190       AC Q8BMK5.1
#=GS A0A2Y9FJ95_PHYMC/1-194  AC A0A2Y9FJ95.1
I3LZH7_ICTTR/1-195                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQGVPQEPETPSPGIGDNSLLGQDPED....EEDEdEE.EEKGMPSP.ATPTSHCERSESPRAGLLGGDGPLVEPLDLPDITLLQLEGEA-a
G5BWC1_HETGA/1-194                 ..MEDGLLELRTKDGGDMPAPLEVSTVPAVGNVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGSLGVVGGKGSLPGPPQEPEIPSPGVGDSGLLGRDPED....EEDD.YE.EEKEMPSP.ATPTSPRERSESPCAGLLAGDGPLVEPLDLPDFTLLQLEGEGS.
F7H6F2_MACMU/1-193                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
G1SC66_NOMLE/1-193                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPSDLQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLGGDGPLVEPLDVPDITLLQLEGEAS.
E2QST5_CANLF/1-194                 ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISAEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPREPETPSPAIGDSGLLGRDPED....QDDD.EE.EEKETPGS.ATPTSHCERPESPCAGLLGGDGPLVEPLDPPDITLLQLEGEAS.
A0A2U3V9D9_TURTR/1-194             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSLGIEDSGLLGRDPEE....EEDD.DS.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
H2NH41_PONAB/1-193                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPSDPQEPDTPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPLVEPLDMPDITLLQLEGEAS.
M3Z5G3_MUSPF/1-192                 ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFRGAPQEPETPSPGIGDSGLLGRDPED....EDDD.--.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K5PH90_CEBCA/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPVVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFRSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLEGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K5HIS7_COLAP/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPCDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
A0A452Q7M3_URSAM/1-194             ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSPGIGDSGLLGRDPED....EDDD.EE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A384D788_URSMA/1-179             mg-----------------NRVEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSPGIGDSGLLGRDPED....EDDD.EE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K6AM40_MACNE/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPVDMPDITLLQLEGEAS.
A0A2I2ZAR5_GORGO/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSL.ATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEAS.
A0A383ZW23_BALAS/1-194             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGVLGVVGGKGSFPGAPQEPETPSLGIGDSGLLGRDPED....EEDD.DS.EEKEMPSS.ATPTSHCERPESPCAGLLVGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K5XCQ6_MANLE/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPEN....EED-.EE.EEKEMPSP.ATPTSHCERPESPCVGLLAGDGPPMEPLDMPDITLLQLEGEAS.
G1PXK5_MYOLU/1-194                 ..MEDGLLEIMTKDGGDLPAPLEVSAVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGHGSFPGAPQEPETPPPGMEDSGLLDRDPED....EEED.DD.EEKEMPRS.STPTSPFERAESPCAGLLGGDGPLVESLDLPDITLLQLEGEAS.
W5Q8G2_SHEEP/1-190                 ..MEEGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCPIMIS----GGLGVVGSKGNFQGARRDPETPSPGIGGSGLLGRDPED....EEDD.DE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
CC184_RAT/1-192                    ..MEDSLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVAGGKGSFPSVPHEPETPSPGIGDSGLLGRDPDE....EDEE.EE.EEKETASP.ATPTSHCERSESP--GLLGENGPLVEPLDLPDITLLQLEGEAS.
L8YDN3_TUPCH/1-194                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGSLGVVGGKGNFPGAPEEPETPSPGIGDNDLLDRDPVD....EEDD.DE.EEKEMPSP.ATPTSHCERPENPCGGLLAGDASLVEPLDLPDITLLQLEGEAS.
H2R7D2_PANTR/1-193                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEAS.
A0A2Y9KNQ5_ENHLU/1-192             ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFRGAPQEPETPSPGIGDSGLLGRDPED....EDDD.--.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A1U7UBF6_TARSY/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGSKGSFPGDPQEPETPSPGIGDSGLLGREPED....EED-.DE.EQKETPSP.STPTSHRERPESPCAGLLGGEGPLVEPLDLPDITLLQLEGEAS.
A0A2K6N7M4_RHIRO/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
A0A1S2ZA97_ERIEU/1-192             ..MEDGLLELRTKDGGDMPAPREVAGVPAVGDVLAGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTSAPRQGGLGVA-AKGVFPGAPQDPEPPSPGLGDGALLGGDPEE....-EDE.DE.DEEELPSP.TTPTRHRERPESPRAGLCAGDGPLVEPLDLPDITLLQLEGEA-a
A0A2U3XCX6_LEPWE/1-195             ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKVSCPGAPQEPETSSPGIGDSGLLDRDPED...eDEDD.DE.EEKEMPSS.TSPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A1U7Q9Q3_MESAU/1-193             ..MEDSLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVAGGKGSFPSVPHEPETPSLGIGDSGLLGRDPEE....EED-.EE.EEKGMPSP.ATPTGHCERSESPCAGLLGEDGPLVEPLDLPDITLLQLEGEVS.
CC184_HUMAN/1-193                  ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPED....EEE-.EE.EEKEMPSP.ATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEAS.
A0A2Y9N4L3_DELLE/1-194             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSLGIEDSGLLGRDPED....EEDD.DS.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
K7E4S1_MONDO/1-185                 ..MEEGPLEILTKD-GDLPGPLEVSAVPAVGDVISGEYNGGMKDLMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGLGAVSGPEGSDRG--------SPGVPDISL----PKEwgcgSQDL.EE.EGKEVPGP.ATPTNRFESSENPCACLLEGDGPLLDAHDLPDIALLHLEGENS.
A0A3Q7SKM7_VULVU/1-194             ..MEDGPLEIMTKDGGDMPAPLEVSAVPAVGDVISAEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSLPGAPREPETPSPAIGDSGLLGRDPED....EDDD.EE.EEKETPGS.ATPTSHCERPESPCAGLLGGDGPLVEPLDPPDITLLQLEGEAS.
A0A340Y4S5_LIPVE/1-194             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTSAPRQGGLGVVGGKGSFPGAPQEPETPSLGIGDSGLLGRDPED....EEDD.DS.EEKEMPSS.ATPTSHCERPESPCAGLLAGDGPLVEPLELPDITLLQLEGEAS.
CC184_BOVIN/1-194                  ..MEEGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGNKGNFPGARRDPETPSPGIGDSGLLGRDPED....EEDD.DE.EEKEMPSS.ATPTSHCELPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K6JZL5_RHIBE/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
A0A1A6HMI2_NEOLE/1-195             ..MEDSLLEIMTKDGGDMPAPLEVSTVPAVGDVLSGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVAGGKGSFPSVPHEPETPSPGIGDSGLLGRDPEE...eEXED.EE.EEKGIPSP.ATPTSHCERSESPCAGLLGEDGPLVEPLDLPDITLLQLEGEVS.
A0A096MLZ4_PAPAN/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLVGDGPPMEPLDMPDITLLQLEGEAS.
A0A2K6S7N3_SAIBB/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFRSDPQEPETPSPGIGDGGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLEGDGPLVEPLDLPDITLLQLDGEAS.
A0A287BN44_PIG/1-194               ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGGLGVVGGKGSFPGAPQERETPSLGIGDSGLLGRDPED....EEDD.DE.EEKEMPSS.ATPTSHCERPESPCAGHLGGDGPLVEPLDLPDITLLQLEAEAS.
A0A2R8ZCN5_PANPA/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEAS.
A0A2K5BYX2_AOTNA/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFRSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.GTPTSHCERPESPCAGLLEGDGPHVEPLDLPDITLLQLEGEAS.
A0A091DWS4_FUKDA/1-197             ..MEDGLLEIRTKDGGDMPAPLEVSAVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRRGSLGVVAGKGSFPGPPQEPETPSPGIGDSGLLGRDPQDe.eeEEDD.DE.EEKEMPSP.ATPTSHCERSESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
U3D6I1_CALJA/1-193                 ..MEDGLLEIRTKDGGDMPAPLEVSAVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGSGSFRSDPREPGTPSPGIGDSGLLGGDPED....EEDD.-E.EEKEMPSP.ATPTSHCERPESPCAGLLEGDGPLVEPLDLPDITLLQLEGEAS.
H0VC73_CAVPO/1-193                 ..MEDGLLEIRTKDGGDMPVPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIITTAPRQGGLGVVGGKGSFPGAPREPETPSPGIEDSGLLGRDLED....QEDD.-Q.EEKEMPSP.ATPTSHCERSKSPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A2U3VLZ9_ODORO/1-193             ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKASCPGAPQEPETPSPGIGDSGLLGRDPED....E-DD.DE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A3Q2GW23_HORSE/1-194             ..MEDGLLEIMTKDGGEMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTIAPRQGGLGVVGGKGSFPGVPQETETPSPGIGDGGLLGRDPED....EEDD.DE.EEKEMPRS.ATPTSHCERPESPSAGLLVGDGPLVEPLDLPDITLLQLEGEAS.
G3IDJ6_CRIGR/1-193                 ..MEDSLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVAAGKGSFPSVPHEPETPSIGIGDGGLLGRDPEE....EED-.EE.EEKAMPSP.ATPTSHRERSESPCAGLLGEDGPLVEPLDLPDITLLQLEGEVS.
G1TUJ9_RABIT/1-158                 ..MEDGPLELMTKDGGDVPAPLEVSSVPAVGDVLSGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGG------QGRCAGTPREPECPAPGAVA----SEDPED....GN--.AE.EEKESPRAgSTAAPPLEPRDPPDAAL--------------------------l
A0A0D9SD21_CHLSB/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
H0XIS6_OTOGA/1-190                 ..MEDGLLEIMTKDGGDMPTPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGSPPKLETPTPGIGDNGLLGRDPED....----.EE.EEKEMPSP.ATPTSHCERPQSPCADLLVGDGPLVEPLDLPDITLLQLEGDAS.
D2HE79_AILME/1-194                 ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSPGIGDSGLLGRDPED....EDDD.EE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
M3X8M3_FELCA/1-194                 ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGARQEPETPSPGIGDSGLLGRDPED....EDDD.EE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A3Q7X5C5_URSAR/1-194             ..MEDGPLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSPGIGDSGLLGRDPED....EDDD.EE.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
A0A2K5US86_MACFA/1-193             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVSGKGSFPSDPQEPETPSPGIGDSGLLGRDPED....EED-.EE.EEKEMPSP.ATPTSHCERPESPCAGLLAGDGPPMEPLDMPDITLLQLEGEAS.
A0A1S3FE41_DIPOR/1-195             ..MEDGLLEMMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGALGVVGGKGSFPDAPQEPESPPPGIGDTSLLDHDPED....EEDE.DElEEKEMPSL.PTPTSHCERSESPCADLLGEDGPLVEPLDLPDITLLQLEGEA-c
L5KCC8_PTEAL/1-192                 ..MEDGPLEIMTKDGGEMPAPLEVSTVPAVGDVISSEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPGAPQEPETPSPGTEDSGLVGRDPEE....E--D.DE.EEKEMPPS.ATPTSHCERRESPCADLLEGDGPLVEPLDLPDITLLQLEGEAS.
CC184_MOUSE/1-190                  ..MEDSLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVAGGKGSFPSVPHEPETPSPGIEDSGLLGRDPDE....--DE.DE.EEKETPNP.ATPTSHCELSESP--GLLGEDGPLVEPPDLPDITLLQLEGEAS.
A0A2Y9FJ95_PHYMC/1-194             ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCRIMTTAPRQGGLGVVGGKGSVPGAPQEPETPSLGIGDSGLLGRDPED....EEDD.DL.EEKEMPSS.ATPTSHCERPESPCAGLLGGDGPLVEPLDLPDITLLQLEGEAS.
#=GC seq_cons                      ..MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFPusPQEPETPSPGIGDSGLLGRDPED....EED..-E.EEKEMPSs.ATPTSHCERPESPCAGLLuGDGPLVEPLDLPDITLLQLEGEAS.
//
DBGET integrated database retrieval system