GenomeNet

Database: Pfam
Entry: DUF4954
LinkDB: DUF4954
Original site: DUF4954 
#=GF ID   DUF4954
#=GF AC   PF16314.7
#=GF DE   Domain of unknown function (DUF4954)
#=GF AU   Chang Y;0000-0002-2418-3433
#=GF SE   Jackhmmer BT_2257 (NP_811170.1)
#=GF GA   35.60 35.60;
#=GF TC   37.60 35.60;
#=GF NC   35.40 34.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Repeat
#=GF CL   CL0536
#=GF DR   INTERPRO; IPR032533;
#=GF DR   SO; 0001068; polypeptide_repeat;
#=GF CC   This family consists of uncharacterized proteins around 660
#=GF CC   residues in length and is mainly found in various Bacteroides
#=GF CC   species. The function of this protein is unknown.
#=GF SQ   391
#=GS H7EHX6_9SPIO/24-715       AC H7EHX6.1
#=GS D7VMI2_9SPHI/42-727       AC D7VMI2.1
#=GS A0A0P1AGH3_PLAHL/27-541   AC A0A0P1AGH3.1
#=GS A0A373ZWU2_9BACT/53-575   AC A0A373ZWU2.1
#=GS A0A4S8I0M4_9BACT/42-735   AC A0A4S8I0M4.1
#=GS A0A1H4EDX9_9BACT/445-575  AC A0A1H4EDX9.1
#=GS A0A5C6HE05_9BACT/3-657    AC A0A5C6HE05.1
#=GS A0A1K1PSD0_9BACT/42-735   AC A0A1K1PSD0.1
#=GS B3CH69_9BACE/3-657        AC B3CH69.1
#=GS R7EWB3_9BACT/2-558        AC R7EWB3.1
#=GS A0A0A2E7G9_9PORP/11-666   AC A0A0A2E7G9.1
#=GS A0A5C8GKZ7_9BACT/3-603    AC A0A5C8GKZ7.1
#=GS R5CR24_9BACT/4-599        AC R5CR24.1
#=GS A0A1H7W4M6_9BACT/42-731   AC A0A1H7W4M6.1
#=GS R6YH31_9BACE/26-680       AC R6YH31.1
#=GS A0A0F5JLF3_9BACT/4-658    AC A0A0F5JLF3.1
#=GS A0A421FI25_9STRA/24-219   AC A0A421FI25.1
#=GS A0A2D0NJF8_9BACT/42-726   AC A0A2D0NJF8.1
#=GS H1XNG4_9BACT/3-656        AC H1XNG4.1
#=GS A0A1T5FAH8_9BACT/3-657    AC A0A1T5FAH8.1
#=GS U2LE69_TRESO/24-761       AC U2LE69.1
#=GS A0A396M6F7_9BACT/6-480    AC A0A396M6F7.1
#=GS A0A5S5DG14_9SPHI/42-731   AC A0A5S5DG14.1
#=GS H1Q3L0_9BACT/3-617        AC H1Q3L0.1
#=GS R6F9I7_9BACE/4-658        AC R6F9I7.1
#=GS R5FDG6_9BACT/3-606        AC R5FDG6.1
#=GS R5GH52_9BACT/2-272        AC R5GH52.1
#=GS A0A255S7E9_9BACT/4-617    AC A0A255S7E9.1
#=GS E7NTL2_TREPH/47-725       AC E7NTL2.1
#=GS A0A5S5DNN6_9SPHI/41-725   AC A0A5S5DNN6.1
#=GS W4UY55_9BACE/4-658        AC W4UY55.1
#=GS A0A2W7RY22_9BACT/44-738   AC A0A2W7RY22.1
#=GS R6B108_9BACT/4-613        AC R6B108.1
#=GS A0A5B8V9F6_9BACT/44-737   AC A0A5B8V9F6.1
#=GS R5P5T9_9BACT/4-603        AC R5P5T9.1
#=GS R5NF73_9BACT/11-666       AC R5NF73.1
#=GS A0A2N4S9Z1_9BACT/4-658    AC A0A2N4S9Z1.1
#=GS A0A172TTZ4_9BACT/42-730   AC A0A172TTZ4.1
#=GS A0A170YIA0_9BACT/3-657    AC A0A170YIA0.1
#=GS F5Y9H7_TREAZ/42-749       AC F5Y9H7.1
#=GS A0A1R4KGR0_9SPHI/41-725   AC A0A1R4KGR0.1
#=GS A0A1I0QB05_9BACT/42-727   AC A0A1I0QB05.1
#=GS A0A3M6VNK5_9STRA/42-561   AC A0A3M6VNK5.1
#=GS D7FSJ4_ECTSI/137-517      AC D7FSJ4.1
#=GS A0A3P1SRM6_9BACT/4-617    AC A0A3P1SRM6.1
#=GS D9RV43_PREMB/3-617        AC D9RV43.1
#=GS I4ZA23_9BACT/3-618        AC I4ZA23.1
#=GS A0A0A2DVY8_9PORP/1-650    AC A0A0A2DVY8.1
#=GS A0A4R8DTH0_9BACT/42-735   AC A0A4R8DTH0.1
#=GS R6EC95_9BACT/4-595        AC R6EC95.1
#=GS A0A249SVI5_9BACT/42-732   AC A0A249SVI5.1
#=GS R6DPD1_9BACE/21-675       AC R6DPD1.1
#=GS A0A2T7BG43_9BACT/42-733   AC A0A2T7BG43.1
#=GS R7JPT4_9BACT/54-574       AC R7JPT4.1
#=GS R5PLK0_9BACT/5-659        AC R5PLK0.1
#=GS R6VLW9_9BACT/2-599        AC R6VLW9.1
#=GS A0A2T5C3R2_9BACT/6-660    AC A0A2T5C3R2.1
#=GS F9D4C8_PREDD/3-617        AC F9D4C8.1
#=GS A0A3M9NSQ7_9BACT/42-703   AC A0A3M9NSQ7.1
#=GS C5LJA7_PERM5/45-565       AC C5LJA7.1
#=GS V5WCM9_9SPIO/39-492       AC V5WCM9.1
#=GS A0A4U9JS85_9SPHI/42-717   AC A0A4U9JS85.1
#=GS A0A1I3HNM6_9SPHI/41-726   AC A0A1I3HNM6.1
#=GS A0A414BRT7_9BACT/4-611    AC A0A414BRT7.1
#=GS A0A1T5NI53_9BACT/41-730   AC A0A1T5NI53.1
#=GS A0A6G0WLP3_9STRA/35-548   AC A0A6G0WLP3.1
#=GS A0A0L0F623_9EUKA/1-120    AC A0A0L0F623.1
#=GS A0A1Y1S3R9_9SPIO/11-667   AC A0A1Y1S3R9.1
#=GS A0A4R4BR74_9SPIO/627-789  AC A0A4R4BR74.1
#=GS A0A1Y3QYI1_9BACT/54-575   AC A0A1Y3QYI1.1
#=GS D1PYX7_9BACT/5-618        AC D1PYX7.1
#=GS A0A4Y1WZ97_9BACT/53-574   AC A0A4Y1WZ97.1
#=GS A0A133XRC5_9BACT/1-625    AC A0A133XRC5.1
#=GS A0A6A4FHP2_9STRA/33-548   AC A0A6A4FHP2.1
#=GS A0A416GHY3_9BACE/4-658    AC A0A416GHY3.1
#=GS A6LH30_PARD8/4-658        AC A6LH30.1
#=GS A0A327QF19_9BACT/42-730   AC A0A327QF19.1
#=GS H9UMP2_SPIAZ/30-469       AC H9UMP2.1
#=GS A0A1I0Q3Z1_9BACT/4-603    AC A0A1I0Q3Z1.1
#=GS C9MT10_9BACT/3-617        AC C9MT10.1
#=GS F3ZTN4_9BACE/4-657        AC F3ZTN4.1
#=GS R6XAM9_9BACT/1-628        AC R6XAM9.1
#=GS A0A1T5DGJ6_9SPHI/41-725   AC A0A1T5DGJ6.1
#=GS A0A1Y4A6S9_9BACE/4-658    AC A0A1Y4A6S9.1
#=GS U7DAX2_9BACT/3-657        AC U7DAX2.1
#=GS A0A4U7NFC0_9SPIR/12-659   AC A0A4U7NFC0.1
#=GS V9EZ89_PHYPR/38-554       AC V9EZ89.1
#=GS A0A255T481_9BACT/1-590    AC A0A255T481.1
#=GS U2LGB9_9BACT/4-616        AC U2LGB9.1
#=GS R5CS17_9BACT/4-594        AC R5CS17.1
#=GS A0A4Y9J437_9BACT/3-650    AC A0A4Y9J437.1
#=GS A0A4Q0J584_9BACT/160-555  AC A0A4Q0J584.1
#=GS I0X6P2_9SPIO/23-725       AC I0X6P2.1
#=GS A0A4Y8WMB4_9PORP/1-657    AC A0A4Y8WMB4.1
#=GS A0A1B1Y4S0_9FLAO/4-658    AC A0A1B1Y4S0.1
#=GS A0A4Q8RQ18_9BACT/3-654    AC A0A4Q8RQ18.1
#=GS R6CSX3_9BACE/4-658        AC R6CSX3.1
#=GS A0A1K1MW70_9BACT/4-603    AC A0A1K1MW70.1
#=GS A0A3E1NMY6_9BACT/44-735   AC A0A3E1NMY6.1
#=GS A0A3B7MM75_9BACT/42-735   AC A0A3B7MM75.1
#=GS Q73PF3_TREDE/40-717       AC Q73PF3.1
#=GS W2CIU8_9BACT/3-614        AC W2CIU8.1
#=GS G5HBJ4_9BACT/2-628        AC G5HBJ4.1
#=GS A0A1T4LB04_9SPIO/26-721   AC A0A1T4LB04.1
#=GS A0A0A2F374_PORCN/1-651    AC A0A0A2F374.1
#=GS A0A4Q5SSR4_9BACT/42-731   AC A0A4Q5SSR4.1
#=GS A0A257HTP1_9BACT/44-736   AC A0A257HTP1.1
#=GS R7DDJ6_9BACT/1-234        AC R7DDJ6.1
#=GS A0A4U2LFD0_9BACT/38-685   AC A0A4U2LFD0.1
#=GS E1RA53_SEDSS/39-741       AC E1RA53.1
#=GS A0A1H7Z503_9BACT/4-615    AC A0A1H7Z503.1
#=GS A0A0A2DUG5_9PORP/8-663    AC A0A0A2DUG5.1
#=GS A0A133YAR7_9BACT/3-616    AC A0A133YAR7.1
#=GS J6GZU9_9PORP/9-663        AC J6GZU9.1
#=GS A0A2W7P7P9_9BACT/3-634    AC A0A2W7P7P9.1
#=GS A0A143XTY3_9BACT/54-575   AC A0A143XTY3.1
#=GS E7RPZ4_9BACT/3-608        AC E7RPZ4.1
#=GS F8N5M1_9BACT/3-617        AC F8N5M1.1
#=GS S6A3Y7_9SPIO/43-724       AC S6A3Y7.1
#=GS B7FVS4_PHATC/44-550       AC B7FVS4.1
#=GS A0A1M4VJH5_9BACT/42-729   AC A0A1M4VJH5.1
#=GS A0A512BHK6_9BACT/46-737   AC A0A512BHK6.1
#=GS U2P8G2_9BACT/1-614        AC U2P8G2.1
#=GS F3PRS1_9BACE/3-657        AC F3PRS1.1
#=GS F5IXU2_9BACT/3-657        AC F5IXU2.1
#=GS Q5LHM9_BACFN/5-659        AC Q5LHM9.1
#=GS A0A1T4L0R5_9BACT/44-737   AC A0A1T4L0R5.1
#=GS A0A3P2A6P7_9BACE/5-659    AC A0A3P2A6P7.1
#=GS A0A485LRB8_9STRA/35-537   AC A0A485LRB8.1
#=GS F2NS49_TRES6/24-740       AC F2NS49.1
#=GS A0A662XKJ1_9STRA/153-617  AC A0A662XKJ1.1
#=GS A0A1T4TJ24_9BACT/41-731   AC A0A1T4TJ24.1
#=GS A0A1Z5KAS6_FISSO/42-541   AC A0A1Z5KAS6.1
#=GS A0A069D6F5_9BACE/4-658    AC A0A069D6F5.1
#=GS A0A1I2RSH1_9BACT/4-618    AC A0A1I2RSH1.1
#=GS A0A1C2BVZ0_9PORP/4-658    AC A0A1C2BVZ0.1
#=GS R6PUZ6_9BACT/4-606        AC R6PUZ6.1
#=GS A0A2Z3MRE6_9BACT/42-731   AC A0A2Z3MRE6.1
#=GS A0A5C1QPA8_9SPIO/42-718   AC A0A5C1QPA8.1
#=GS A0A2R5GJ84_9STRA/23-546   AC A0A2R5GJ84.1
#=GS G5AEJ0_PHYSP/33-430       AC G5AEJ0.1
#=GS A0A024FUA6_9STRA/42-550   AC A0A024FUA6.1
#=GS W4G7Q0_9STRA/38-413       AC W4G7Q0.1
#=GS A0A1M6V3V8_9BACT/41-730   AC A0A1M6V3V8.1
#=GS K3WT23_GLOUD/42-573       AC K3WT23.1
#=GS A0A517Y361_9BACT/40-540   AC A0A517Y361.1
#=GS A0A421FI25_9STRA/203-542  AC A0A421FI25.1
#=GS R5X1S2_9BACT/51-581       AC R5X1S2.1
#=GS A0A4Y1WT27_9BACT/51-442   AC A0A4Y1WT27.1
#=GS R5X1S2_9BACT/6-57         AC R5X1S2.1
#=GS A0A4R3VU25_9SPHI/38-723   AC A0A4R3VU25.1
#=GS A0A067CA14_SAPPC/32-544   AC A0A067CA14.1
#=GS A0A484DYX9_BRELC/38-289   AC A0A484DYX9.1
#=GS A0A415DIP2_9BACT/4-658    AC A0A415DIP2.1
#=GS A0A4P7DWV4_9SPHI/42-717   AC A0A4P7DWV4.1
#=GS A0A5B8UFP9_9BACT/39-726   AC A0A5B8UFP9.1
#=GS W2Z3V0_PHYPR/38-554       AC W2Z3V0.1
#=GS A0A2T8HM90_9SPHI/43-718   AC A0A2T8HM90.1
#=GS C5K8Q3_PERM5/204-390      AC C5K8Q3.1
#=GS A0A1I2GSI9_9BACT/6-660    AC A0A1I2GSI9.1
#=GS A0A098C0E4_9BACT/4-658    AC A0A098C0E4.1
#=GS A0A0C1IGG8_9BACT/42-731   AC A0A0C1IGG8.1
#=GS A0A1M5G7Q5_9BACE/4-658    AC A0A1M5G7Q5.1
#=GS A0A1H9EX99_9SPIO/27-726   AC A0A1H9EX99.1
#=GS R6EW46_9BACT/3-614        AC R6EW46.1
#=GS A0A521CSE9_9BACT/3-650    AC A0A521CSE9.1
#=GS A0A1Y4ALV1_9BACT/54-576   AC A0A1Y4ALV1.1
#=GS A0A562T5Z7_CHIJA/42-736   AC A0A562T5Z7.1
#=GS A0A2U0ZDG2_9BACT/44-738   AC A0A2U0ZDG2.1
#=GS A0A448YYF7_9STRA/205-674  AC A0A448YYF7.1
#=GS A0A4Q8RTZ7_9BACT/4-658    AC A0A4Q8RTZ7.1
#=GS A0A6F9ZGS1_9BACT/4-658    AC A0A6F9ZGS1.1
#=GS A0A482SK99_9ARCH/195-515  AC A0A482SK99.1
#=GS A0A3N2MVP5_9BACT/3-648    AC A0A3N2MVP5.1
#=GS A0A254RG24_9BACT/33-561   AC A0A254RG24.1
#=GS A0A4R2EBZ4_9BACT/41-720   AC A0A4R2EBZ4.1
#=GS U2IXU4_9SPHI/42-724       AC U2IXU4.1
#=GS A0A1I1ITY1_9SPHI/42-727   AC A0A1I1ITY1.1
#=GS A0A2S9JGE3_9SPHI/42-731   AC A0A2S9JGE3.1
#=GS W7U6L5_9STRA/55-432       AC W7U6L5.1
#=GS A0A4Q0J0N7_9BACT/3-628    AC A0A4Q0J0N7.1
#=GS A0A512RDK2_9BACT/42-735   AC A0A512RDK2.1
#=GS A0A1V9FVE3_9BACT/42-735   AC A0A1V9FVE3.1
#=GS A0A1T5KN27_9BACT/43-734   AC A0A1T5KN27.1
#=GS A0A0M3C9B9_9SPHI/41-726   AC A0A0M3C9B9.1
#=GS A0A3S1CQ45_9BACT/41-731   AC A0A3S1CQ45.1
#=GS C3J9H9_POREA/13-660       AC C3J9H9.1
#=GS A0A5P2FZR3_9BACT/43-728   AC A0A5P2FZR3.1
#=GS R6X8B8_9BACT/4-613        AC R6X8B8.1
#=GS A0A329SKK5_9STRA/39-554   AC A0A329SKK5.1
#=GS R6E856_9BACE/4-659        AC R6E856.1
#=GS W0EUK6_9BACT/4-658        AC W0EUK6.1
#=GS A0A3L8ADE5_9BACE/4-658    AC A0A3L8ADE5.1
#=GS E0NPP0_9BACT/16-606       AC E0NPP0.1
#=GS A0A1Y3VAC0_9BACT/52-575   AC A0A1Y3VAC0.1
#=GS D8DVN1_PREBR/4-599        AC D8DVN1.1
#=GS A0A419W4Y7_9BACT/6-660    AC A0A419W4Y7.1
#=GS A0A1I5Z269_9BACT/44-736   AC A0A1I5Z269.1
#=GS C7PCB1_CHIPD/43-736       AC C7PCB1.1
#=GS A0A437PRI1_9BACT/41-709   AC A0A437PRI1.1
#=GS D5EVI0_PRER2/4-603        AC D5EVI0.1
#=GS A0A1H4AHA9_9BACT/4-613    AC A0A1H4AHA9.1
#=GS A0A2T5C700_9DELT/1-129    AC A0A2T5C700.1
#=GS G1WBJ6_9BACT/1-614        AC G1WBJ6.1
#=GS A0A1H3WQQ1_9BACT/42-736   AC A0A1H3WQQ1.1
#=GS A0A3N4QKE7_9BACT/42-731   AC A0A3N4QKE7.1
#=GS A0A1N6N564_9SPIO/51-718   AC A0A1N6N564.1
#=GS R5I224_9BACT/5-660        AC R5I224.1
#=GS A0A3N2N7V4_9BACT/79-558   AC A0A3N2N7V4.1
#=GS A0A1W9N6S8_9SPIO/23-682   AC A0A1W9N6S8.1
#=GS G8TPC3_NIAKG/42-735       AC G8TPC3.1
#=GS F9D8R2_9BACT/3-600        AC F9D8R2.1
#=GS A0A1R3T8W8_9BACT/4-658    AC A0A1R3T8W8.1
#=GS A0A3N2M144_9BACT/67-570   AC A0A3N2M144.1
#=GS A0A4R6IXJ4_9BACT/44-736   AC A0A4R6IXJ4.1
#=GS W7Y5M9_9BACT/3-651        AC W7Y5M9.1
#=GS A0A1M4X3C3_9BACT/42-733   AC A0A1M4X3C3.1
#=GS A0A4R1LZX2_9SPHI/42-736   AC A0A4R1LZX2.1
#=GS G0GBI4_SPITZ/26-462       AC G0GBI4.1
#=GS A0A1B1S881_9BACT/4-654    AC A0A1B1S881.1
#=GS R6SVY6_9BACE/4-659        AC R6SVY6.1
#=GS K5Y9S5_9BACT/7-661        AC K5Y9S5.1
#=GS R5C5X4_9BACE/25-679       AC R5C5X4.1
#=GS W4G6I9_9STRA/41-493       AC W4G6I9.1
#=GS K8YVE9_NANGC/20-254       AC K8YVE9.1
#=GS A0A1H6CFG5_9SPHI/42-712   AC A0A1H6CFG5.1
#=GS A0A239RHX5_9BACT/4-602    AC A0A239RHX5.1
#=GS H3H1Y3_PHYRM/2-339        AC H3H1Y3.1
#=GS A0A4R3KMI4_9SPHI/42-765   AC A0A4R3KMI4.1
#=GS W0EZ61_9BACT/41-733       AC W0EZ61.1
#=GS D8E096_PREBR/48-483       AC D8E096.1
#=GS A0A374VD27_9BACE/3-657    AC A0A374VD27.1
#=GS C5LT92_PERM5/45-555       AC C5LT92.1
#=GS A0A5D6XUZ0_9STRA/91-621   AC A0A5D6XUZ0.1
#=GS A0A2T7QCA7_9BACT/42-734   AC A0A2T7QCA7.1
#=GS A0A0K8QTP7_9BACT/10-664   AC A0A0K8QTP7.1
#=GS A0A386HMX1_9BACT/43-735   AC A0A386HMX1.1
#=GS R5KTH3_9BACT/4-596        AC R5KTH3.1
#=GS A0A174V4F5_BACUN/3-657    AC A0A174V4F5.1
#=GS A0A1C3Z7L5_9BACT/42-732   AC A0A1C3Z7L5.1
#=GS A0A1M6WMU2_9BACT/33-548   AC A0A1M6WMU2.1
#=GS A0A4R1B385_9BACT/42-730   AC A0A4R1B385.1
#=GS A0A6H5K4J9_9PHAE/294-557  AC A0A6H5K4J9.1
#=GS X5DE87_9BACT/9-663        AC X5DE87.1
#=GS A0A4Q7MAH1_9BACT/42-734   AC A0A4Q7MAH1.1
#=GS R5IQU5_9BACT/5-659        AC R5IQU5.1
#=GS A0A1H0HZN4_9BACT/4-604    AC A0A1H0HZN4.1
#=GS A0A196SPR9_BLAHN/31-467   AC A0A196SPR9.1
#=GS G8QY50_SPHPG/44-729       AC G8QY50.1
#=GS A0A1Y4C8V5_9BACT/3-618    AC A0A1Y4C8V5.1
#=GS A0A0W8C2Q3_PHYNI/38-555   AC A0A0W8C2Q3.1
#=GS A0A0E9N8K4_9BACT/42-729   AC A0A0E9N8K4.1
#=GS A0A2T0WXK9_9BACT/4-658    AC A0A2T0WXK9.1
#=GS A0A4Y8L8J1_9BACT/3-657    AC A0A4Y8L8J1.1
#=GS A0A3L8A0P8_9BACT/3-651    AC A0A3L8A0P8.1
#=GS A0A662X748_9STRA/167-568  AC A0A662X748.1
#=GS A0A4Q1CF75_9BACT/42-708   AC A0A4Q1CF75.1
#=GS A0A174WGH3_9BACE/18-672   AC A0A174WGH3.1
#=GS W4P8A2_9BACE/4-616        AC W4P8A2.1
#=GS A0A0C1KPA7_9BACT/42-731   AC A0A0C1KPA7.1
#=GS Q7MTP4_PORGI/8-662        AC Q7MTP4.1
#=GS F4KKJ2_PORAD/1-658        AC F4KKJ2.1
#=GS A0A1H3CIN6_9BACE/21-675   AC A0A1H3CIN6.1
#=GS W2Q3U7_PHYPN/38-555       AC W2Q3U7.1
#=GS D9SBE7_FIBSS/50-584       AC D9SBE7.1
#=GS A0A5C1QGW6_9SPIO/40-712   AC A0A5C1QGW6.1
#=GS A0A1M6M0L0_9BACT/10-664   AC A0A1M6M0L0.1
#=GS A0A1M5C8P4_9BACT/3-657    AC A0A1M5C8P4.1
#=GS A0A396M6F7_9BACT/484-616  AC A0A396M6F7.1
#=GS A0A4Y1WT27_9BACT/443-573  AC A0A4Y1WT27.1
#=GS A0A2S5A156_9SPHI/41-728   AC A0A2S5A156.1
#=GS A0A370AU59_9SPIO/42-716   AC A0A370AU59.1
#=GS A0A6I6JJI1_9BACT/10-664   AC A0A6I6JJI1.1
#=GS A0A1I5K1T3_9BACT/4-611    AC A0A1I5K1T3.1
#=GS A0A2V3PLW3_9BACT/3-657    AC A0A2V3PLW3.1
#=GS A0A1A9HZ91_9BACT/41-733   AC A0A1A9HZ91.1
#=GS A0A1T5K497_9BACT/3-660    AC A0A1T5K497.1
#=GS A0A4V5MKB4_9SPHI/42-725   AC A0A4V5MKB4.1
#=GS A0A1I6VZN9_9SPHI/41-720   AC A0A1I6VZN9.1
#=GS H1XPF7_9BACT/41-722       AC H1XPF7.1
#=GS A0A399D8B6_9BACT/10-664   AC A0A399D8B6.1
#=GS A0A1Z5KA40_FISSO/43-545   AC A0A1Z5KA40.1
#=GS D3ILB9_9BACT/3-593        AC D3ILB9.1
#=GS A0A1F1DUM3_9PORP/1-653    AC A0A1F1DUM3.1
#=GS D8I9Y1_BRAP9/23-668       AC D8I9Y1.1
#=GS E4T878_PALPW/4-655        AC E4T878.1
#=GS A0A374W9W8_9BACE/4-658    AC A0A374W9W8.1
#=GS A0A2P8CEI1_9BACT/5-659    AC A0A2P8CEI1.1
#=GS A0A1M4WA10_9BACE/4-658    AC A0A1M4WA10.1
#=GS A0A095ZH30_9BACT/3-616    AC A0A095ZH30.1
#=GS D8LVS2_BLAHO/7-209        AC D8LVS2.1
#=GS A0A2S2DX75_9BACT/41-716   AC A0A2S2DX75.1
#=GS A0A024U2H3_9STRA/37-517   AC A0A024U2H3.1
#=GS A0A6H5K4J9_9PHAE/45-298   AC A0A6H5K4J9.1
#=GS A0A060REM3_9BACT/3-657    AC A0A060REM3.1
#=GS A0A2N8N867_9BACT/3-414    AC A0A2N8N867.1
#=GS A0A3P5VJM4_9SPIR/25-691   AC A0A3P5VJM4.1
#=GS G0J7R8_CYCMS/42-735       AC G0J7R8.1
#=GS Q8A5I2_BACTN/4-658        AC Q8A5I2.1
#=GS R6WUC7_9BACT/54-577       AC R6WUC7.1
#=GS F8EZM5_TRECH/46-753       AC F8EZM5.1
#=GS A0A1Y4HLV2_9BACT/3-657    AC A0A1Y4HLV2.1
#=GS A0A1G7KU69_9BACT/1-560    AC A0A1G7KU69.1
#=GS A0A108TAK1_BACSE/3-657    AC A0A108TAK1.1
#=GS A0A1M4VIQ2_9BACT/10-664   AC A0A1M4VIQ2.1
#=GS A0A0B8T2I2_9SPHI/41-727   AC A0A0B8T2I2.1
#=GS A0A264Y7R5_9BACT/3-614    AC A0A264Y7R5.1
#=GS A0A1G4G9S0_9BACT/4-658    AC A0A1G4G9S0.1
#=GS A0A1G6TT63_9BACT/41-733   AC A0A1G6TT63.1
#=GS A0A5J5ICS6_9BACT/42-703   AC A0A5J5ICS6.1
#=GS A0A1J1E9U7_9FLAO/41-732   AC A0A1J1E9U7.1
#=GS A0A0A2F1T7_9PORP/8-663    AC A0A0A2F1T7.1
#=GS A0A1V9ZHC0_9STRA/32-544   AC A0A1V9ZHC0.1
#=GS A0A399D1U7_9BACT/2-655    AC A0A399D1U7.1
#=GS I9GWI0_9BACE/5-659        AC I9GWI0.1
#=GS C5K8Q3_PERM5/385-588      AC C5K8Q3.1
#=GS A0A0M2XXT2_9SPHI/41-722   AC A0A0M2XXT2.1
#=GS A0A1Q2MCK0_9BACT/5-657    AC A0A1Q2MCK0.1
#=GS A0A1H4FVX4_9BACT/41-730   AC A0A1H4FVX4.1
#=GS A6L1G8_BACV8/4-658        AC A6L1G8.1
#=GS F8WZV8_9BACT/3-657        AC F8WZV8.1
#=GS R6C6Z1_9BACT/4-602        AC R6C6Z1.1
#=GS A0A1M7L879_9BACT/42-734   AC A0A1M7L879.1
#=GS Y851_TREPA/42-719         AC O83823.1
#=GS F0RX97_SPHGB/44-726       AC F0RX97.1
#=GS A0A174K0N3_9BACE/4-658    AC A0A174K0N3.1
#=GS R6MK87_9BACE/4-658        AC R6MK87.1
#=GS A0A3N4MEV2_9BACT/42-733   AC A0A3N4MEV2.1
#=GS A0A1T4JJ20_9SPIO/24-722   AC A0A1T4JJ20.1
#=GS R5PGQ4_9BACT/3-614        AC R5PGQ4.1
#=GS A0A421K8I3_9SPIR/1-637    AC A0A421K8I3.1
#=GS L1NHP2_9BACT/2-592        AC L1NHP2.1
#=GS A0A4U3L040_9BACT/44-739   AC A0A4U3L040.1
#=GS A0A024U0N0_9STRA/37-520   AC A0A024U0N0.1
#=GS D8E096_PREBR/5-56         AC D8E096.1
#=GS A0A1N6KHJ6_9BACT/42-728   AC A0A1N6KHJ6.1
#=GS A0A173MLA4_9BACT/44-741   AC A0A173MLA4.1
#=GS E6K3J9_9BACT/5-597        AC E6K3J9.1
#=GS A0A2X4PLN5_9PORP/6-650    AC A0A2X4PLN5.1
#=GS E6SSU1_BACT6/3-657        AC E6SSU1.1
#=GS A0A255SZG8_9BACT/4-617    AC A0A255SZG8.1
#=GS A0A1V9ZYU4_9STRA/37-546   AC A0A1V9ZYU4.1
#=GS H1HMK2_9BACT/1-615        AC H1HMK2.1
#=GS A0A088F162_9SPHI/41-725   AC A0A088F162.1
#=GS F5YQY5_TREPZ/43-738       AC F5YQY5.1
#=GS H8KQU0_SOLCM/41-723       AC H8KQU0.1
#=GS A0A291QZY6_9BACT/42-731   AC A0A291QZY6.1
#=GS A0A2S9JIC3_9SPHI/41-725   AC A0A2S9JIC3.1
#=GS A0A6A3F5H9_9STRA/33-548   AC A0A6A3F5H9.1
#=GS A0A0A0X0X4_9SPIO/42-728   AC A0A0A0X0X4.1
#=GS A0A5B8VQK0_9BACT/42-732   AC A0A5B8VQK0.1
#=GS D7JFI7_9BACT/2-625        AC D7JFI7.1
#=GS A0A1H4EDX9_9BACT/53-442   AC A0A1H4EDX9.1
#=GS R5VAS6_9BACT/7-661        AC R5VAS6.1
#=GS A0A2P8HKN5_9BACT/41-731   AC A0A2P8HKN5.1
#=GS A0A2U2BB35_9BACT/4-658    AC A0A2U2BB35.1
#=GS A0A521BLI5_9SPHI/41-724   AC A0A521BLI5.1
#=GS F4LPZ4_TREBD/25-710       AC F4LPZ4.1
#=GS C5LN64_PERM5/45-565       AC C5LN64.1
#=GS A0A1F0FX82_9PORP/1-661    AC A0A1F0FX82.1
#=GS A0A1T4KX03_9PORP/1-631    AC A0A1T4KX03.1
#=GS A0A553GSC1_9BACT/4-658    AC A0A553GSC1.1
#=GS A0A4U2LEA9_9BACT/11-665   AC A0A4U2LEA9.1
#=GS A0A5R9QMU6_9BACT/3-653    AC A0A5R9QMU6.1
#=GS R5VUQ7_9BACE/5-659        AC R5VUQ7.1
#=GS A0A1E7FR13_9STRA/183-531  AC A0A1E7FR13.1
#=GS A0A3R6INC7_9BACT/7-661    AC A0A3R6INC7.1
#=GS W4G6L3_9STRA/41-499       AC W4G6L3.1
#=GS F9ZCM7_ODOSD/3-657        AC F9ZCM7.1
#=GS A0A0L0F4U8_9EUKA/1-205    AC A0A0L0F4U8.1
#=GS A0A099BV64_9BACT/1-597    AC A0A099BV64.1
#=GS A0A4R4BR74_9SPIO/43-497   AC A0A4R4BR74.1
#=GS M4BIJ5_HYAAE/41-561       AC M4BIJ5.1
#=GS A0A0E9LZP2_9BACT/3-657    AC A0A0E9LZP2.1
#=GS A0A399SW77_9BACT/9-662    AC A0A399SW77.1
#=GS R7ZR45_9BACT/42-729       AC R7ZR45.1
#=GS A0A191TIY0_9BACT/42-731   AC A0A191TIY0.1
#=GS D0P271_PHYIT/45-561       AC D0P271.1
#=GS A0A4Q0J584_9BACT/1-182    AC A0A4Q0J584.1
#=GS A0A1Y2RGA8_9BACT/42-733   AC A0A1Y2RGA8.1
#=GS A0A4S4HDU8_9BACT/4-650    AC A0A4S4HDU8.1
#=GS A0A4Q1D7Y0_9BACT/44-737   AC A0A4Q1D7Y0.1
#=GS T0RJH5_SAPDV/32-538       AC T0RJH5.1
#=GS A0A1H3DI07_9BACT/44-735   AC A0A1H3DI07.1
#=GS D1VYA2_9BACT/1-578        AC D1VYA2.1
#=GS A0A1X7LAX0_9SPHI/41-724   AC A0A1X7LAX0.1
#=GS A0A1I1X663_9BACT/4-658    AC A0A1I1X663.1
#=GS A0A0L8V2H2_9BACT/6-660    AC A0A0L8V2H2.1
#=GS A0A1I7NDL1_9BACT/41-735   AC A0A1I7NDL1.1
#=GS R5BL39_9BACE/43-734       AC R5BL39.1
#=GS A0A2M9A6A2_9BACT/32-511   AC A0A2M9A6A2.1
H7EHX6_9SPIO/24-715                  .............................................................................................................................................k-RHLTPDEIDILSA.T.NTNS..DD.tWMN.V...W...V.........D...E.........R..gF.D.....C.........S.........LVRNNEIRGY...LVL..GVLRR.VN..LR...YHD..L..CL.CAGLYGSNVE.NVVL...GS.D.....VCVRN..........V.....-A.......YFS..N..YI........IDDKVILFNIQEM.....S.........C.T........N..H..........SKFGNGILkegep...........esnriwIGVGNEN.DA.RAVLPFESM................I.PADAFIW..............S..R.Y..R.E..DSA..L.MARFKEMT.ED.MF.L........RTA.D..T.KG..F..VGSNTVIKNTTLLK.D..VKVGENAYIKGAFKLKNITI.LS...SED...E..P...SQVGEGVELVNGIVGYRARIFYQAVAVRFVIGRNCQLKYGARLLNSVLGDNSTVSCCEILNNLIFPFHEQHHNSSFLIASTVc.gqSNIASGAt..vGSNH.NSR----SPDGELFAGRGFWPGLCSDFKHN.........S..RF..A..SFVLVSkGSYQ.NELNIP-YPFSLV.......A..S..........Ng.....sN..K..P.......V..S........VI.PAYwf.....................lyNM..Y..A..I.A.........-...-.RNGQKFLKRDG.RL.V...K..V..Q..--HIETNPLAPDTIQEVVSSISRII.....E..LT.SR.Y..L..VS........RGDgaasgaitedgrl..........................................qvakdflhknpsasFVLQ.DMD.C........QRkfgaN....I...LKp.....vKA.....YKEY...R..KIVKYFAV.SVLI..D.Y.......CAAR....R.I...P.Sl.nW....RE.IERIA....E.-..--FP.L..Y.T.EWVNVGGQVVPREKL.GELFSLVKSREID.S.WEAVHAFYDKCEAK...YLTYKVAYAIYL.LEFL..YS.......RP......F..L.E...F.DASVFDDIAAD.V.TAVSDE....MCSSAYASRRKDYE.CFF...R-----...-KITFR.NDEEMRAVL.GT.L..EDNEFLADMKRRTAE------------fdarltvi..............................................................
D7VMI2_9SPHI/42-727                  ..............................................................................................................................................FRHLTQEQIQILRS.N.GNTA..DE..WSN.I...L...V.........T...D.........H...F.I.....P.........E.........QIRGCRFYGL...NRI..GDMEP.IY..LD...YRE..L..RL.PTGIYHSTIV.SCDI...GN.H.....VAIHE..........V.....-S.......YMS..Y..FI........IADEVILSNIDEM.....Q.........T.S........S..K..........AKFGNGILrages...........pdvrvaLELRNEN.GG.RKVWPFDGM................L.LSDAYLW..............T..R.H..R.D..DEI..F.QSKLEQMT.NA.RH.T........SKR.G..T.YS..T..IDTGTVIKNCQVIK.D..VRIGGQAYIKGVNKLKNVTI.HS...SET...A..P...TQIGEGCELVNGIIGEGCRIFYGVKAVRFILAAHSQLKYGARLINSFLGENSTISCCEVLNSLIFPAHEQHHNNSFLCASLIm.gqSNMAAGAt..vGSNH.NSR----SPDGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.YEMDIR-IPFSLVs.....nH..T..........T.......E..D..R.......L..I........IV.PGYwf.....................lhNM..Y..A..L.A.........-...-.RNPSKYEARDK.RS.E...K..K..Q..--YYEYDILAPDTINELFESLQIMK.....T..AV.AK.A..Y..YS........AEIladqeailrgaeil........................................esdedishldilldhFENS.KRK.V........QL....M....K...VR.......QG.....YKLF...K..RLIRYYGA.SALA..G.Y.......SD--....-.-...-.Q...M....EH.TLQLL....Q.Q..EVSW.E..R.E.DWVNIGGQLIPASRY.KELIHQLKTDQLN.S.WDEVHAYYFAQSDQ...YQQDKTIHAVSA.LAEL..NN.......LK......V..S.E...I.TKEHLIVLFEE.A.LEIKQW....ITEEIYQTRAKDYQ.NSF...R-----...-MMVYD.SKEEMDKVV.GA.L..ENNSFIRQQKEEFKYYQERIADKIA--ql....................................................................
A0A0P1AGH3_PLAHL/27-541              ..............................................................................................................................................YYELSDAEVRALEA.N.GNSA..EN..WHN.V...RktnA.........E...A.........Q...L.Q.....T.........S.........LIRQNTFHGK...VVL..GCFSA.SF.cHD...VDG..I..SF.ASGVYNSALK.NVVV...LD.E.....ALVKD..........T.....-M.......VLR..D..VL........VDAQASIIKCTSV.....T.........G.S........K..Nk.......daVVSANGNS......................LHVGVET.GG.RDLRIVADL................S.FKLGVAV..............V..T.Q..R.N..DVD..F.LTAYNSFV.DK.YV.A........AVK.A..P.MA..I..VAQSARVRGCNRVQ.E..SFVGHFATIEDSD-VVNSTI.LS...TKE...E..P...SVIKDKSHVSDSILQWNSTIEALSIVQDTFLCDTTHVERHGIVISSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQEFYPGEGCFFGLGCNIKFP.........C..NFekA..PYSVVA.TAVT.MLPQLLSMPFALIntp.ahvI..Ps........lS.......P..A..M.......N..E........IF.PGW.........................VL..Y..S.sVfT.........V...L.RNENKFHLRNK.SK.R...T..-..-..--QIDADIFRKEIVEYMKDARAALR.....A..AE.GK.A..Q..V-........--Ilpngea........................................................vhtdkqvRGLG.KNY.M........RE....S....S...RR.......EA.....ITTY...T..FFIKLFAL.KALF..K.R.......VESG....Q.V...S.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------idgtvgi...............................................................
A0A373ZWU2_9BACT/53-575              ..........................................................................................................................................eari--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........V.....RS.......RVA..N..YR........IGTGSLVEGVTAL.....E.........C.R........R..R..........SAFGNGVG......................VATMNEC.GG.RTVKIFDRL................S.AQVAYVM..............A..V.Y..R.H..RPQ..T.IAALEKMV.DA.YA.E........ERS.S..E.IG..E..VGSDCRIVGARFIR.E..VRIGNGVEIDGASILENATL.C-...---...D..G...ARVGVDVKAYDLIAAEGSVIDNGSIVERCFVGESCRLDKGFTAAESLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGAVHQSVHLRGCKFASSAYIMSP.........A..LE..G..AFTMVM.GHHS.YHHDTSAFPYSYL.......I..E..........K.......E..G..R.......T..H........LM.PGA.........................NL..T..S..F.G.........A...V.RDIEKWPARDR.RS.V...K..R..-..-DVISFDEYNPYITGAMLQAVDILH.....S..LQ.EQ.-..D..PD........APV.....................................................................FTHN.KTL.I........RS....A....A...LQ.......RG.....LKLY...N..KAIVAALG.AMLS..R.G.......----....-.-...-.-...-....--.----G....S.D..PRYD.G..D.G.QWLDLGGQYITRRET.EAILAAVDRGELT.T.TEAVDNRFRVFAVH...YDDYAHSWAKQV.YAAL..LG.......HT......P..-.-...-.TVDEIDEAISA.G.HNAHAS....MRRTTDADRDRDCS.LDM...AVSYGL...DCTSEEeRREDYYSVR.G-.-..---------------------------l.....................................................................
A0A4S8I0M4_9BACT/42-735              ..............................................................................................................................................YRHLSAYEIEVLVR.N.RNTS..DN..WNN.L...L...V.........S...D.........A...F.N.....P.........E.........LVQNCKFFGL...VRI..GKLEP.YY..LE...YHN..L..RR.PVGFYNSTVI.SCDF...GD.N.....VVVDN..........V.....-N.......YIS..H..YI........IGNGVILVNCNEI.....A.........T.T........D..H..........SKFGNGILkegep...........eniriwMELCNEN.AG.RSILAFDGI................L.PGDAFLW..............T..Y.F..R.D..DEK..L.LNRFKEFT.EK.KF.D........ALR.G..Y.YG..T..IGDRTVIKNCRIIK.D..VKIGSDAYLKGANKIKNVTI.NS...SSE...A..N...TQVGEGCELVNGIIGYGCRLFYGVKAVRFVLASHSQLKYGARLINSYLGDNSTISCCEVLNSLIFPSHEQHHNNSFLCAALVq.gqSNMAAGAt..vGSNH.NSR----SPDGEIIAGRG---------FWPglcvslkhnS..KF..A..CYSILAkGDYA.TELNIP-IPFSLI.......S..Nd........lS.......K..D..Q.......L..V........VM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNAWKYVDRDK.RT.D...K..T..Q..--TLEFHFLAPDSVNDILQSLPLLQ.....K..FT.GK.A..W..LK........QQGnnkkmsdeeiisigqvl...................................ldtkdpvvnelailadnFENS.RRP.V........RV....I....K...VM.......RS.....YHLF...K..ELVMYYLV.QQLL..E.H.......IHIN....N.I...K.T...H....EQ.LIESL....P.A..KTA-.-..I.N.QWMNVGGQLILRSEI.DKLNKQVVAGKIK.D.WEAVHNFYVQQGKN...YQNEKLVHAMAA.VKEV..FD.......IN......V..K.K...A.SPGIIKSLLHQ.S.IATREW....MVKEIYESRAKDYR.NPF...R-----...--KMVYeTTEAMNKVV.GK.L..EDNSFIKQEQKALEEYKAAIQQLVNKL......................................................................
A0A1H4EDX9_9BACT/445-575             ..........................................................................................................................................dphy--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..---D.G..S.G.RWLDLAGQYITRREV.AAILDAVDRGELT.T.PAAVDNRFRVFAVH...YDDYAHSWAVQV.YASM..LG.......HT......P..-.-...-.TAGELDDAVAA.G.RNAHEA....MRRTTDADRDRDCS.LDM...AVSYGL...DCDNDDdRREDYYTVR.G-.-..---------------------------l.....................................................................
A0A5C6HE05_9BACT/3-657               ..............................................................................................................................................YRHLTEDEILQLKS.Q.FCLA..DD..WGK.V...M...V.........A...K.........D...F.A.....T.........S.........FIHHTRFSGE...VRL..GVFLS.EF..IL...PGG..I..KK.HSGLRHVTLH.NVTV...GN.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.E........G..L..........SKFGNGVE......................VSVLNET.GG.REVLISDKL................S.AHQAYIM..............A..L.Y..R.H..RPE..L.INRMKAIT.DF.YS.S........KHS.S..D.IG..T..IGNHAMILNTGSIR.N..VRIGDYCRICGTCRLTNGSI.NS...NAE...A..P...VHVGHGVICDDFIISSGSHIDDGAMLTRCFIGQACRLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...Q..N..K..LDYINYNLLSPYTVQKMLKGRETLL.....N..LR.KA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IQFY...E..IAIHKFLG.NSII..K.R.......LEGI....H.F...E.N...D....ET.IRARL....R.P..NTSI.G..G.G.EWVDISGLITPKSEV.DILIFDIESGKIN.R.LKHINAEFERMHQN...YYTYEWTWAYDK.IEEF..YG.......YK......P..E.E...I.TASQICSIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRVE.KELDFEQVR.GD.F..ESNPFVKAVLKHIEDKTALGDELISRL......................................................................
A0A1K1PSD0_9BACT/42-735              ..............................................................................................................................................YRHLSALEIETLVR.N.DNTS..DN..WNN.I...S...V.........T...N.........E...F.N.....P.........Q.........LVKHCHFFGL...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YL........IGNEVMICNVNEM.....A.........T.T........G..H..........AKFGNGIVkdgep...........esvriwLELCNEN.GG.RSIMPFDGM................L.PGDAWLW..............T..R.N..R.D..DKA..L.QDQFKSFT.EQ.QF.D........KKR.G..Y.YG..M..VGDRCVIKNVSILK.D..VMIGTDAYLKGANKIKNVTI.NS...SAE...A..T...TQIGEGCELVNGIVGYGCRVFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GPDGEIIAGRG---------FWPglcvslkhnS..RF..A..TFTLIAkGNYM.AEMDIP-FPFSLV.......IndE..........Q.......H..N..C.......L..K........IM.TGYwf.....................lhNM..Y..A..L.A.........-...-.RNSWKYLDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEMIHAMALME.....A..AT.GK.A.wY..LH........TATdyseltemdyrqkgqdl...................................llnhpndvaklkilvkgVENS.NRE.V........LL....L....K...VH.......KT.....YPLF...R..ALIVLYAV.KNVM..Q.F.......VETN....D.I...K.T...F....EA.IHNI-....-.-..ALTA.Q..R.E.SWHNVGGQLMPASTL.HTLKEEIRANKLN.S.WADLHAKYQEIGSQ...YATDKLQHAIAS.LLYV..QE.......KT......I..A.D...F.NIDFFDECLQA.S.IQTQTV....LTENIQKSRAKDYE.NPF...R-----...--KMTYeNEAEMDAVV.GK.L..DDNSFIKQTKEDLLVYKQKVKTLIK--ll....................................................................
B3CH69_9BACE/3-657                   ..............................................................................................................................................YRHLTEDEILRLKS.Q.SCLA..DD..WGK.V...T...V.........A...E.........D...F.V.....T.........E.........FVHHTRFSGN...VRL..GVFQS.EF..TL...PGG..I..KK.HSGLRHVTLH.NVSV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..L..........SKFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ICRMKAIT.DF.YS.N........KHA.S..A.IG..S..IGNHVMILNTGSIK.N..VRIGDYCHICGTCRLYNGSI.NS...NEE...A..P...VHLGHGVICDDFIISSGSHIDDGAMLSRCFIGQACRLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...T..N..K..LDFINYNLLSPYTVQKMFKGRETLQ.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IKFY...E..IAIHKFLG.NSVI..K.R.......LEGI....D.F...K.S...N....EE.IRARL....K.P..DTVI.G..S.G.EWVDISGLIAPKSEI.DALINDIECGKVD.R.LKSINAEFEKMHQN...YYTYEWTWAYEK.LEEF..YG.......IK......P..E.N...I.TTADIIRIVEK.W.KEAVVG....LDCMVYDDAKKEFS.LAS...MTGFGA...DGSRAE.KEMDFEQVR.GD.F..ESNPFVTAVLKHIEDKTALGDELISRM......................................................................
R7EWB3_9BACT/2-558                   ........................................................................................................................................raagii-------EIYELER.R.GCSA..SD..WSR.V...Y...I.........E...P.........E...C.D.....L.........S.........RISNVSFSGR...VEI..GAIRE.--..--...---..-..--.---LRNAAIT.DCRI...GA.D.....SSIRN..........I.....GG.......CLR..G..LK........IGRGVTIADCGII.....E.........S.E........P..E..........TTYGLGSE......................VAVLDET.GG.RPAFLYPGL................S.AQVATLM..............T..M.R..P.H..WS-..R.QTLLPLLQ.EK.FG.D........KPF.S..A.--..D..LADGCSVTGCRLMR.N..VYVDRRVRVEGAARLVNGAI.IN...NAA...A..GkdlAAVGNDVDAENFIIEDGFA-GGGTLLRNVYVGQGASLDKGFTAHDSLFFANCAMENGEACAVLAGPYTVSMHKSTLLIGMRT....AFMNAGS....ATNF.SNHMYKLGPVHWGTLQRGVKTASGAYVMWG.........G..KI..G..AFSLVM.GGHK.EHPDTSMFPFSYL......fG..D..........S.......H..G..H.......T..T........AS.PGL.........................ML..R..S..C.G.........L...A.RDEKKWPVRDR.RL.N...R..RmpL..FDNIVYEVLNPNTVQTMLRALPLLQ.....Q..LA.HE.Q..P..DA........QGY.....................................................................VHHG.AVA.L........KP....T....A...AL.......RA.....HRLY...S..LAITAYVY.G---..-.K.......MHEE....G.Y...D.G...-....--.-----....-.A..NPEE.A..P.E.EWLDLAGQIIPADTL.TAVLDPAND-TL-.-.---PQELIDEAFKD...YHRLELSWVKQL.AEGV..WH.......DH......L..S.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------tapqavveleamiekdrndyk.................................................
A0A0A2E7G9_9PORP/11-666              ..............................................................................................................................................YRQLTDTEIDILVN.N.LCIA..DE..WGD.I...E...V.........R...D.........G...F.D.....P.........T.........FCRQVRFSGK...NKL..GAMNA.TY..TE...LGG..I..KT.HSGISHCYLH.NCTI...GD.N.....VVIKN..........V.....HR.......YIA..N..YD........IGDCVCIENVDTI.....V.........V.D........G..F..........SSFGNGVR......................VPVLNET.GG.REVILTNNL................S.SHIAYLM..............A..F.Y..R.H..DEE..L.IKSLFSFA.DS.YA.E........SVK.S..D.RG..K..IGENVKIKDCGSII.N..MYVGAGARLLGVSFLKNGSL.NS...NPE...A..P...VRIGFNVIAENFICASGSSVFDGCTISNCFIGQGTHMGHLFSAHDSLFFANCQAENGEACAVFAGPYTVTMHKSSLLIAGYY....SFLNAGS....GSNQ.SNHLYKLGPIHQGVVERGSKTTSDSYILWP.........S..HI..G..PFSLVM.GRHV.HHVDTSKFPFSYL.......I..E..........E.......H..N..Q.......T..Y........LV.PGV.........................NI..R..S..V.G.........T...I.RDAKKWPNRDK.RT.D...S..K..K..TDCINFNLLSPYTVGKMLHAHRILS.....E..LS.RL.L.cN..DG........NQE.....................................................................YVYR.NMR.I........QS....R....A...LA.......KG.....LHFY...E..MAIVKFLG.NSLI..K.K.......LEDC....P.C...T.S...D....AE.VIEWL....R.P..RTEE.G..L.G.VWLDICGMIAPRSSV.LCILDKVKNGTVN.S.LEELNEEICSLHKN...YYNLEWTWAYNT.ILEW..FG.......LK......P..E.D...L.TRTKVAEIVRK.W.KDCVVS....LDKMLYEDARKEFT.MNT...QVGFGI...DVKGDE.KSADFDTVR.GN.F..ESNPFVLEILDHIEKKSALGDLTLAKL......................................................................
A0A5C8GKZ7_9BACT/3-603               ..............................................................................................................................................YRNLTNEEILVFEN.N.NCWA..ED..WSR.V...Q...V.........A...E.........E..gF.Y.....P.........K.........FFHRVMFYGD...IRL..GSFEK.EV..EV...TKG..F..VK.HSGINDATLR.NVSV...GN.D.....CLIEK..........V.....GN.......YIN..N..YT........IGSDCIITNISVM.....E.........T.T........E..G..........ATYGEGNL......................IAVLNET.GD.SNIIFFHDL................N.SQFAAFM..............V..R.H..F.K..DKD..L.KNAIRRLV.SE.EI.T........RTN.P..D.RG..T..IGNNVKIVNTKEIT.N..TVIQDDCEISGASRLSDCTI.LS...SEN...A..S...VYIGTGVICENSIISDGSSIINSVKMQDCFVGEACQISNGFTAAQSVFFANSFMANGEACAAFCGPFSASHHKSSLLIGGMF....SFYNAGS....GTNF.SNHAYKMGPMHWGVLERGSKTASGGYILMP.........A..TI..G..TFSVCF.GKLM.HHPNTQALPFSYL.......I..A..........G.......G..D..T.......M..F........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDI.RP.I...G..S..Q..KSIVNFDWLSPFSVGEIIRGKKILE.....N..LR.QA.S..G..EN........VSS.....................................................................YIYH.EYV.I........NA....S....S...LN.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......AHKW....G.F...F.G...-....--.-----....K.P..KTQI.G..L.G.KWNDLSGLLLPDTEE.QKLLEDIKSGNLE.T.IQDVLDRFTEIHAN...YRKYQWAWTYRL.IQDY..YG.......I-......-..K.E...I.SEKDNKRIEQD.Y.IEARRA....WIAEIRKDAEKEFA.M--...------...------.---------.--.-..---------------------------gdveeevlt.............................................................
R5CR24_9BACT/4-599                   ..............................................................................................................................................YRLLSDEEIGILEE.N.GCTA..ED..WTS.L...N...V.........D...Y.........D...F.N.....P.........A.........FIRNVRFYGT...VNL..GVFEK.NI..EV...TNG..F..MK.HSGISNATLR.NVTI...GD.N.....CLIEN..........V.....GC.......YIN..N..YV........IGDECCICNVATM.....E.........T.T........A..E..........ATFGEGNT......................ISVLNEA.GN.GNVVLFRGL................T.ANIAVLM..............V..S.H..Q.D..DKD..L.SAALKTMA.RN.DI.S........QRL.A..D.RG..T..IGNRVRITKTTEIT.N..TNIDDNCEVNGACRLSDCTL.AA...APD...D..S...VYIGSGVICENSIIADGSSVLNSAKVFNCYVGEACQITNGFTAESSLFFANTYMANGEACAAFCGPFSASHHKSSLLIGCMT....SFYNAGS....CTNF.SNHAYKMGPVHYGTLERGSKTASGSHTLLP.........A..TI..G..AFSMCM.GKIS.GHPDTRRLPFSYI.......I..G..........T.......G..R..D.......T..I........LV.PGK.........................NI..A..T..V.G.........L...Y.RDISKWPRRDV.RM.E...S..A..K..NTLINYDWLSPFTINEIMEGREELG.....R..LL.RI.Q..G..ED........AAV.....................................................................YEYE.GCK.M........SG....K....S...LR.......RG.....LRLY...D..MAVELFIG.EVLM..S.H.......----....-.-...-.-...-....-D.LDDR-....-.-..CAAS.G..A.G.GWSDLSGLLLPSSEV.ERVIEKIKLGIIS.T.VNDLTEVFVAYNDM...YGEYLWTFTVSL.IKYY..--.......LG......K..D.E...L.TEEDFELMRER.G.KAAREA....WLDEIRRDAEKEFS.MG-...------...------.---------.--.-..---------------------------dvdratld..............................................................
A0A1H7W4M6_9BACT/42-731              ..............................................................................................................................................YRKLNALEIETLVQ.N.DNTS..DD..WNQ.I...F...V.........A...N.........E...F.D.....A.........R.........LVKHCHFFGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YI........IGNEVIIANVNEM.....A.........T.T........D..H..........SKFGNGIIkegep...........envriwLELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.N..R.D..DEA..L.QAKFKAFT.EK.QF.D........KKR.G..Y.YG..L..VGDRSVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...RAG...A..A...SQIGEGCELVNGIIGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..KF..A..SFALIAkGTYM.QELHIP-IPFSLIl.....nS..E..........H.......D..N..T.......L..K........IM.PGYwf.....................lhNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEILTSLPIME.....M..AT.AQ.A..W..YA........AQGqtteqlsenellqkg.......................................kelllqqpeevarltILVH.G--.M........EN....S....Q...RK.......AQ.....LLKV...H..KAYPLFRA.LVVL..Y.G.......IRNI....L.A...Q.G...I....DS.FAALQ....S.L..AKTA.K..R.G.PWINVGGQLMKASTV.DDLKTKIKKGKIS.S.WAQLHETYEQLGQQ...YAQEKLEHAVAS.LLYV..QG.......LN......A..R.T...F.TAERFQQNLEQ.S.VTTMSW....ITEGIYRSREKDYQ.NPY...R-----...-SMTYE.NKADMEAVV.GK.L..EDNSFIQQTITELKQYKKQVKALATKL......................................................................
R6YH31_9BACE/26-680                  ..............................................................................................................................................YRLLTPAEIAQLEK.Q.LCVA..DS..WEN.I...Q...V.........A...E.........N...F.T.....P.........T.........HIHYTRFSGT...IRL..GVFEK.EF..QL...PGG..M..SK.HAGLCRVTLH.NVTV...GD.N.....CCIEN..........V.....KN.......YIA..N..YT........IGHDTFIENVDII.....L.........V.D........R..E..........TSFGNGVE......................VSVLNET.GG.REVMIHDRL................S.AHEAYIM..............A..L.Y..R.H..RPQ..L.IERMKEIV.QA.YV.K........ERT.S..D.SG..Q..IGNHVTIVDAGYIK.N..VFVGDYCQIEGTSRLKNGSI.NS...NEH...D..P...VHIGSGVICDDFIISSGSNVEDGTMLSRCFVGQACHMGHNYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGALERGAKTTSDSYILWP.........A..RI..G..AFSLVM.GRHV.KHPDTSNLPFSYL.......I..E..........E.......K..N..T.......T..Y........LA.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..D..R..LDQINYNLLSPYTIQKMMTGRMILK.....D..LS.KV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........RN....S....A...LN.......KG.....IKFY...E..MAIHKFLG.NSVI..K.R.......LENL....H.F...A.S...D....EE.IRARL....Q.P..DTPV.G..G.G.EWVDVSGLIAPKSEV.ERLMQEIETGSLT.T.VAEMHAQFAEMHRN...YYTYEWTWAYEK.MLEF..YQ.......LD......A..T.R...I.TAKDIVAIVKQ.W.QQSVVE....LDKMVYEDARKEFS.LSS...MTGFGA...DGTRRE.QELDFEQVR.GA.F..ESNPFVTAVLEHIRVKTELGNELIARL......................................................................
A0A0F5JLF3_9BACT/4-658               .............................................................................................................................................i-RNLRPEEIAILQS.Q.DCRA..ES..WDQ.V...L...V.........P...L.........S...F.D.....T.........K.........YLVNVRFSGT...VII..GLFEK.EF..TL...PGG..I..KK.HSGIRNATLH.NCFL...GN.N.....ILIEN..........V.....HN.......YIA..N..YR........IHDNCYIENVNIM.....V.........V.E........G..E..........TTFGNNVQ......................VSVLNET.GG.REVPIFNRL................S.APLAYVI..............A..L.Y..R.H..RPK..L.IGKLQEMI.AD.YT.K........KLT.S..D.YG..T..VGKDVKIINAGTIR.N..VDLGPYTTIENCTRLENGTI.NS...NEE...A..P...VYIGDSVIAQDFIISSGAVIADAAKIIRCFIGQACHVTHNFSAHDSLLFSNCSFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RI..G..AFSLIM.GRHH.HHSDTSDMPFSYL.......I..E..........Q.......D..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..N..K..QDMINYNLLSPYTIQKMMKAVDILK.....N..LQ.SL.V..G..ET........SEI.....................................................................YYYQ.NTR.I........KG....S....S...LR.......NA.....LKLY...G..MAINKFLG.NSLI..K.R.......LEGT....R.F...K.S...L....EE.VHSQL....I.P..TTEE.G..E.G.EWVDLAGLILPKDQL.DGLIEDIENQETT.S.LGFIDLFFHTMHYL...YYEMEWTWAYKK.IEEY..YG.......IK......L..D.S...I.TANEIIQLVET.W.KSSVIE....LDELLYKDAQKEFS.LTS...MTGFGV...DGSRKE.KQEDFETVR.GA.F..EQNPFVTAVKEHIVTKRALGDELIERI......................................................................
A0A421FI25_9STRA/24-219              ..............................................................................................................................................FYHLSSDEIKALEV.N.GNSA..EN..WGL.V...R...K.........T...Kk......qlK...L.Q.....T.........N.........RIRQCSFHGK...VVL..GDFSD.FQ..HD...VDG..V..PF.PCGVYNSTLS.DVVV...LD.D.....ALVKD..........T.....-L.......VLK..G..VL........VDAKASVLQCGSV.....V.........C.A........QetE..........TVFGNGRV......................LHVGVET.GG.RNLRVVADL................P.FSLGAEV..............A..T.K..R.G..DLK..F.LETYDAIV.DE.YV.A........KIK.A..P.MA..I..VAQNAQ--------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ertvvktksvi...........................................................
A0A2D0NJF8_9BACT/42-726              ..............................................................................................................................................FRRLTASEIEALVK.N.ENVA..DN..WED.I...W...V.........S...E.........A...F.D.....P.........N.........LVRNCHFHGR...VRI..GALEA.YY..LE...FHE..L..RI.PVGLYNSTII.SCDI...GN.Y.....VAIKN..........V.....-Q.......YLA..Y..YI........IGDETVLFNVNEM.....Q.........T.T........S..H..........AKFGNGILkeges...........ehlriwLEICNEN.GN.RKVLPFEDM................L.PADACLW..............A..R.T..R.D..DRE..L.MAAFKKMT.DN.AF.D........QSR.G..Y.YG..T..VGTQCVIKNTESIK.D..VKIGSHAYIKGANKLKNLTI.KS...SEA...A..P...SQIGEGVELVNGIMGYGSRAFYGVKAVRFILGENSTLKYGARLINSILGDNSTISCCEVLNSLLFPGHEQHHNNSFLIAATVl.gqSNIAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..KF..A..AFCLLTkGDFP.AELHIH-LPFSLVa.....nN..E..........S.......E..D..R.......L..E........VI.PAFww.....................qyNM..Y..A..L.A.........-...-.RNAWKYGERDQ.RT.Y...K..Q..Q..--SFETDFLAPDTVAEMFHALSYLE.....E..AT.AR.A..F..RE........QDHpspeielegralgkel....................................llerpeiadrliirandMEHS.ARE.V........RL....L....K...VT.......AA.....YRAY...R..EMLHFYGV.RTLL..D.-.......LQTEg..eG.P...V.A...W....EN.LRAQF....G.E..S---.Q..R.E.DWFNLGGQLIARADL.DRMLAEIKGGDID.S.WKELHARYVDLDRD...YRQKNAANAYAS.LLEL..HG.......ID......A..P.A...V.NEEMWRKWVEQ.A.TEISWM....MARRTKASRQKDYD.NPF...R-----...-QLTYN.SAEEMEAVQ.GA.L..DANPFIREMASRA--------------aefadr................................................................
H1XNG4_9BACT/3-656                   ..............................................................................................................................................FKSLSSAEINQLKE.Q.GCRA..ED..WSA.V...L...I.........H...R.........E...T.D.....L.........A.........RIRFVTFKGK...VAV..GKLSD.FI..EI...EPG..R..VE.ECSLQNVTLD.STVI...AD.E.....VYLND..........V.....-G.......LIK..N..YA........IGDGAAIEQVKLL.....S.........A.T........G..K..........TTFGNGVR......................IEALNEG.GG.REMIIFDQL................S.AQIAYLQ..............T..L.Y..R.H..EPQ..L.INALQKMI.DQ.YV.E........EQK.S..S.IG..V..IGNQARVLRCNQIV.N..VKIGACAVIRGAQSLENGTI.QS...EKA...A..P...VLIGDGVIARNFIVLSGSEVKDGALLTDCFVGQGVRIGRQFSAENSAFFANCEGFHSEAVSVFAGPYSVTHHKSTLLIAGMF....SFYNAGS....GTNQ.SNHMYKLGPVHQGILERGAKTGSFSYLLWP.........A..RV..A..PFTAVI.GKHY.ANFDAANLPFSYI.......E..E..........V.......A..G..R.......T..L........LT.PGM.........................NL..F..T..V.G.........T...R.RDSAKWPKRDR.RK.G...E..N..K..LDLIHFDLFSPFVINRVRKGKKILA.....E..LY.AA.A..N..PK........QEF.....................................................................VKFK.GLY.L........KR....L....L...LK.......RG.....IKYY...Q..MAMDIFVG.EQLL..R.R.......LQPI...dE.L...K.G...W....TD.VAARL....K.A..PNTK.K..L.E.EWYDWFGMFIPQSAA.EELLGKIKSNQIK.T.VQDLLTQLRQYFER...YDEWAWNWTAAL.LKEE..WQ.......ID......V..E.T...I.EKDQFKQLIAN.W.KNQKIR....FNNLILSDAQKEFD.SNS...RIAYGI...DGDEQI.ALKDFEAVR.GT.L..EENGFYKELLAENEQMEKIAERLT---el....................................................................
A0A1T5FAH8_9BACT/3-657               ..............................................................................................................................................YRKLTEEEIKSLIL.N.GSFC..ED..WST.I...E...V.........H...S.........A...F.S.....P.........H.........NIRNVSFSGN...VKI..GLLLK.KF..TS...PGG..V..PK.QSGIYNATIH.NCII...DD.D.....VYINQ..........V.....KN.......HLA..N..YH........IKKNVIIENVDSL.....F.........V.S........E..E..........TSFGNGIR......................VAVLNET.GG.REIAMYDEL................S.AHTAYLM..............A..F.Y..R.H..RPI..L.IDQLLKKA.DD.FA.K........GVT.S..A.MG..T..IEEGAHLVNCRTIQ.N..VRIGKHAFIEGVYRLVNGTI.NS...SLE...D..P...SYIGPGVIAQDFITASGSEVTESSMISKCFVGQGTVLAKQYSAENSVFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYY....SFLNAGS....GSNQ.SNHMYKLGPIHQGVVERGSKTTSDSYLLWP.........A..KI..G..AFSLVM.GRHY.RNPDTADLPFSYL.......I..E..........N.......T..D..E.......S..F........LA.PGV.........................NL..R..S..I.G.........T...I.RDARKWPRRDR.RK.D...P..V..L..LDAIVFNLLSPYSIQKMIKGIKVLN.....D..LK.ST.S..G..PT........SEY.....................................................................YMYN.SVK.I........TA....S....A...LD.......RG.....IQMY...R..IGITKFLG.NGLV..K.K.......LELA....D.F...S.N...R....EE.MLKAI....A.P..EGKQ.G..S.G.EWVDMAGLLVPKEEV.DQLVNDVEKGIVT.T.AGELNKRFVSFKNH...YFDWAWNWIVPR.LKTE..AG.......LD......V..E.S...V.SVQQVMDYVEE.W.KNAVVK....LDQMMYEDARKEFT.LKS...QTGFGI...DGKEET.RMCDFENVR.GE.F..TSHPAVTDILEHIEKKSNLASKVLDKL......................................................................
U2LE69_TRESO/24-761                  .............................................................................................................................................k-RHLTQAEIEALEK.N.QNTS..DDpsWQN.F...Y...V.........D..aE.........C...F.D.....A.........S.........LIRDSSFSGF...IVL..GKLRH.AA..LK...YHD..L..EL.EEGIYASKLI.NAVT...GD.D.....NVIRN..........V.....-A.......YFE..N..YR........LGKNVMLFNIQEM.....S.........C.T........T..H..........SKFGEGILkkgep...........eenriwIGVANEN.GG.REVLPFKSM................I.PADAYLW..............S..R.Y..R.E..DGA..L.MKRFVELT.EK.GA.C........CEG.A..T.YG..I..VKNNAVIKNTTLLK.D..AEIGECVYIKGAFKLKNITV.LS...SEA...E..P...SQIGEGVEMVNGIMGAGSRVFYQAVAVRFVIGKNCQLKYGARLLNSVLGDNSTVSCCEILNNLIFPFHEQHHNSSFLIASTIm.gqSNIASGAt..iGSNH.NSR----SPDGELIASRGFWPSLSSDFKHN.........S..RF..A..SFVLIAkGSYQ.YELDIP-YPFSLIa.....lG..E..........N.......G..D.rS.......I..R........IF.PAWwf.....................myD-..-..M..F.A.........L...V.RNRYKFKKRDK.RV.V...P..V..Q..--HIETDPFAPDTMQEIMTALDRIV.....R..LT.AK.E..R..MP........HRGqtesgihetedvrmrgktrgfgirtsadatdgfedaaggntangtreddtdkerlaeakaffeknpdadFTLS.DAQ.C........QK....RygatV...FRp.....aYA.....YHQY...R..KIIKYFAA.KTII..E.Y.......CDEN....G.I...A.S...V....SPaVLAEI....A.-..-RHP.L..Y.A.EWLNAGGQIIPIEKI.DELREKVKRGEIA.S.WEKVHAFYDACAAS...YLADKTRYALYL.LKCI..YG.......VP......F..E.R...C.SAEQYRNLVES.V.AAVSDD....MYTLSVSSREKDYT.DYY...R-----...--KMTYrNREEMDAVL.GT.I..DRDDFLTMLKDDTERFNKKLRR-----vit...................................................................
A0A396M6F7_9BACT/6-480               ..............................................................................................................................................YRKLTEAEISVLSA.Q.GCTS..ES..WEL.V...E...V.........A...D.........G...F.R.....P.........E.........FVRTVHFSGS...VRL..GGNGS.EI..PL...PGG..V..VR.RSGVYRAALH.DCTV...GD.D.....ALISN..........V.....GR.......YVA..N..YD........IGDRAVIENVGEM.....I.........C.D........G..A..........TAFGNGVE......................VAAVNEA.GG.REVPIFDGL................T.AQIAYVI..............A..M.Y..R.H..RPQ..T.VRRMNAMI.AG.YA.E........RRV.S..R.RG..T..IGADSRIVNTLSLF.N..VAVGESAVVDGASSLRNGTV.NS...TPQ...S..P...STVGAGVTASDFILACSARVDTGSMLRRCFVGEGVVIENGFSAENSLFFANSHCNHGEACAVFAGPYTVSHHRATLLIAGYF....SFFNAGS....GANQ.SNHMYKSGPVHQGVHLRGCKFGSDAYVLLP.........A..ST..G..VFTIVT.GRHY.NHHDTEKMPFSYL.......L..E..........E.......A..D..D.......S..I........LL.PGV.........................NL..R..S..Y.G.........T...A.RDIGKWPSRDR.RR.G...V..A..H..-DIIRYELMNPYTAGRVLDAIGECR.....A..LM.ER.Y..-..PT........AEV.....................................................................VTWN.RVK.I........KM....H....S...LK.......KG.....LMLY...T..QALRGYLG.EL--..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------faeg..................................................................
A0A5S5DG14_9SPHI/42-731              ..............................................................................................................................................YRSLTETEKQTLIR.N.GNQA..TD..WDM.L...L...V.........T...D.........R...F.L.....P.........E.........QIRNSSFSGL...VRI..GDMSP.SV..LE...HKS..L..EL.PVGIYDSCVV.SCDI...GA.D.....VAIHK..........V.....-N.......YLA..H..FI........LEREVMLSSVHEM.....V.........T.S........S..A..........AKFGNGAIkegee...........esqrivLELCNEN.GK.RAVTAFEGM................Q.ASDAYLW..............T..R.F..R.D..DSV..L.QRRFQEIT.DK.RF.D........KRR.G..F.YS..V..VGEGTVIKNSKIIK.D..VRIGAHAYIKGVNKIKNVAV.NS...RID...A..M...TQIGEGCELVNGIIGFGCRVFYGVKAVRFVLSSFSQLKYGARLINSFLGDNSTISCCEVLNALIFPAHEQHHNNSFLCAALVk.gqSNMAAGAt..vGSNH.NSR----GADGEIIAERG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.YELDVR-LPFSLV......sL..D.........lK.......N..D..R.......L..V........LV.PGYw.......................fLY..N..A..Y.A.........L...M.RNTDKFAARDN.RK.L...K..N..Q..--YFEYDVLAPDTVNEMFVGMALIE.....K..AV.GK.S..I..YS........SEQlsdgeaqergrall........................................sreekpelgeifiegVE--.-CS.K........RP....V....V...IAk....ayEA.....YHVY...R..RMIAYYAG.TEIF..K.A.......LSSM....P.F...E.-...-....-E.FALLL....D.Q..WKDG.S..R.A.TFDNVGGQLVDTEAL.NSILERLKVGEID.S.WEEIHAWYHDASAA...YPMARLQHAVVSyLELM..GG.......VA......V..L.G...D.EVDWLLLLLQE.T.LKTKKW....LYQQIAGSREKDYT.NPF...R-----...--KMVYaNEQEMDIVV.GS.L..KDNAFINKQAQECAAMEEEL-------srlekqii..............................................................
H1Q3L0_9BACT/3-617                   ..............................................................................................................................................YRALTEEEIIVFEN.N.NCWA..ED..WNR.V...K...V.........A..vE.........G...F.F.....P.........K.........FFHRVMFYGD...IRL..GSFEK.NV..EV...TKG..F..VK.HSGINDATLR.NVIV...GN.D.....CLIEK..........I.....GN.......YIN..N..YT........IGNDCLITNISVM.....E.........T.T........E..G..........ATFGEGNL......................ISVLNEV.GD.GNMILFHDL................N.SQLAAFM..............V..K.H..F.G..DKD..L.KNAIRRLI.SE.EI.A........RTN.P..E.RG..T..LGNGVKIVNTKEIT.N..TIIQDDCEISGASRLSDCTI.LS...TGK...A..S...VYIGTGVICENTIISDGSSIINSVKMQDCFVGEACQIANGFTASQSVFFANSFMANGEACAAFCGPFSASHHKSSLLIGGMY....SFYNAGS....GTNF.SNHAYKMGPMHWGVLERGTKTASGGYILMP.........A..TI..G..TFSVCF.GKLM.HHPNTQALPFSYL.......I..A..........G.......G..D..T.......M..F........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDM.RP.Q...D..S..Q..KSIVNFDWLSPFSVGEILRGKKILE.....N..LR.LA.S..G..DN........VST.....................................................................YNYH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......AHKQ....G.F...F.G...-....--.-----....K.P..ETEI.G..L.G.KWNDLSGLLLPESEE.QRMIADIKSGSLE.T.IQDVLERFAEINRN...YRRYQWAWTYRM.ILDY..YG.......I-......-..Q.E...I.TEVDSDRIKHD.Y.IEARRA....WIAEIKKDAEKEFD.MG-...------...------.---------.--.-..---------------------------dvdeevfrdfvdkldheidfee................................................
R6F9I7_9BACE/4-658                   ..............................................................................................................................................YRKLTEDEVLRLKS.Q.SCLA..DD..WEK.V...S...V.........S...E.........G...F.S.....T.........E.........FVHHTRFSGE...VRL..GVFQS.EF..TL...AGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........V.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..L..........SRFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHLAYIM..............A..L.Y..R.H..RPE..L.IARLKEIT.EF.YA.N........KHA.S..A.MG..T..IGDHVTIMNTGSIK.N..IRIGSHARIVGTCRLYNGSI.NS...NEA...A..P...VYIGDGVICDDFIISSGSHVDDGVMLTRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RK.D...P..N..K..LDFINYNLLSPYTVQKMFKGRETLL.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....S...LA.......KG.....IKFY...E..IAIHKFLG.NSVI..K.R.......LEGI....D.F...R.N...D....DE.IRARL....R.P..DTSI.G..T.G.EWVDISGLIAPKSEI.DALMDGIENGSVN.K.LKEINAEFERMHLN...YYTYEWTWAYEK.LEEF..YG.......VK......P..E.A...M.TAADIIRIVEK.W.KESVIG....LDRMVYEDAKKEFS.MAS...MTGFGA...DGSRLE.KEMDFEQVR.GD.F..ESNPFVTAVLKHIEVKSALGDELIGRM......................................................................
R5FDG6_9BACT/3-606                   ..............................................................................................................................................YRNLTDEEIALLED.K.NCWA..ED..WSA.V...Q...V.........A...D.........D...F.R.....P.........R.........YMQNVQLYGD...VRI..GVFES.NV..EV...SKG..F..LK.HSGISNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YD........IGDDCNISNISTI.....E.........T.T........E..G..........ATYGQGNL......................VSVLNEV.GE.GNVVLYSAL................S.AQLAAFM..............V..S.H..F.H..DRE..L.KDKIRKLI.RD.YI.D........TYV.P..E.RG..K..IGNRVKIVNTKEIT.N..TLVSDDCEINGAARLSDCTL.LS...TED...A..N...VYIGTGVIAENSIISDGSSLINSVKMQDCFVGEACQISNGFTASQSVFFANSYMSNGEACAAFCGPFSASHHKSSLLIGGMF....SFYNAGS....GTNF.SNHAYKMGPMHWGVLERGTKTASGAYLLMP.........A..TI..G..TFSVCF.GKLM.HHPDTRALPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDL.RA.K...G..S..Q..KSIVNFDWLSPFSVGEIIQGKKILE.....Q..LR.EA.S..G..ED........VST.....................................................................YNFH.EYV.I........RA....S....S...LQ.......KG.....IKYY...D..IALRIYMG.AVLK..R.M.......LKRD....P.-...-.-...-....--.---TL....QpP..VSDE.G..V.G.EWNDLSGLLLPVSEE.QRLVDDIKDGTLD.S.IEAVNDRFEEINAG...YRRYQWAWTYKL.ILDY..YG.......LT......-..-.E...L.TLDDVPRIRED.Y.VCARRA....WIAEIRKDAEKEYR.M--...------...------.---------.--.-..---------------------------gdverevldnfl..........................................................
R5GH52_9BACT/2-272                   ..............................................................................................................................................YRPLTDAEIRQLEH.Q.GCRA..DE..WAA.V...R...V.........A...D.........A...F.R.....P.........E.........TVAMVRFCGD...VRL..GEFGR.PV..EL...APG..V..RV.PSGVTRAVLS.DCTV...GD.G.....CLVRD..........V.....GC.......YLH..G..YR........LDDGAVVMNCGTL.....S.........A.D........A..D..........AEFGMDGA......................MAEASDD.TP.RRVAACDGL................Q.APMAALM..............L..-.-..-.A..ESP..A.AVAMRRLA.AR.RA.V........AWA.S.eE.RN..V..VGRGAVVANTVRLV.N..TYVGDACEVNGASALNECAL.LS...TDE...A..P...VWVGAGVIAEDTVVGAGSTLDGAARLYNCYVGEYIRVRGVQAARRCFFA---------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------etppdhg...............................................................
A0A255S7E9_9BACT/4-617               ..............................................................................................................................................YRQLTQEEIDVLER.N.NCWA..EN..WES.V...K...V.........A...D.........D...F.S.....P.........Y.........GFHRVMFYGD...IRL..GVFDL.QV..EV...TKG..F..TK.HAGINDATLR.NVTI...GD.N.....CLIEK..........I.....GN.......FIN..N..YT........IGDNCYISNVSTM.....E.........T.T........E..G..........ATYGEDHM......................ISVLNEM.GD.GNLVLFHDL................N.SQLAAFM..............V..K.H..F.N..DKV..L.KEKITRLI.RE.EV.R........FSL.P..D.RG..T..IGNNVKIINTKEIT.N..TVVKDDCEINGASRLSDCTI.LS...SKD...A..S...VYIGTGVICENSIISNGCSITNSVKMQDCFVGEACQVANGFTAQASVFFANSYMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPLHYGTLERGTKTASGAYVLMP.........A..KI..G..AFSVCF.GKLM.NHPDMRCLPFAYL.......L..A..........Y.......G..D..T.......M..Y........IV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RA.A...S..C..R..KSIINFDWLSPFTVGEIVQGKKILE.....A..LR.QA.G..G..DN........VSS.....................................................................YNYH.EYI.I........NA....T....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.A.......IKGG....F.L...G.-...-....--.-----....K.P..TSDI.G..L.G.HWTDLSGLLLPISEE.ERLIDDIKNGNIE.S.IKEILDRFIDIDNH...YRQYQWTWTYRL.ILDY..YG.......LD......-..-.E...L.SDSDLPRIRED.Y.IRARRA....WVAEIRKDAEKEFA.MGD...------...------.---------.--.-..---------------------------veqsvfddfitkldheidfed.................................................
E7NTL2_TREPH/47-725                  ..............................................................................................................................................WRALTLGELESLIK.N.GNSC..TD..WNK.I...L...V.........E...D.........P...F.N.....A.........H.........LIKNSFFAGL...VRI..SALEE.NY..LK...YHD..F..TV.PTGITNSKII.SSDI...GK.N.....CAIHD..........C.....-A.......YIS..H..YI........IGDHVILSRIDEL.....C.........A.T........N..N..........AKFGEGIIkeged...........esvrisIEVINEA.GG.REVLPFAEM................I.PADAFLW..............A..R.Y..R.D..NKK..L.IERFKKIT.QE.QR.D........NRR.G..Y.YG..I..IGSEAVIKSCCIIK.D..VSFGESVYVKGANKLKNLTV.KS...SSN...E..P...TQIGEGVELVNGIIGFGCRIFYGVKAIRFVLGNNSALKYGTRFIHSILGDNSTISCCEVLNSLIFPYHEQHHNNSFLIATMIq.gqSNMAAGAt..vGSNH.NTR----GNDGEIIAGRGFWPGLSSTLKHN.........C..KF..A..SFVLLNkGNYP.SELNIS-FPFSLV.......S..E..........Na.....qK..N..R.......L..E........IM.PAYhw.....................myNM..Y..A..L.-.........-...I.RNNKKFATRDK.RI.T...K..I..Q..--KIETNCFAPDTAMEMEDAIAELN.....S..LI.EQ.T..W..QK........AGNpflsakkiias..............................................heaeirnmliivPNAE.RLK.E........RE....S....V...LLk....piEA.....WHAY...H..DMLIWYGV.KTLF..D.F.......FEKE....H.C...S.I...K....KF.----E....H.I..TLEE.V..E.R.NWVNMGGQLVPEKKL.FALMDRIANGDFL.T.WNQIHEEYEVLYAQ...YPYDKAENAYAV.LCRI..KG.......V-......-..S.K...L.TKELWNEYIDE.S.LRIRKF....IEEEILKTKLKDYT.NPF...R-----...DITY-R.NKAERDAVL.GK.V..EDNPIIQESKIETEYFFSQ--------aekmr.................................................................
A0A5S5DNN6_9SPHI/41-725              ..............................................................................................................................................FRRLTAAEIAVLVE.H.QNYA..NN..WND.V...L...V.........T...D.........K...F.I.....P.........Q.........QIQYCKFYGL...VRI..GDMED.IY..LN...YRD..L..RL.PTGVYHSTIV.SCDL...GD.A.....VAIHH..........V.....-R.......YMS..H..FV........VGNEVMLSNVNEM.....E.........T.S........H..N..........AKFGNGILktgdv...........eerrikLELCNEN.GG.RSVWPFDGM................Q.AGDVFLW..............S..R.N..R.Q..DHV..L.QERFQEMT.DR.RY.T........KEH.G..Y.YS..E..IGDRCVIKNTHTIK.D..VKIGSHAYIKGVNKLKNLTI.NS...SGE...S..F...TQIGEGCELVNGIIGYGCRIFYGVKAVRFILSSNSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALIk.gqSNMAAGAt..vGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIK-FPFCLV.......S..Ne........vH.......T..N..R.......L..V........IV.PGYwf.....................lyNM..Y..A..L.M.........-...-.RNTSKFHARDK.RK.F...K..N..Q..--YIEYDVLAPDTVNEMFEA---LR.....E..IE.KA.V..G..RA........CSSigddadllltgkavl.......................................ladgplpkkdilvdnVEFS.KRE.V........VL....A....K...PR.......EA.....YRVY...I..RMIRYYAA.LQII..S.E.......LQQT....T.F...A.E...L....--.VGKMI....-.-..ALPA.G..R.R.YFENVGGQLIPEDKL.QSLLDEVRAGAIS.S.WDDIHASYHLWSRE...YPADKLAHAVAS.LAEI..AG.......IP......V..A.A...W.DLDFVKELIGE.A.LETRKW....IFSEIAASRTKDYQ.NPF...K-----...--QMVYsSYEEMEEVV.GA.L..ADNDFINRERLALQEFEATVTGIL---aai...................................................................
W4UY55_9BACE/4-658                   ..............................................................................................................................................YRKLTEEEILQLKG.Q.SCLA..GD..WGS.V...L...V.........V...E.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFDS.EF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGSDAFIENVDII.....L.........V.D........G..L..........STFGNGVK......................ISVLNEM.GG.REVLMNDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKTIT.DY.YS.N........KHA.A..T.VG..S..IGNHVIIQNTGSIR.N..VRIGDYCHICGTCRLTNGSI.NS...NVA...D..P...VHIGDGVICDDFIISSGSEVDDGTMLSRCFVGQSCRLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..D..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..K..LDYINYNLLSPYTIQKMFKGRAILK.....D..LK.RV.S..G..ET........SEI.....................................................................YSFQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.N...D....EE.IRQRL....K.P..DTEI.G..V.G.EWVDMSGLIAPKSEI.DRLLDGIESGEIN.R.LKSINACFSVMHAN...YYTYEWTWAYEN.IREF..YG.......IN......P..E.T...I.TAKDIIQIVKS.W.QEAVVG....LDRMVYNDARKEFS.LSS...MTGFGA...DGSRDD.MKQDFEQVR.GD.F..ESNPFVTAVLKHVEDKTALGNELISRI......................................................................
A0A2W7RY22_9BACT/44-738              ..............................................................................................................................................YRRLTAYEIEALVK.N.RNTS..DD..WNN.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.IC..LN...FSD..L..TI.PVGLYNSIII.SCDI...GD.N.....VVIDN..........V.....-N.......YLS..H..FI........IGNECILANINEM.....V.........T.S........N..H..........AKFGNGIVkeged...........eairiwLEICNEN.GG.RSVIPFNGM................L.PGDAYLW..............S..K.Y..R.A..DKE..L.LQQFKNFT.EK.QF.N........QKR.G..Y.YG..K..VGNRTVIKNSAILK.D..VWIGEDAYIKGANKLKNLTI.NS...GKE...G..Q...TQIGEGCELVNGIIGFGCRIFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALLm.gqSNIAAGAt..iGSNH.NSR----GPDGEMVMGRG---------FWPglcvslkhnS..KF..A..SYIILAkGDYP.AELNIT-LPFSLV......sI..D.........nE.......K..N..Q.......L..V........IM.PAYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYIDRDK.RT.E...K..I..Q..--YLEYDFLAPDTVNEMFDGISTLE.....Y..CV.GK.A..F..YT........KETnelsnsneaciekgrel...................................lnkengaelidsleivlPNAE.NNK.R........KT....I....I...IKa.....fKA.....YHLY...K..QMIAYYGI.NHLL..N.W.......INTN....S.I...T.S...V....SD.LKKSL....P.N..---F.E..R.K.QWINVGGQLMEKDTV.DKLLLQIKNNNIN.S.WEQVHHFYEKQGNL...YNTEKTKHALAA.LTEL..YQ.......IN......W..E.T...I.NANFIQKLFKE.V.IETKSW....ITEQIFLSREKDYI.NPY...R-----...--KMVYdSDAEMEAVM.GK.L..ADNSFINQQNKELMAFKTTLELIS---ekl...................................................................
R6B108_9BACT/4-613                   ..............................................................................................................................................YRPLTSEEIEVLKS.N.DCWA..ED..WTS.V...N...V.........S...E.........N...F.K.....P.........N.........FMHRVMLYGE...VNI..GGFDK.NV..EV...SQG..F..VK.HSGINNATLR.NVTI...GD.D.....CLIEN..........V.....GN.......FIN..N..YT........IGDDCYISNISTM.....E.........T.T........E..G..........ATYGEGNL......................VSVLNEV.GE.GNVILFSDL................N.SQLAAFM..............V..K.H..F.S..DKE..L.KEKIRLLI.KS.DI.D........TKM.P..E.RG..Q..IGNNVKIINTKEIT.N..CVINDFCEVNGASRLSDCTL.LG...SIH...G..N...VYIGTGVIAENSIIAEGSSVINSVKIQDCFIGETCQLSNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGSKTASGAYLLMP.........A..TL..G..TYSVCF.GKLM.HHPDTRNLPFAYL.......I..A..........D.......G..D..K.......M..F........LI.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDL.RA.P...E..N..R..KSIVNLDWLSPFSVGEVLKGKKILE.....N..LR.EV.T..G..DN........VSQ.....................................................................YLYH.EYI.I........PA....T....S...LH.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKRD....-.-...-.-...-....PS.IT---....P.P..STQI.G..L.G.DWDDLSGLLLPVSEE.ERIINDLKDGNIE.T.IQELIERFENIDAN...YREYQWTWTYKM.ICDY..YG.......IS......-..-.E...I.TLEDANRIHED.Y.IKARRS....WIAEIKKDAEKEFA.M--...------...------.---------.--.-..---------------------------gdveeevfrnfvdsldqe....................................................
A0A5B8V9F6_9BACT/44-737              ..............................................................................................................................................YRNLTAYEIEALVK.N.RNAS..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVRNCKFFGL...VRI..GKLEP.CY..LE...FSD..M..KY.VVGLYNSTII.SCDL...GD.N.....VVVDN..........V.....-N.......YLS..H..YV........IGNEVIIVNVNEL.....I.........T.T........D..H..........AKFGIGIVkegep...........esvriwMEICNEN.GG.RSVIPFNDM................L.PADAWLW..............S..K.Y..R.D..DEK..L.LEQFKIFT.ER.QF.K........KER.G..Y.YG..K..IGDRTVIKNCAIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GPE...G..I...SQIGEGCELVNGIIGFGCRIFYGVKAVRFVMASNSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIPAGAt..iGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..KF..A..SFTILAkADYS.YELNIP-IPFSLV......sI..D..........S......sK..D..F.......L..T........VM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNAWKYGDRDK.RI.Q...P..I..Q..--NMEYDYLAPDTVNEMFDAMKMLE.....L..FT.GR.A..F..YK........KENpdtsinnddcskkgkq.....................................llknndaiideleilaEGFE.NHK.R........KT....V....I...IKv.....qQS.....YNLF...E..QMITYYGA.LHLF..N.L.......IKEN....N.A...T.S...F....EA.VKEVL....P.K..AG--.S..R.S.EWLNAGGQLLLKKDV.ALIRQRVKENKIN.S.WDQLHSVYDEMATR...YVTNKTAHAIAA.LLEI..KA.......LT......A..K.K...L.SGNDIITILAE.L.ITTKEW....IAAKIKESRAKDYT.NPF...R-----...-SMVYD.SEEEMNNVV.GL.L..SENSFIKQQQDELKKFKSMVNLTLK--kf....................................................................
R5P5T9_9BACT/4-603                   ..............................................................................................................................................YRHITDREIDILEA.N.NCWA..ED..WTS.V...M...V.........A...E.........D...F.R.....P.........N.........FMHRVMLYGD...IRI..GAFEK.NV..EV...SKG..F..VK.HSGINDATLR.NVVI...GD.N.....CLIEK..........I.....GN.......YIN..N..YT........IGEDCHIANVSTI.....E.........T.T........D..G..........ATFGEGNL......................ISVLNEV.GD.GNVVLFRDL................N.SQLAAFM..............V..K.H..F.A..DKE..L.KSEIRQLI.RQ.QI.S........DTA.P..E.RG..V..IGDRVKIVNTKEIT.N..TVVFDDCEIDGASRLSDCTI.LT...SPN...A..S...VYIGTGVICENSIISDGSSIINSVKIQDCFVGEACQLSNGFTASASLFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGVLERGSKTASGAYLLMP.........A..TI..G..TFSVCF.GKLM.HHPNTRNLPFSYL.......I..A..........G.......G..D..T.......M..F........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.I...G..S..Q..KSIVNFDWLSPFSVGEILNGKKILE.....N..LR.SA.S..G..DN........VST.....................................................................YNYH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKKD....P.-...-.-...-....-Q.L---T....P.P..TSDV.G..V.G.DWHDLSGLLLPASEE.ERMINDIKDGTLG.D.IQAINDRLVEINNN...YREYQWAWTYRM.ILDY..YN.......LT......-..-.E...L.TLADAERIHVD.Y.ITARRA....WIAEIRKDAEKEFA.M--...------...------.---------.--.-..---------------------------gdveeevf..............................................................
R5NF73_9BACT/11-666                  ..............................................................................................................................................YRQLLPTEIRQLEQ.Q.GCTA..EN..WQL.I...E...V.........H...P.........D...I.D.....L.........R.........HLAYVHFSGS...NRI..GNFQK.TV..TL...PGG..I..TF.HTGIRHATLH.CTTV...GD.D.....CLIAH..........V.....HG.......YIA..H..YD........IASGCIILHTDTI.....A.........M.T........G..S..........SAFGNGTE......................LHVMSES.GG.RDILIHDRL................S.AQEAYMQ..............A..M.Y..R.H..DAL..L.TQNLRRLV.SD.YA.A........RQT.G..N.RG..K..IGEGTRILRCGLIR.N..VKIGPCSRLEGVVRLENGTI.CS...HPD...A..P...TFVGDLVIARDFILQTGSHVADGATLTRCHVGQASSIGHGFSATDSYFGCNCQAEQGEACAILAGPYTVTHHKSTLLIGGMF....SFMNAGS....GTNQ.SNHAYKLGPRHHGVLERGCKTASGSHISWP.........A..HI..G..AFSLVM.GHCA.PGTDSSEWPFSYL.......V..E..........Q.......G..S..S.......H..Y........VI.PGI.........................TL..R..G..V.G.........T...L.RDIGKWPARDG.RL.P...Q.vP..Q..TDRVSFEAFSPYTMGRVFRARITLE.....E..LS.GR.F..D..AD........TQE.....................................................................ITWN.GLR.L........KE....K....S...VK.......QG.....IEWY...R..LALDRYLG.EQLI..R.Q.......LEAH....E.G...M.P...S....DG.LCEVL....H.P..RAAC.-..S.D.RWGDIGGMLAPISEI.NDITRIIATGQLD.R.IEKLRERLRLIHDR...YDDFAWAWTWNL.LHEI..YP.......DS......Y.gK.D...F.IPSLCLPVIRK.W.ETAATT....LNRQIIADATKDIS.TGS...LAGFGI...DGGGET.AVDDALAVR.GT.V..QQCGIIQELEKQQTEIKEKAGYW----lhkl..................................................................
A0A2N4S9Z1_9BACT/4-658               .............................................................................................................................................l-RKLTSKEIKTLEM.H.RCSH..SD..WSL.V...N...V.........K...N.........G...F.N.....P.........D.........YIFDTQFSGQ...ITL..GVLEK.EF..EL...TQG..L..KK.HACINRAVIH.NCRI...GD.N.....VVIEN..........V.....QN.......YIA..N..YI........IGDDCFIQNVDVI.....L.........V.E........R..K..........TTFGNGVE......................VNVLNET.GG.REVHITDKL................S.AHFAYIY..............S..L.Y..R.H..RPQ..L.IERMKSII.DF.YS.E........KHA.S..D.MG..E..IGNGSMIVNVGYIK.N..VKMGAFTKITGAMKLKNGSI.NS...NEA...A..P...VHIGRNVIAEDFIISSGTRIDGGAHISRCFIGQACHLDHGYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIVERGAKTTSDSYVLWP.........A..KV..G..PYSLIL.GRHY.KHSDTSNLPFSYL.......I..E..........N.......D..N..T.......T..Y........IA.PGV.........................NL..R..S..V.G.........T...I.RDAKKWPERDK.RK.D...P..N..R..LDYINFNLLSPYTIQKVFAGVDLLN.....E..LQ.KT.A..G..KN........SEI.....................................................................YTYQ.SCI.I........KN....S....A...LK.......RG.....LSLY...E..IVIHKFLG.NSLI..K.R.......LEKT....K.F...K.T...D....EE.IRNQL....K.P..NTNK.G..L.G.EWVDLSGLIAPKTEI.DALLCKIEKGELT.K.LKEINDVFRQLHEQ...YYTYEWTWAWDK.IKSY..YH.......LD......E..T.T...I.SAKDIIDIVEK.W.KESVIQ....LDQLIYEDAKKEFS.LSF...KTGFGA...DGNIED.QAMDFEYVR.GA.F..DKNPFVLTTLKHIEEKKALGDELIRRM......................................................................
A0A172TTZ4_9BACT/42-730              ..............................................................................................................................................YRNLSAYEIEVLVR.N.NNTS..DD..WNK.I...Q...V.........S...N.........A...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLET.IS..LE...FHN..I..IM.PVGLYNSTII.SCDF...GD.N.....VVVSN..........V.....-N.......YMS..H..YI........IGSEVVLSNIHEL.....H.........V.T........N..H..........SKFGNGIIkeged...........esvrvwLELCNEN.AG.RKIIPFIGM................L.PGDAHLW..............S..K.Y..R.S..DEL..L.MQRFREFT.EK.KF.D........KQR.G..Y.YG..K..VGDRSVIKNTSIIK.D..VWVGSDAYIKGANKLKNLTI.NS...NDE...A..P...SQIGEGCELVNGIINEGCRVFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAATIm.gqSNIAAGAt..iGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..KF..A..SFTLIAkGDYS.YELNIP-IPFSLI.......S..Nd........vS.......H..D..R.......L..V........VM.PGFwf.....................myNM..Y..A..L.A.........-...-.RNSGKYIDRDK.RT.D...K..I..Q..--HIEYDFLAPDTINEMFDALVLFK.....K..YT.AI.A..H..HK........KQGstinessleeegnai.......................................lnddqydwkglqviaYGFE.NNH.R........PT....H....L...IKv.....kEA.....FQLF...Q..RLIRYYGT.TQLM..Q.S.......IQNG....V.V...N.S...L....QE.IQQ--....-.I..DTTT.E..R.L.TWKNIGGQLLPETKF.NQFIESIHKNTIG.S.WEAVHGFYKECGAT...YDADKLQHAYSS.LLEI..KG.......LT......T..E.E...F.TTDIFNELMQE.A.LATKEW....MVQNIYDSRAKDYQ.SAF...R-----...--KMVYdNEEEMVEVI.GK.L..EDNVFIQQQQNELEQMRES--------vvqiqs................................................................
A0A170YIA0_9BACT/3-657               ..............................................................................................................................................YRKLTETEIARLQL.Q.LCRA..DN..WAD.I...E...V.........V...E.........D...F.T.....P.........E.........FFRNVKFTGK...NQL..GKFGE.EI..TL...AGG..V..KA.HTGIYDAWIH.NCSI...GN.N.....VLIHT..........I.....RD.......YVA..N..YT........IEDNAIIFDVKLL.....A.........V.D........G..E..........SSFGNGIS......................VETISEA.GN.RSVMIYDKL................S.AQLAYIL..............A..L.Y..R.H..RPQ..L.IDNIEKMI.TA.YS.N........QVK.S..S.RG..T..ICSGARIYRCDTIL.N..VKIGKKAHIEGARLIKNGTV.NS...EAA...D..P...VYIGDGCHMQNFIICSGSKVNNATLVSNCFIGQGCILDKHYSADNSLFFANCQGLHGEACSIFAGPFTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHMYKLGPIHQGFVERGSKTASDSYVLWP.........A..KI..G..AFTLIS.GRHY.SHCDTSELPFSYL.......I..E..........H.......K..D..V.......S..Y........LS.PAV.........................NL..R..S..I.G.........T...I.RDSQKWPKRDV.RK.S...E..N..L..LDCINYNLLSPFTVERMIQGRNLLL.....T..MR.EK.-..D..ET........CAI.....................................................................YQYQ.GVE.I........EA....R....I...LS.......RG.....IRLY...E..NAIWKFLG.NSLI..T.Q.......LEKS...tK.S...L.D...K....KE.IQSIL....K.V..TSPE.G..S.G.KWVDISGMICPSSVL.NDLLNDIESGKES.S.LENISAEFKRMHHN...YYNYEWTWAYDT.LSQW..YG.......KK......P..D.S...F.TPEDIIAVVKK.W.LTAVLN....IDHWLYEDAQKEFA.LTQ...QIGFGI...DGDEEA.QRKDFENVR.GS.M..ETDDSVLTIKKHMEAKEALGKRIIN--mv....................................................................
F5Y9H7_TREAZ/42-749                  ..............................................................................................................................................WRNLKPHELEILIK.N.QNYC..SD..WDN.F...L...V.........T...D.........P...F.E.....P.........A.........LIRNSAFYGL...IRF..GMLKN.TL..LR...RHD..F..CL.PAGVRNSTII.SCDI...GD.N.....AVIQD..........C.....-T.......YIS..H..YI........IGDEVILSRIDEM.....E.........T.T........N..H..........AKFGNGILkeged...........edvriwIDVMNEA.GG.RSILPFADM................L.PSDAFFW..............A..A.Y..R.D..DIQ..F.TEKLKTIT.QE.QY.G........GFR.G..N.YG..V..IGSGSVIKSTRIIK.D..MQVGEFAYIKGANKLKNISI.LS...SED...E..P...SQIGEGVEMVNGIVGYGSHAFYGSKAVRFVMGRNCNLKYGARLIHSVLGDNSTVSCCEILNNLIFPVHEQHHNNSFLIASLIq.gmSNMAAGAt..iGSNH.NSR----ANDGEIRAGRG---------FWPglavtlkhsS..RF..A..SFVLIAkGDYP.YELNIT-LPFSLV.......N..Nn........iK.......L..D..R.......L..E........VM.PAYfw.....................myNL..Y..A..L.E.........-...-.RNSWKAAARDK.RM.I...K..E..Q..--HIEMDYLAPDTAEEIIAALAQIE.....A..WM.SD.A..G..VP........APNisadhapnpagsnsaene................................dpeyevpaedsqkdpalpaRGLE.RRH.R........GQ....V....I...LKp.....rKA.....WTAY...R..QMLRYYAI.GTLA..E.A.......FKTR....R.D...S.G...WasfcSE.MDKPL....L.N..TKPG.R..I.A.EWVNMGGQIAPTFRV.DELRSRIREGKIS.N.WNSIHAAYDEMAAA...YAEDKARHAWEV.YRYL..CK.......AE......S..S.EahpLkDFEAFKKELET.L.IQTRVW....IAEQVYASRAKDFN.DPF...R-----...-AITYR.NKKEMEQVV.GS.A..GDNSFVKLVQEKTAAFAEEITGL----lcr...................................................................
A0A1R4KGR0_9SPHI/41-725              ..............................................................................................................................................FRKLTQEEIKRLVQ.Q.NNYS..TN..WGN.V...L...V.........T...D.........K...F.I.....P.........E.........QVQNSKFYGL...VRI..GDMDD.VY..LN...FRD..L..RL.VCGIYNSTVV.SCDL...GD.T.....VAVHN..........V.....-R.......FMS..H..FI........LGDDVMLANISEM.....E.........T.S........S..N..........AKFGNGILkhgdd...........perriqLELCNEN.GG.RAVIPFDGM................Q.AGDVYLW..............S..R.N..R.D..DRQ..L.QQRYLEMA.EV.MF.S........KEH.G..F.YS..E..IGNNSVIKNTHTIK.D..VKIGTHAYIKGVNKLKNLTI.NS...SVE...S..Y...TQIGEGCELVNGIIGYGCRIFYGVKAVRFILSSNSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCASVVk.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYSLIVkGDFL.HELDIR-FPFSLV.......S..N..........Ev.....dT..N..R.......L..V........IL.PGYwf.....................qyNM..Y..A..L.M.........-...-.RNTSKFQSRDK.RK.F...K..N..Q..--YIEYDVLAPDTVNEMFEAIDLIE.....L.aVG.RT.I..E..DS........ADEhalrargrellns...........................................qeslngkeilldnVEFS.RRK.V........VL....A....K...PK.......EA.....YNVY...R..RMIQYYAG.VKLV..E.A.......LGSS....S.L...-.-...-....EE.LKASI....E.G..-PNI.T..R.G.AFENIGGQLVPAGKL.ARLISDIRDGSVE.S.WAIVHDHYHAWSRS...YLTDKLEHAIAS.LREI..SG.......VN......V..E.Q...W.DSAFIKDIFKQ.T.LLTREW....IFSEITSSRAKDYQ.NPF...K-----...-LMLYE.SYQEMEEVV.GK.L..ADNDFINKERVALKEFQQVVQQLSEKL......................................................................
A0A1I0QB05_9BACT/42-727              ..............................................................................................................................................YRQLSAMEIETLVR.N.DNTS..DD..WNN.I...F...V.........A...D.........A...F.N.....P.........Q.........LVKHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RQ.PVGLYNSTIS.SCDF...GD.N.....VVVHN..........V.....-H.......FLS..H..YI........IGNEVMICNVNEM.....A.........T.T........D..H..........AKFGNGIVkegep...........envriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.D..DES..L.QSKFKAFT.EK.QF.D........KKR.G..Y.YG..M..VGDRCVIKNVKIIK.D..VTIGTDAYLKGANKIKNVTI.NS...SAD...A..T...TQIGEGCELVNGVVGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIVAGRG---------FWPglcvslkhnS..RF..A..SFTLIAkGNYM.SEMDIP-FPFSLVl.....nD..E..........Q.......H..N..S.......L..K........IM.TGYwf.....................lhNM..Y..A..L.A.........-...-.RNSWKHMDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEMIHAMELME.....V.aVG.KA.W..Y..AK........EDDtldyrqkgrelll...........................................nnieevshlkiyaEKVE.NSS.R........KT....E....L...LKv.....hRS.....YPLF...R..ELINLYAV.RNIF..S.Y.......LHTH....P.D...A.S...F....ES.LQTI-....-.-..ANAA.E..R.G.PWCNVGGQLMRASTL.QLLKDNIRSGKIN.G.WDQLHENYRQIGEQ...YPVDKLQHAIGS.LLFI..QG.......--......K..K.D...F.TSAYLKESLLS.S.VATQEL....ITDNIYRSREKDYQ.NPF...R-----...--KMTYeNNAEMDAVT.GK.L..ESNSFIQQTIADLKSYKESVNALINK-w.....................................................................
A0A3M6VNK5_9STRA/42-561              ............................................................................................................................................ff--PLSDTEILALKA.N.GNSA..HD..WQT.V...R..kI.........N...K.........Nv.pL.Q.....T.........S.........RIHQCAFHGK...VVL..GSFSP.TF..NH..dVDG..I..PF.PCGVYNSALR.NVVV...LD.N.....ALIKD..........T.....-L.......VLK..N..VL........VDNEALIIKCGSI.....T.........G.P........D..K.........gDTFANGIV......................LHVGVET.GG.RDLRIVADL................P.FTLGAAV..............T..M.R..R.H..DAE..L.IKTYEAFV.DE.YV.A........RIQ.S..P.MA..I..VASNARVRACFRVH.G..TFVGKYAVVEDCDV-INSTI.LS...TME...E..P...SVIRVKSIVRDSIVQWNSTVETLSVVDRAFLCDTSHVERHGMVMSSIIGPNTSIAEGEVTSCFVGPFVGF-HHQALLIASIWp..kGKGNIGS....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFveA..PYSVIA.TAVN.TLPQVVAMPFALI.......N..T..........P.......G..H..I.......I.pS........LS.PAInei..................spgwVL.sR..S..V.F.........T..vL.RNEYKFHSRNK.SM.R...-..-..-..-THIEVNIFRPEVVQYMKDARAELV.....A..AE.GK.A..E..LSl......aNGEavyt.............................................................dkqaRGLG.KNY.M........RE....A....S...RL.......AG.....IAAY...T..FFIKLYAL.EAL-..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ldlaesgcvcadgtvasvassqye..............................................
D7FSJ4_ECTSI/137-517                 .........................................................................................................................................kaaaa--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............T..A.D..R.S..SPE..A.VKEHRLAV.DA.YA.E........LAR.C..G.AT..V..IGPGAVVMSCSRVV.D..VFIGANALLES-SAVENATI.LS...TAE...E..P...SRITCGSSVTSSLLQHGVTVDRGCVVNDSLLMEHSHVDNHGKLTHSVLGPDSGVGAGECLHCLVGPFVGFHH-QSLLIATVWp..lGRGNVGY....GANVgSNH-TSRQADQEIWPGEGVFFGLSTVIKFP.........A..NYseS..PFSVIG.SGVT.CLPQRVAFPFCLIn.....sQ..E..........Q.......A..G..L.......P..G........VS.PGLnhlrp..............gwvlseSM..Y..-..-.M.........V...I.RSEDKYRRRAKaRQ.E...H..S..R..RNRVDWPVFRPSMMRLMADARARLV.....AagLN.KR.E..V..YVg......dRGV.....................................................................AGLG.KNY.M........TE....A....S...RL.......EG.....IATY...T..LHLRRYAL.RGLL..S.R.......LEEQ....S.G...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------tdrfllqgpakptwgngdgn..................................................
A0A3P1SRM6_9BACT/4-617               ..............................................................................................................................................YRKLTEEEIEILEN.N.NCWA..ED..WSA.I...D...V.........A...E.........D...F.M.....P.........K.........YVKNAVFYGI...VRL..GVFEK.NI..EV...SRG..F..FK.HSGIYRATLR.NVSV...GD.D.....CLIEN..........I.....SN.......FIN..N..YT........IGNGCYISNVCTM.....E.........T.T........E..G..........AAFGQGNL......................VSVLNEV.GD.GNVVLFGNL................N.SQFAAFM..............V..K.H..F.G..DKG..I.KNAIRRLV.DE.DF.R........LHT.P..D.RG..T..IGNDVKIVNTKEIT.N..TIVKDAAEIDGAARLSDCSI.MS...SPN...N..S...VYIGTGVICENSIISDGSSIINSVKMQDCFVGEACQISNGFTASASVFFANSYMANGEACAAFCGPFSASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGTKTASGCYLLMP.........A..NI..G..TFSVCF.GKLM.HHPDTRDLPFSYL.......I..S..........Y.......N..D..D.......M..Y........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDM.RP.Q...E..C..H..KSIVNFDWLSPFSVGGILRGKKILE.....D..LR.KA.S..G..KN........VSE.....................................................................YIYH.EYL.I........KG....S....S...LE.......KG.....IKYY...D..IALHIYMG.AVMK..R.V.......MKSG....M.F...G.-...-....--.-----....I.P..LTNT.G..I.G.KWNDLAGLLLPESEE.QRLIDDIKNGTLS.D.IDQVINRFAEINEH...YREYQWAWTYRL.ILDY..YG.......LD......-..-.H...I.SETDIERIRKD.Y.IKARRA....WIAEIRKDAENEYA.MG-...------...------.---------.--.-..---------------------------dveesvfenfinsldhetdfed................................................
D9RV43_PREMB/3-617                   ..............................................................................................................................................YRSLTFEEIEILES.N.SCWA..ED..WSR.V...E...V.........A...E.........D..gF.Q.....A.........K.........FFHRVMFYGD...VQL..GSVQK.EV..EI...TKG..F..VK.HSGINDATLR.NVTV...GN.D.....CLIEK..........V.....GN.......YIN..N..YT........IGDDCLISNISVM.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GD.GNVIFFHDL................N.SQFAAFM..............V..K.H..F.N..DKD..L.KNAIRRLV.KE.EI.A........RTN.P..E.RG..T..IGNNVKIVNTREIT.N..TVIQDDCEISGASRLSDCTI.LS...SEY...A..S...VYIGTGVICENSIISDGSSIVNSVKMQDCFVGEACQISNGFTASQSVFFANSFMSNGEACAAFCGPFCASHHKSSLLIGGMF....SFYNAGS....GTNF.SNHAYKMGPMHWGILERGTKTASGSYLLMP.........A..TI..G..TFSVCF.GKLM.HHPNTTALPFSYL.......I..A..........E.......A..D..K.......M..Y........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDM.RP.Q...Q..T..Q..KSIVNFDWLSPYSVGEILQGKKILE.....N..LR.QA.S..G..DN........VSS.....................................................................YNYH.EYV.I........NA....T....S...LR.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......AHKW....G.F...F.G...-....--.-----....K.P..QTEV.G..L.G.RWDDLSGLLLPVSEE.RRLIEDIKSGSLE.T.IEEVVNRFREINEN...YRIYQWAWTYRM.ILEY..YG.......IN......-..-.E...I.SPEDDARIKQD.Y.IEARRA....WIAEIKKDAEKEFE.MG-...------...------.---------.--.-..---------------------------dvdrevfesfvnsldhevdfen................................................
I4ZA23_9BACT/3-618                   ..............................................................................................................................................YRLLTQDEISIFEN.N.SCWA..ED..WQR.V...L...V.........A...E.........E..gF.Q.....P.........K.........FFHRVMFYGD...IRL..GSFQK.NV..EI...TKD..F..VK.HSGINDATLR.NVTV...GN.D.....CLIEK..........V.....GN.......YIN..N..YT........IGDDCLISNVSVL.....E.........T.T........E..G..........ASFGEGNL......................ISVLNEV.GD.GNVILFHDL................N.SQFAAFM..............V..K.H..F.D..DKD..V.KNAIRRLV.KE.EI.M........RTN.P..D.RG..V..VGNRVKIINTREIT.N..TVIQDDCEISGASRLSDCTI.LS...SDK...A..S...VYIGTGVICENSIISEGSSIVNSVKMQDCFVGEACHVSNGFTASQSVFFANSYMANGEACAAFCGPFSASHHKSSLLIGGMF....SFYNAGS....GTNF.SNHAYKMGPMHWGTLERGSKTASGSYLLMP.........A..TI..G..TFSVCF.GKLM.HHPNTTALPFSYL.......I..A..........E.......A..D..K.......M..F........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIHKWPKRDM.RP.Q...N..A.pK..KSIVNFDWLSPFSVGEILRGKFILE.....N..LR.QA.S..G..DN........VSS.....................................................................YNFH.EYT.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......AHKW....G.F...F.G...-....--.-----....K.P..TTDV.G..I.G.EWRDLSGLLLPASEE.DRLIEDIKSGNLE.T.IQEVIDRFEEINHN...YRTYQWAWTYKM.IQNY..YG.......VD......-..-.E...I.TAEVDAKIKAD.Y.ITARRA....WIAEIKKDAEKEYK.MG-...------...------.---------.--.-..---------------------------dvdrevfeefvnsldretdyee................................................
A0A0A2DVY8_9PORP/1-650               .............................................................................................................................................m-RHLTQSEIEVLLR.N.GCTS..ED..WDK.I...T...V.........S...E.........N...F.L.....P.........D.........RCRSVTFIGE...CRI..GDLSG.FR..SS...EHG..F..HI.PNGIRNALIH.DCTI...GD.R.....VCIEN..........V.....HE.......CIS..K..YD........IGNDVTIKNVNII.....A.........M.K........G..E..........SSFGNGLP......................VSVLRET.GG.TEVILCDLL................T.SHTAYLM..............A..V.T..A.T..RDS.lL.RSRLHELF.AT.YA.A........QRR.S..G.RG..K..IEDGVRIKHTGSIL.N..ARIGAGAVIEGATYVEECSV.NS...RPD...A..P...VYIGHNVMAKEFIASSGSSMSGGATIQRCFIGQSTRIDHLYSAHDSLFFANCQLENGESCAVFAGPYTVSMHKSSLLIAGHV....SFLNAGS....GSNQ.SNHLYKLGPIHQGVIERGSKTTSDSYILWP.........S..RI..G..PFSLIM.GRHV.HHVDTSDFPFSYV.......I..E..........N.......N..D..E.......T..Y........LV.PGA.........................NL..R..S..V.G.........T...I.RDAKKWPARDR.RE.Q...E..G..R..LDCINFNLLSPYTISKMVNGHRKLS.....E..LR.SY.I..G..EH........GKT.....................................................................YIYR.NIN.I........RS....A....A...LE.......KG.....LEAY...R..MGIVKFIG.NSLI..Q.R.......LQER....I.P...K.N...G....AE.VDEVL....K.P..DHDT.G..L.G.EWVDLCGLIAPQRLV.QEILENIRNGFYK.T.PADLNRAFEHLHAS...YYDLEWDWSYNL.LREW..YG.......LS......E..K.E..vL.TVPFLIKVVEE.W.MQAVLS....LDRMLYADACKEYN.IAS...RIYFS-...------.SVPDAERGE.SS.V..EDNPFVQEVLDHIRRKEALGNETIQRL......................................................................
A0A4R8DTH0_9BACT/42-735              ..............................................................................................................................................YRHLNAHEIEVLVR.N.RNQS..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFYGL...IRI..GKLEP.WY..LE...FKN..L..RR.PVGLYNSTIC.SCDL...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........VGNDVLLVNVEEL.....A.........T.T........N..Y..........AKFGNGIVkvgep...........eerriwLEICNEN.GG.RSVIPFNGM................L.PGDAYLW..............S..R.Y..R.D..DDM..V.QERFKAFT.EK.KF.D........RQR.G..Y.YG..K..IGHRTVVKNCKTIK.D..VWIGSDAYLKGANKLKNLTI.NS...SAD...A..P...SQIGEGCELVNGIIDYGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----SPDGELVAGRG---------FWPglcvslkhnS..QF..A..SFVILSkGDYP.AELRIP-LPFALV.......S..Nd........vS.......R..D..Q.......L..V........VM.PAYwf.....................lyNM..Y..A..L.A.........-...-.RNSWKYTDRDK.RT.E...K..I..Q..--HLEYDYLAPDTIGELVEALRILE.....E..ST.GK.A..W..LR.......aGEKlgpggkgdptatgkrl....................................lesgspelksleilgegFEHS.PRK.T........VL....A....K...VP.......QA.....YAIF...K..DLIKYHAA.LQLI..H.F.......FQSN....T.T...A.G...L....DD.VKALL....S.P..AP--.R..L.Q.RWHNVGGQLIDQDSM.DTFRRQMRTGEIK.S.WEDVHDFYRRCGEA...YPQAKLLNALAA.WSEV..FG.......VS......L..R.D...L.DRSRVISLLWE.A.VDTKTW....MVEGIYASREKDYS.NPF...R-----...-GMVYA.SDDEMEAVI.GR.L..EDNGFIAQERKNLEAFALQVEGLAARL......................................................................
R6EC95_9BACT/4-595                   ..............................................................................................................................................YRSLTLDEVAALER.Q.GCTA..ED..WST.I...Y...V.........A...E.........D...F.L.....A.........D.........TVTDTHFYGE...IKL..GVYEQ.RM..EL...EEG..F..SL.PTGIRHATLK.DVTI...GD.N.....CLIEG..........V.....GC.......YIH..R..YD........IGDECYISNVGKL.....S.........C.A........P..D..........ATFGQGNT......................IAVLNEG.GE.ENVTLYAGL................S.PQVAALM..............A..L.Y..A.D..DRL..A.RESLRRIA.LR.QI.A........QEK.R..E.RG..Q..IGHRSKIVSATEIT.N..AIIGEDVEIYGVSRLAECTI.LS...TPE...S..S...TYLGHDVIVDNSIVQAGASVLDGAKISNSLVGEACHVGKGASLESTLLFANSYIDNGETCAAFCGPFTVSHHKSSLLIGGMY....SFYNAGS....GTNY.SNHAYKMGPIHWGTLHRGCKTASGAHVAWP.........A..TI..G..AFSMCM.GKIL.THPNVEDLPFSYL.......F..G..........M.......G..D..T.......T..Y........IV.PGR.........................NL..C..T..V.G.........T...Y.RDIHKWPKRDM.RP.R...H..G..G..KGIIDYDWLSPLTVKACLKGKKTLE.....T..LR.KE.E..G..EN........VAS.....................................................................YHYQ.GCV.I........KN....N....A...LQ.......RG.....IKYY...D..MAIRLFLG.QALD..R.-.......---E....R.I...D.-...-....--.-----....L.P..GSIV.G..T.G.EWIDLGGMLLPQEEL.ESLTEDIKQGAVA.S.MEQLEARLRLVHSH...YDEHRWNFAYKM.ALDV..CQ.......--......L..E.T...M.TDEDARRIRLA.C.EKAEKE....WKNNIRYDAEREFQ.MG-...------...------.---------.--.-..---------------------------dvae..................................................................
A0A249SVI5_9BACT/42-732              ..............................................................................................................................................YRKLTAQELETLVR.N.DNTS..DD..WNN.I...F...V.........A...E.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........A.....-N.......FLS..H..YI........IGNEVMITNVNEM.....A.........I.T........D..Y..........AKFGNGIVkegep...........envriwLELCNEN.GG.RNVMPFDGM................L.PGDAWLW..............T..R.N..R.D..DQQ..L.MQQFKSFT.EK.QF.D........KKR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...APG...A..A...SQIGEGCEMVNGIIGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAAVIm.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTLISkGTYM.HELDIP-FPFSLVm.....nD..E..........H.......D..N..T.......L..K........IM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.E...R..I..Q..--HIEYDYLAPDAIEELLQALPLIE.....T.aVG.KA.W..Y..KQ........QTKtttkatekdfrqkg.........................................itllhqhpeevaklAVYA.D-N.I........EN....S....N...RKvqllkvhRS.....YTLL...K..QLVVLYGI.RNIV..-.-.......----....E.Y...A.P...N....LE.SFTAL....Q.N.iVKTA.R..R.S.TWQNIGGQLMKTEVV.DDIKQRIRKGKIN.S.WHQLHETYTQVGEQ...YPLDKLQHAIAS.MLYI..QG.......IA......P..K.D...F.NTDLLKQWLQQ.S.VYTLGL....LTEGIYHSREKDYT.NPF...R-----...-KMVYE.NEAEMEAVV.GK.L..ADNSFIQQTIADLKAYKKKVKEL----srk...................................................................
R6DPD1_9BACE/21-675                  ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGN.V...L...V.........A...D.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFEA.EF..TL...RGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGSDTFIENVDII.....L.........V.D........G..L..........TTFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ISRMKSIA.DY.YS.N........KHA.S..A.VG..S..IGNHVMILNTGSIR.N..VRIGDYCHICGTCRLTNGSV.NS...NVT...A..P...VHIGHGVICDDFIISSGSQVDDGTMLSRCFVGQSCKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RQ.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LR.RV.S..G..VT........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..I.G.EWVDVSGLIAPKSEI.DRLLDGIENGTIN.R.LKSINACFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......LN......P..E.T...I.TAQDVIRIVKS.W.QEAVVG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSHDE.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEEKTTLGNELIKRI......................................................................
A0A2T7BG43_9BACT/42-733              ..............................................................................................................................................YRKLTAQELEILVR.N.DNTS..DD..WNN.I...M...V.........S...N.........E...F.N.....P.........Q.........LVQHCHFYGM...VRI..GKLEP.YF..LE...FRN..L..RL.AVGLYNSTIT.SCDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YI........IGNEVILFNVNEM.....E.........T.T........D..F..........AKFGNGIIkdges...........eerrlwMELCNEN.GG.RKILPFDGM................L.PGDAYLW..............T..R.N..R.D..DQQ..L.MDQFRILT.EK.QF.D........KRR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...RPD...E..T...SQIGEGCELVNGIIGYGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..TFTLIAkGNYM.NELDIP-YPFSLVm.....nD..E..........H.......D..N..T.......L..K........IM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKYIDRDK.RS.N...K..I..Q..--YIEYDYMAPDSMEELLHALPLIE.....Q.aVG.EA.WylQ..EK........QEVpgaktcikkgqell.........................................lhdpatvakmniyaSKVE.NSN.R........KA....A....L...LKv.....hRS.....YPVL...R..EIVNLYGV.RNIL..A.Y.......LAKQ....P.D...A.T...F....AQ.LQSL-....-.-..AKTA.K..R.G.PWQNVGGQLMREATV.EDLKNRIRKGKIG.S.WLQLHDVYKQEGAV...YESEKLQHAIAC.MMHL..HG.......VS......A..D.G...F.TPAFLKQCMEQ.S.VYTMGN....LTEGIYRSREKDYT.NPF...R-----...--KMTYsSQEEMDVVI.GK.L..EDNGFIRQTIAGLKTYKKTVKEV----skkw..................................................................
R7JPT4_9BACT/54-574                  ........................................................................................................................................arlrrc--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......TIR..N..YR........IGEEALIEGVTAL.....E.........C.R........R..E..........SSFGNGVR......................VAAINEN.GG.RTVRIYDRL................T.AQTAYIL..............A..V.Y..R.Y..RPE..A.VEAIERMI.ER.YA.A........ERR.D..T.LG..T..VGPHARITGARFIR.E..VNIGEGATIDGVSLLENGTV.C-...---...A..G...AYVGIDVQARDFIAAEGARIDGGTLLERCFAGECCTLDKHFTAVDSLFFANSHCENGEAVSIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GANQ.SNHLFKSGAVHQSIHARGCKFGSGTYIMAP.........A..IE..G..PFTLVL.GRHT.QHHDTSAFPFSYL.......V..E..........Q.......D..G..R.......S..A........LM.PGA.........................NL..T..S..Y.G.........T...V.RDIGKWLERDR.RT.V...K..R..-..-DRINFEEYNPYLAGGMIDAVNTLN.....S..LA.EA.H..-..PD........AES.....................................................................YVHN.HAL.I........RS....T....Q...LQ.......RG.....LKLY...N..KAIVASLG.AMLR..-.-.......----....-.-...-.-...-....--.---NG....E.P..GRAD.G..T.G.RWNDVAGQYVPRREV.KRILDAIANGGID.S.LEGIDRAFDRIAAD...YDHYARSWAEGV.LAQL..LG.......HA......P..S.P...-.--EEIAEAVTA.G.ERTRET....LRKSAEDDRARDCS.PAM...AVGYGV...DADSEEeKMQDYHTVR.G-.-..---------------------------i.....................................................................
R5PLK0_9BACT/5-659                   ..............................................................................................................................................YRPLTQEEIITLKK.Q.NCTA..TD..WNH.I...K...V.........A...P.........H...F.T.....T.........D.........YISNVRFSGD...IYL..GEFSQ.SF..HL...DGG..L..CK.HSGIYYATLH.NCRI...GN.N.....VLIEN..........I.....PN.......YIA..N..YT........IGDDCFIQNVNLI.....V.........V.E........Q..K..........SSFGNGTP......................VSVLNET.GG.REVPIFNEL................S.AHLAYII..............A..L.Y..R.H..LPV..L.TEKLKRLI.DR.YT.E........KHS.S..E.TG..S..IGRGVTIVSSGSIR.N..VIIGDKCTIDGASRLKNGTI.NS...NET...A..P...VYIGHNVVAEDFIIASGTSITDGATLVRCFIGQACHLGHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYILWP.........A..KI..G..AFSLIM.GRHV.NHPDTSDLPFSYL.......I..E..........K.......N..N..Q.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDALKWPKRDK.RT.D...P..C..K..LDYINFNLLSPYTIRKMIAGIEVLH.....S..LR.SV.S..G..ET........SEE.....................................................................YSYQ.SAR.I........KN....S....S...LE.......KG.....IVLY...A..KAINKFLG.NSLI..K.R.......LENI....R.F...R.T...N....EE.IRSRL....K.P..DTSK.G..A.G.EWIDLAGLIVPQKEI.ENLITAIENGEID.S.VEQICSFLEALHRD...YYTLEWTWAWDT.IQKW..YD.......IS......P..D.S...I.TAQDIIRIVNI.W.KEAVIS....LDEMLYNDARKEFS.LMA...QTGFGV...DGTNHQ.KQMDFEQVR.GD.F..ESNPFVETVRHHISDKTALGNELIERM......................................................................
R6VLW9_9BACT/2-599                   .............................................................................................................................................q-RLLSEQEINILEL.N.GCQA..ED..WTA.V...S...V.........S...E.........D...F.T.....P.........D.........YLHNVMFYGD...VSL..GVFER.TI..EV...SPG..F..SK.HSGIRNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YT........IGANCYISNVCVM.....E.........T.I........E..G..........ATFGQGNV......................VSVLNEV.GE.GNIMMFGLL................N.SQFAAFM..............V..K.H..H.S..DHH..L.RDTIYRLI.RE.EI.N........CTM.P..D.RG..T..IGERVKIVNTKEII.N..SVIGPDCEISGASRLSDCTL.QS...V-G...Q..P...VYIGTGVICENSIISDGSSVINSVKMQDCFVGEACKISNGFTASQSIFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGAKTASGAYILMP.........A..KI..G..TFSVCF.GKLM.YHPDTRCIPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NL..T..T..V.G.........L...Y.RDIRKWPKRDI.RP.L...S..K..H..RSIVNFDWLSPFSVNEVIQGKAILE.....R..LR.EA.S..G..DN........VST.....................................................................YNYH.MYV.I........NA....A....S...LR.......MG.....ISHY...D..MALRIYMG.AVVK..R.V.......LKRY....G.A...V.-...-....--.----E....P.P..ASTI.G..E.G.AWSDLSGLLLPESEE.QRLIEQIKDGTLD.D.VQSIIDEFVAIDGR...YRDYQWAWTYRL.ILDY..YH.......ID......-..-.H...I.TQADIDRIHTD.Y.VEARRM....WISEIRKDAEKEFN.MG-...------...------.---------.--.-..---------------------------dverev................................................................
A0A2T5C3R2_9BACT/6-660               ..............................................................................................................................................YRSLRTEEIEQLTK.Q.NCQA..ED..WSR.I...F...V.........S...D.........E...F.D.....P.........T.........RFMSVQFSGT...IYL..GSQTG.EI..EL...YGG..V..KK.QCGIYHAHLH.NCEI...GD.N.....VFINH..........I.....KN.......YIA..N..YS........IHDHVIIDNTDIC.....A.........V.E........G..P..........STFGNGTT......................VDVMDET.GG.RSVVIYDEL................S.AHLAYIM..............A..F.Y..K.H..RHD..A.VCKIETMI.GQ.YC.H........EVE.S..N.KG..V..LGEHTQIFNCKELR.N..VKTGAYTRINGASSLQNGTI.NS...TKS...A..P...VLIGQDVILKNFIVSSGTEISDGAIVSNCFVGQGCSIGAQYSAQNSLFFANCQGFHGEACAVFAGPYTVTHHKSTLLIAGMF....SFCNAGS....GSNQ.SNHMYKLGPIHHGVVERGSKTTSDSYLLWP.........A..KI..G..AFTLVM.GRHY.KNSDTSDMPFSYL.......I..E..........K.......N..D..E.......S..W........LV.PGV.........................NL..R..S..V.G.........T...I.RDVLKWPKRDK.RT.D...E..H..Q..LDCINFNLLSPFTIQKMAQAIAILH.....Q..IR.RI.S..G..ET........TGE.....................................................................YSYN.NTR.I........KR....D....A...LH.......KG.....LKLY...D..MAIMKFIG.NSII..T.R.......LNKA....Q.L...E.G...G....AG.LQDCL....K.A..DSEI.G..L.G.DWIDLSGLLAPKNEV.IKLLNGIENGTIT.D.LKTIDQFFRTLHQN...YYDYEWNWTVRF.MESY..LQ.......KP......L..A.D...F.SRDELIDIIRK.W.RESVVE....LDELLYEDAKKEFR.LDS...MTGFGI...DGDQEI.KQKDFEQVR.GR.F..EENSFVKEVLHHIDRKTKLGERVINQL......................................................................
F9D4C8_PREDD/3-617                   ..............................................................................................................................................YRKLTDNEIMVLED.R.NCWA..ED..WNN.I...N...V.........A...E.........D...F.L.....P.........N.........YMHRVMLYGE...VNI..GVFER.NV..EV...SKD..F..YK.HSGINNATLR.NVTV...GD.N.....CLIEN..........I.....GN.......YIN..N..YT........IGDDCYISNISTL.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GD.GNLILFRHL................N.SQFAAFM..............V..K.H..F.R..DRD..L.RDPIRRLI.RE.EI.A........ACT.P..E.RG..T..IGDRVKIVNTKEIT.N..SVICDDCEINGAARLSDTTI.LS...SPN...A..N...VYVGTGVICENSIISDGSSIINSVKMQDCFVGEACQISNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGTKTASGAYLLMP.........A..NI..G..TFSVCF.GKLM.HHPDTRNLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.Q...G..S..Q..KSIVNFDWLSPFSVGEIIKGKKILE.....D..LR.DA.S..G..ED........VSS.....................................................................YNFH.EYV.I........NA....S....S...LK.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......VRKR....D.P...-.-...-....-E.---LC....A.P..ETTV.G..L.G.DWNDLSGLLMPASEE.QRLIDDIKNGTLD.S.IDGITSRFEDINAH...YREYQWAWTHRL.ILDY..YG.......LD......-..-.R...L.TPEATQRIKAD.Y.VSARRT....WIAEIRKDAEKEYR.MGD...------...------.---------.--.-..---------------------------verevldnfvnsldhetdfed.................................................
A0A3M9NSQ7_9BACT/42-703              ..............................................................................................................................................YRRLSGSEIEILIR.N.GNTS..DD..WGK.I...F...V.........S...K.........A...F.D.....P.........T.........LVKNSKFHGL...IRI..GKLEP.FY..LE...FHN..L..RM.PVGIYNSHVI.SCDF...GD.N.....VCIDN..........A.....-G.......YLS..H..YI........IGNEVMITNVNEL.....A.........T.T........D..Y..........SKFGNGILkegen...........entrvwIEVRNEN.GG.RRIAPFDRM................L.PGDAYLW..............S..N.N..P.E..DKI..L.QQRFLDLT.HN.ES.S........TKR.G..F.YG..T..IGDRCVIKDCDIIK.D..VIIGTDAYLKGANKLKNLTI.NS...DKE...R..T...SQIGEGCEMVNGIVGYGCRIFYGVKAVRFIMAAHSQLKYGARLINSYLGNNSTISCCEVLNTLIFPNHEQHHNNSFLCAALVm.gqSNIAAGAt..iGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFCILAkGDYP.FELNIP-IPFCLV.......S..N..........Dv.....aN..D..K.......L..V........LM.PGYwf.....................myNM..Y..A..L.E.........-...-.RNAWKFKDRDK.RT.E...K..I..Q..--HIEYSYLAPDTINEMFDSIEILS.....K..LK.VD.D..E..GN........AQI.....................................................................GDIE.NSKrI........TE...iV....K...IK.......ES.....VDLF...R..ELIGYYGT.VQLI..N.H.......INAN....K.F...S.S...F....DE.FKKSI....P.V..--KI.S..R.T.KWRNIGGQLIPASDV.EKLKDQIKTSKID.S.WKEVHEFYHKSGED...YEKNKLIHAYTS.LLEI..EN.......IT......S..K.Q...L.TPEYFRQLLER.S.VVTKTW....ASKAIYESRAKDYS.NPF...R-----...-KMIYE.NAEEMNTIM.GK.L..EDNHFIQDQFKDLDAFKKTVKGLIKK-y.....................................................................
C5LJA7_PERM5/45-565                  .............................................................................................................................................l-RPLTADEIAALQG.S.GCTA..ED..WGE.I...M...V.........I...G.........Ds.pL.A.....V.........G.........KIRGCTFQGR...IEL..AVEEG.SK..VS...IGDsrR..QL.PCGIVNSFLE.DVTV...ES.G.....TLVKD..........C.....-G.......LVA..N..TV........VRRGAVLVRCSVVe...gS.........T.E........S..H..........CKYGNGHS......................MSLAEET.GS.RRTRQFAEL................T.IEIAAKV..............V..S.N..R.K..ESD..AyHAAVDAYV.DA.VE.D........AGQ.G..-.RT..I..IDENAEVISCCSIK.G..SYIGRHVRVVN-SRVHNSSL.--...---...L..D...FNIVEDCSLNTAILQKSASVATFGVVEGSVLCPTVHVERHGKVFDSIIGPGSGVAEGEVTASLVGPFVGF-HHQALLIACFWp..aGRGNVGH....GANVgSNHTG-KAPDQENWPGEGTFFGLASNIKYP.........F..HLvdA..PYSLIA.TGVS.CLPQAIGLPFSLV.......N..E..........S.......S..E..Y.......I..N.......gLS.PAIneitp..............gwmlsdNM..Y..S..L.F.........-...-.RNEAKFESRQR.NL.S...K..D..G..-VMYQFAVFRPEIMDRVVKARDALK.....A..AD.PK.D..A..KL........KDAkgrav..........................................................ftdkeiPIMG.KNW.M........ND....S....T...RL.......IA.....IKTY...S..TFLQWYAI.RGLW..R.R.......LASI....H.F...E.S...G....H-.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------acsdeaaklvss..........................................................
V5WCM9_9SPIO/39-492                  .............................................................................................................................................l-RTLSHDEVQSLER.Q.GNVC..HD..WSR.I...R...V.........V...E.........D...F.S.....A.........A.........FITQNLFIGD...VVL..GYFDG.RMicNQ...ESA..G..SL.PSGIHRSTIE.SSHI...AS.G.....SAVHN..........C.....PR.......IFA..T..LV........VRDS-LLSNSSTG.....L.........T.A........G..Sr........gTLYGNGVN......................IPVGIET.GG.REISLYSDL................S.LELAEYV..............L..M.H..P.G..SAA..V.EDAYGTHL.SE.YL.E........RIR.F..N.WT..I..IDKHSRILDCRSIV.N..SYIGPYSRVLGADEISNSSI.FS...TSS...D..P...SVVTNSSIIRNSILQDGVEVSDASIIQNSMLFEHSHAEHHGKIVDSIIGPNSGVSKGEITSCFLGPFVGFHH-QSLLIAAFWpggrGNVGYGAn..vGSNH.TSR----MPDQECWPGEGMFFGLSCAVKYP.........A..NFrkA..PYSIVA.AGVT.TLPQKLEYPFSLI.......N..E..........P.......V..G..Y.......F..L........EVpPGFnnlip..............awglsaNL..Y..S..L.K.........-...-.RNEAKYYKRNK.AR.R...-..N..R..---FDLRVFRPEILEYMRDAVGMLE.....N..IR.ER.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ktiylpg...............................................................
A0A4U9JS85_9SPHI/42-717              ..............................................................................................................................................YRNLTEEEIRILEL.N.NNES..TD..WND.V...L...V.........T...D.........K...F.I.....P.........Q.........QIKRSKFFGL...VRI..GDMEE.VY..LE...YRD..I..RL.PVGIYNSQII.SCDL...GD.C.....VALHQ..........V.....-R.......YIA..H..FI........VGNEVILLNVNEM.....E.........T.S........S..N..........AKFGNGILkegdp...........eksrifLELCNEN.GG.RSVLPFDGM................Q.AADVYLW..............T..R.N..R.Q..DKE..L.QKRFFDIT.NQ.KF.N........DIR.G..Y.YS..E..IGDRTVIKNSHTFK.N..VKIGSDAYIKGVSKLKNVTI.NS...TSE...A..Y...TQIGEGCELVNGIIGYGCRVFYGVKAVRFILSSYSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALIk.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIK-FPFSLV.......S..N..........Dv.....tH..D..R.......L..V........IV.PGYwf.....................myNM..Y..A..L.M.........-...-.RNTNKFISRDK.RS.F...K..N..Q..--YFEYDILAPDTVNEIFTGIKEIK.....S.aVS.KS.L..N..IS........-DPlqwlnnnek...................................................tneeifldnAEFS.KRK.V........LL....L....K...PK.......ES.....FHLF...K..KLVRYYAV.CQLM..E.H.......VDPN....G.F...N.-...-....DN.IKSLI....D.K..G--L.K..R.E.EFENVGSQLIPVSKL.DDLLNNLKSGQID.S.WDEMHSNYRQLSSD...YVQDKLQHSLAS.LQEI..TE.......TD......P..Q.N...W.NAEFWNELFDE.A.LQTKKW....ICDEIYNSRSKDYH.NPF...R-----...-LMVYE.SEAEMNEVV.GK.L..EDNSFINLQSSEFENFQSRI-------kdfksql...............................................................
A0A1I3HNM6_9SPHI/41-726              ..............................................................................................................................................YRQLSADEVAILTR.N.GNYS..PN..WGD.V...W...V.........T...D.........R...F.L.....P.........E.........QVQQSTFYGR...VRI..GDMEE.SF..LD...FRD..L..HL.PIGIYNSVIV.SSDI...GG.Y.....NAIHN..........V.....-R.......YMA..H..FI........LGEEVMLFNINEM.....E.........T.S........N..N..........AKFGNGILkegda...........essliqLELCNEN.GG.RAVLPFEGM................Q.ASDVYLW..............T..R.Q..R.H..DRL..L.QSRFREIT.FR.RF.D........TRR.G..Y.YS..V..VCHRTVIKNSDIIK.D..VKIGTDAYIKGVNKLKNVTV.NS...IAE...A..Y...TQIGEGCELVNGIIGHGCRIFYGVKAVRFILCSFSQLKYGARLINSFLADNSTISCCEVLNSLLFPAHEQHHNNSFLCASLVm.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIR-LPFTMV......sH..D.........vA.......N..D..R.......I..V........IL.PAYwf.....................lyNM..Y..A..L.M.........-...-.RNNGKFISRDR.RS.L...K..N..Q..--HFEYDVLAPDTVNEAFTA---LH.....E..IE.IA.V..G..KT........YHPeagdpaewgakgkail.....................................adatmdlrekeivldgVENS.KRK.V........VL....I....K...VR.......EG.....YNTY...R..RIIAYYAA.TQLK..A.Y.......LNTY....S.F...A.E...L....R-.-ADYL....S.R..SGRM.E..R.A.GFENVGGQLIRKPDL.DDLLEHIRSGELA.E.WEAIHHQYHLLSSR...YLTHKFEHALAT.FLEI..HD.......LE......K..S.A...L.TPAYLDTCIAE.S.VATKQW....ICGEIYKTRAKDYQ.NPF...RT----...--MVYE.NDEERDIVI.GR.L..EDNAFIRQQQDEYERYTESI-------tgir..................................................................
A0A414BRT7_9BACT/4-611               ..............................................................................................................................................YRPLTSEEIEVLKS.N.DCWA..ED..WTS.V...N...V.........S...E.........D...F.K.....P.........N.........YMHRVMLYGE...VNI..GSFNK.NV..EV...SQG..F..VK.HSGINNATLR.NVTI...GD.D.....CLIEN..........V.....GN.......FIN..N..YT........IGDDCYISNISTM.....E.........T.T........E..G..........ATFGEGNL......................VSVLNEV.GE.GNVILFSDL................N.SQLAAFM..............V..K.H..F.S..DKE..L.KENIRQLI.KT.DI.E........NKA.P..E.RG..Q..IGSNVKIVNTKEIT.N..CVINDLCEVNGASRLSDCTL.LG...SVH...G..N...VYIGTGVIIENSIIAEGSSVINSVKIQDCFVGEACQLSNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGTLERGSKTASGAYLLMP.........A..TL..G..SFSVCF.GKLM.HHPNTRNLPFAYL.......I..A..........D.......G..D..K.......M..F........LI.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDL.RA.P...E..N..R..KSIVNFDWLSPFSVGEILKGKKILE.....S..LR.EV.T..G..DN........VSQ.....................................................................YLYH.EYI.I........PA....T....S...LH.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKRD....P.-...-.-...-....-A.I---T....P.P..STQT.G..V.G.DWDDLSGLLLPVSEE.ERIVKDMREGNIE.T.IQQLLERFEEINNN...YREYQWAWTYSV.ICDY..YG.......IS......-..-.E...I.TLEDANRIHED.Y.IRARRS....WIAEIKKDAEKEYA.M--...------...------.---------.--.-..---------------------------gdveeevfrnfvnnld......................................................
A0A1T5NI53_9BACT/41-730              ..............................................................................................................................................YRKLTAHEIESLVR.N.DNTS..DD..WNI.I...F...V.........S...N.........E...F.D.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RM.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........LGNEVIVANVNEM.....A.........T.T........D..Y..........AKFGNGILkeges...........esgriwMELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.Y..R.D..DEQ..L.QQQFKSFT.EK.QF.D........KRR.G..Y.YG..M..VGDRTVIKNCKMIK.D..VTIGTDAYLKGANKLKNLTI.NS...NSE...A..S...SQIGEGCEMVNGVIGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTLISkGNYM.SELNIS-IPFSLVv.....nD..E..........H.......E..N..R.......L..K........IM.PGYwf.....................lyNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RT.D...K..Q..Q..--LIEYDYLAPDSVEEIFQALAIME.....T..AT.GK.A..W..YA.......lPENapkkeltekdirkk.........................................gkdllnnnpeevakLTIL.SKG.F........EN....S....S...RE.......VE.....LLKV...H..RAYPLFIE.MVVL..Y.A.......VKNI....L.A...A.D...K....PS.FLALQ....A.A..VKTA.K..R.G.DWQNIGGQLMKAETV.ATLKTKIRKNKIS.S.WPQLHTAYEEIGNE...YAADKLQHAVAC.LLEI..KD.......SS......L..K.N...M.TTADLAQWMND.S.VVTMEW....ITAQIKRSREKDYK.NPF...R-----...-QLAYE.SEKEMNAVI.GS.L..EDNSFIKQTAEDLEKYKLQVNKTI---se....................................................................
A0A6G0WLP3_9STRA/35-548              ............................................................................................................................................qp---VTPAQIQILEQ.N.GNHA..DS..WTT.V...Y...S.........S...G.........N...LaS.....L.........R.........RVRNCSFRGH...VYL..GAFTK.DV..LV...-DN..V..PF.PSGCYNSTLV.DSFV...LD.N.....ALVQD..........T.....-F.......LLH..Q..TY........VDTGACIVGCGSV.....T.........S.S........G.pN..........ATYGNGTV......................LKVGVEI.GG.REISVFADM................P.FALGAAV..............G..Q.H..R.E..NAS..E.LQAYDGRV.KE.YV.E........SIK.C..G.LN..I..VAKQAKVLRCAKLR.D..IFVGEGALVEDS-VVTNTTI.LS...TIE...E..H...SSITGFSKVHSAIVQWSAHVEGGSSVERSFLCDASHVERHAMIMDSLLGPNTSIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..qGRGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLAVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALV......nI..P..........G.......H..N..I.......P..E........LS.PAI.........................NE..I..S..P.GwvlsssiftV...L.RNQDKF---DR.RN.H...S..K..R..-TPLDVQIFRPEIVRMMQVACQRLR.....D..AE.KK.P..V..KIr......hGKE.....................................................................LIYT.DKQ.VpglgknymTE....R....S...RV.......AA.....IEAY...S..FYIRYFAL.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------egywqllqhgtisietpfdqisvsde............................................
A0A0L0F623_9EUKA/1-120               ............................................................................................................................................sy------SEVAQLER.Q.GCGA..ED..WAS.V...L...V.........A...E.........K...F.N.....A.........R.........RVRNCEFHGR...VRL..GVFTG.RI..NT...-GT..S..YL.PTGVFSTDLS.NVTV...GN.N.....SLVTR..........N.....-S.......HVA..N..CV........VGENVCIIGCGEL.....A.........C.T........G..S..........TTFGQGQE......................LPIAIE-.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------v.....................................................................
A0A1Y1S3R9_9SPIO/11-667              ..............................................................................................................................................YRQLSPEEKKQLLA.N.GNRV..ED..WST.F...F...V.........C...D.........P...F.F.....P.........D.........LIRNTSFSGE...IRI..QGLHP.ER..RS...HDG..R..TL.EVGICNSEIR.DCRI...GG.Q.....TVIRN..........L.....-A.......YCA..N..FN........LGQGCILSDIQEI.....Y.........T.R........P..G..........AKFGCGIRnpgee...........essrrrISLINEA.GD.RGVPPFPGM................T.GSDAFLW..............S..R.Y..R.E..DSE..L.MRRLEEIT.DR.SF.-........-SG.S..D.RG..E..IGENTFIQGCRSLI.D..LRIGSFCRIRGADVLEDLSI.DS...SGD...E..P...TSIGFGTILRRGITGPGCSILDGAMAEDFVLASHVTLTKGLRLSHCFVGDNSTIACCEVSNSLIFPFHEQHHNNSFLIASLLm.gqSNLAAGAt..vGSNH.NSR----SADNELHAGRGFWPGLNVSLKHP.........S..RF..A..SFTLIAkGSYP.SELDIP-LPFSLVn.....nN..E..........H.......D..G..C.......L..D........II.PAFw.......................wNY..N..M..Y.A.........L...V.RNSRKYAARDR.RI.Q...P..R..Q..--HLEFDFLAPDTAAEIRSALELLD.....Q..WD.PT.G..E..ADn.....leAPR.....................................................................GLVE.RSR.R........RV....R....I...LKa.....aAA.....RQAY...R..EMLLYYIA.STLL..P.G.......LEEK....G.-...-.-...-....AG.LIAGL....PgD..TDTA.D..P.L.EWINMGGQLVPERKV.DLLRDEIRSGNLA.G.WQDIHRRCEKWDKT...YPAEKIRDAWAC.FLLL..EG.......NI......P..D.A...P.GW---QRLFTA.A.EQIQEQ....IAGEVYKSRSKDFL.DPF...R-----...-TVNFQ.NEAEKTAVL.GT.I..DGNEFVRQIRKESDVM-----------irrfrsvrq.............................................................
A0A4R4BR74_9SPIO/627-789             ......................................................................................................................................asaelssp--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.A.AWENFGGQLVPASRV.DALRQAIREGRIC.S.WDEIHATYEEWFRR...YPEDRLSHAQQL.VCIL..FErglmaswMQ......E..S.T...L.QPAPLVEELKK.V.YALSQW....MENEVRHSREKDYT.DPF...R-----...-AITYR.NKEEMEAVL.GR.L..EDNPFIGVFQEECRKFREILQRFIEK-w.....................................................................
A0A1Y3QYI1_9BACT/54-575              ...........................................................................................................................................ari--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........I.....RS.......RVC..N..YH........LGEGALVEGVTAL.....E.........C.R........R..R..........STFGNGVG......................VATMNEC.GG.RTVKIYDRL................S.AQAAYLM..............A..V.Y..R.H..RPQ..T.MAALEKMV.DD.YA.E........TRA.S..Q.TG..S..VGKDSRIVGARFIR.E..VRIGDNVTVDGASLLENGTV.C-...---...D..G...AHIGVDVKAYDFIAAENARIDNGSIVERCFVGESCRLDKAFTAAESLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGAVHQAVHLRGCKFASGAYIMSP.........A..LE..G..AFTMIM.GHHS.FHHDTSAFPYSYL.......I..E..........K.......E..G..R.......S..V........LM.PGA.........................NL..T..S..Y.G.........A...V.RDIEKWPARDR.RT.I...R..R..-..-DVINFEEYNPYITSGMLRAVDTLH.....A..IA.EE.-..D..PD........APT.....................................................................YVHQ.KAI.I........RA....A....A...LK.......RG.....IGLY...N..RFIVAALG.AMLD..R.-.......---G....E.-...-.-...-....--.-----....S.A..ERYD.G..S.G.RWLDIAGQYITKREV.EAILDAIDHGELT.S.PEEVDNRFRVFSVH...YDDYAHSWAEGV.YASL..LG.......HI......P..-.-...-.TVAEIEEAIAA.G.RNARAT....MRRTTDADRDRDCS.LDM...AVSYGL...DSDDEGeVRDDYYSVR.G-.-..---------------------------l.....................................................................
D1PYX7_9BACT/5-618                   ..............................................................................................................................................YRNLTDKEIITLED.R.SCWA..ED..WSN.V...H...V.........A...E.........D...F.K.....P.........N.........YMHRVMLYGE...VNI..GAFEK.NV..EV...TKD..F..FK.HSGINNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YT........IGDDCLISNISTI.....E.........T.T........E..G..........ATFGEGNL......................VSVLNEV.GD.GNVVLFKGL................N.SQFASFM..............V..K.H..F.H..DKE..L.KKAIRRII.RE.EI.A........TTS.P..D.RG..T..IGSRVKIVNTKEIT.N..TVISDDCEVNGAARLSDTTI.IG...SPD...A..S...VYIGTGVICENSIICDGSSIVNSVKMQDCFVGEACHISNGFTASGSVFFANSYMSNGEACAAFCGPFSASHHKSSLLIGCMF....SFYNAGS....ATNF.SNHAYKMGPMHWGTLERGTKTASGAYVLMP.........A..TI..G..TFSVCF.GKLM.HHPNTRSLPFSYL.......V..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIQKWPKRDL.RP.K...T..S..Q..KSIVNLDWLSPFSVGEIIKGKKILE.....D..LR.AA.S..G..ED........VSS.....................................................................YNFH.EYV.I........RG....S....S...LK.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......VRK-....-.-...-.-...-....-R.YDSVV....P.P..TTDI.G..L.G.DWNDLSGLLLPDTEE.QRIIQDIKNGTLD.T.VDKIVERFVEIDQN...YRAYQWAWTYRL.ILDY..YG.......LT......-..-.E...L.TEEDAARIKKD.Y.ISARRS....WIAEIRKDAEREFE.MG-...------...------.---------.--.-..---------------------------dveqdvfdnfvnsldhevdye.................................................
A0A4Y1WZ97_9BACT/53-574              ..........................................................................................................................................gari--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........V.....RS.......RVR..N..YR........IGEGSSVEGVTAL.....E.........C.R........S..R..........SAFGNGTA......................VAAMNEC.GG.RTVPVFDRL................S.AQVAYVL..............A..I.Y..R.H..RPQ..T.IAALEAMI.RT.YA.E........ERS.S..E.LG..E..VGRGCRIVGARFIR.E..VRIGDDCRIDGASMLCNGTL.C-...---...D..G...CRVGVDVKAYDFIAAEQARLDNGATVERCFVGESCRLDKGFTAVDSLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGPVHQAVHLRGCKFASGTYVMSP.........A..LE..G..AFTMVM.GHHS.YHHDTAIFPYSYL.......I..E..........K.......E..D..R.......S..V........LM.PGA.........................NL..T..S..Y.G.........A...V.RDIEKWPARDR.RE.V...R..R..-..-DTINFEEYNPYVTGAMLRAVDTLH.....S..LE.EG.-..D..PD........AAE.....................................................................YGYN.KTM.I........RA....A....A...LR.......RG.....LKLY...N..KAIVAALG.AMLG..R.G.......A---....-.-...-.-...-....--.-----....S.S..ERYD.G..G.G.RWIDAAGQYITLRET.EAILDAIDRGELP.T.TDAVDNRFRVFFVH...YDDYAHSWAEQV.CAAM..LG.......HA......P..-.-...-.TAEELNDVIAA.G.RNAHEA....MRRTTDADRERDCS.PEM...AVGYGL...DGDGTT.RMEDYRAVR.G-.-..---------------------------l.....................................................................
A0A133XRC5_9BACT/1-625               .............................................................................................................................................m-RKLTRQEIKELQE.K.GCTA..TD..WSL.L...H...V.........A...E.........D...F.D.....T.........G.........ALESVTFIGE...NYL..PRLER.--..--...---..-..KN.NEGIYRAILS.YCII...ER.G.....VYISD..........I.....AD.......GIH..H..YH........IGEKCIIQNVQKI.....F.........Y.E........P..H..........TRCGEGAE......................VFPLDET.GS.RSVFLMDTL................T.APLAYLL..............L..F.A..R.Q..KEE..F.SQEFVKLS.EK.YI.N........TQKpT..S.HS..F..IANQSVIKSCGELY.N..LHIKNRAEITHIPRLYNVTL.SG...C--...-..-...-RLSTGAILEDAICVEGSVVEEYSILTRCFVGECSHIKGAFSAHDTLIFSNCQLANGEAVASVLGPHSVSAHRSTLLVGSLV....SFFNAGS....GTNQ.SNHHYQLGPIHYGLMERGCKTASNAYLLWP.........A..HI..G..AYSLLS.GRIV.NRNNYLDFPFSHL.......Y..Q..........D.......G..K..A.......V..F........LE.PGV.........................QL..A..N..I.G.........L...Y.RDVYKWRHRDQ.RK.T..lE..K..P..QDLIDYQMLTPAVVYHLLKGYKLLV.....S..TK.E-.M..H..PE........AEK.....................................................................YIVH.SAY.V........SK....G....V...ME.......RG.....IRYY...R..TALLLYLV.E---..-.H.......---F....S.A...W.S...E....AK.-----....-.-..CENV.Y..E.S.SFFDLMGATISEKSL.QGLLQRLASGQFS.S.IEEVHTFLQKHCD-...---PNVTHLYGE.VLET..LS.......PE......G..A.S...-.HSEKLYSLTEE.M.AQEIPK....MLGEALRMAEKEAY.PKK...SVGFGL...LASTEE.ETQNEIRLL.GEpI..LQQPFVLEFTERIEQLRLKIEEI----kvsl..................................................................
A0A6A4FHP2_9STRA/33-548              ............................................................................................................................................ff--PLSDAEIRALEA.N.GNSA..DD..WSN.V...R...K.........T...H.........EhepL.Q.....T.........P.........SIRQCSFHGR...VAL..GSFSA.SY.sHD...VDG..I..PF.RCGVYNSALS.NAGV...LD.D.....ALVKD..........T.....-L.......VLK..N..VL........VDARAAVIQCGSV.....T.........G.P........EqlD..........AVCGNGRV......................LHVGVET.GG.RDLRVVADM................P.FALGAAV..............A..T.K..R.R..DVE..F.LESYDAFV.DK.YV.A........EIK.A..P.MA..I..VAQNARVRGCARVE.G..TFVGEHALVEDS-DVANSTI.LS...TAE...E..P...SVVRMKSIVRDSIVQWNSTVETLSVVEGAFLCDTSHVERHGVVMSSVIGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASVWp..kGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......A..H.vI.......A..S........LS.PAInei..................spgwVL..S..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEGAIFRPEIVQYMKDARSELA.....A..AE.GK.A..K..ISl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RQ.......AG.....IAAY...T..FFIKLYAV.EALL..L.L.......VESG....R.I...S.A...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------dgtvgtsd..............................................................
A0A416GHY3_9BACE/4-658               ..............................................................................................................................................YRKLTKEEIDCLKR.Q.FCEA..DD..WQH.V...E...V.........A...E.........G...F.S.....P.........E.........HVRQTRFSGQ...VRL..GVFHD.EF..TL...SGG..I..VK.HSGLRNVTLH.HVTV...GD.N.....CLIEN..........V.....KN.......YIA..N..YC........IGDHTFIENVDTI.....L.........V.D........G..K..........TRFGNGVE......................VSVLNET.GG.REVLIHDHL................S.AHQAYFM..............A..L.Y..R.H..RPL..L.IDKMRRII.QE.YA.D........IHA.S..E.IG..T..IGSHVTIVDSGYIR.N..VRIGDFAKIKGAGRLKNGSL.NS...NEA...A..P...VHIGQGVICDDFIISSGSRVEDGTMLTRCFVGQACHMGHTYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYVLWP.........A..RI..G..AFSLVM.GRHV.HHPDTTNLPFSYL.......I..E..........E.......Q..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..N..R..LDQINYNLLSPYTIQKMMNGRRILK.....E..LA.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....A...LN.......KG.....IMFY...E..TAIQKFLG.NSII..K.R.......LEQL....E.Y...T.D...D....EA.LRVWL....K.P..DCPI.G..E.G.DWVDISGLIAPKSEV.ECLMDDIEQERVR.T.VDQMHERFAEMHRN...YYAYEWTWAYGK.ILEY..YH.......LN......P..E.T...I.SRQDVIDIVQR.W.QAAVVG....LDRMVYEDARKEFS.LSA...MTGFGA...DGSRTE.QQMDFEEVR.GA.F..NSNPFVTAVLEHIRVKTELGNELIARL......................................................................
A6LH30_PARD8/4-658                   .............................................................................................................................................l-RNLRPDEIATLRS.Q.ACRA..DD..WNQ.V...W...V.........P...E.........V...F.D.....I.........E.........YVNHVRFSGV...VKL..GAFRK.IF..TL...PGG..L..VK.HSGLRHVTLH.NCTL...GD.N.....VLIEN..........V.....QN.......YIA..N..YQ........IGDDCFIQNINVM.....L.........V.E........G..K..........ATFGNNVE......................VSVLNET.GG.REVPIYDGL................S.ASLAYII..............A..L.Y..R.H..RPA..L.IERLRDMI.TA.YT.E........GIA.S..T.EG..T..VGDKVKIVNTGTIR.N..VKIGDYATIENSARLENGSV.NS...KRE...A..P...VFIGDSVIAQDFIVSSGAKIADAAKIIRCFIGQACQVTHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RI..G..AFSLVM.GRHH.HHSDTSDIPFSYL.......I..E..........K.......D..D..E.......T..Y........LV.PGI.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..D..R..LDMINYNLLSPYTIQKMLKAVDILK.....N..LQ.AL.V..G..ET........SEI.....................................................................YYYQ.NTR.I........KG....S....S...LR.......NA.....LNFY...G..MAINKFFG.NSLI..K.R.......LEGT....T.Y...C.S...M....EE.VWEQL....R.P..TESK.G..S.G.EWLDLAGLILPREPL.EALLQDIEQGEIA.S.LEDVECFFRLVHGR...YYSLEWTWAYEM.IERY..YG.......VD......L..R.S...I.SAAEIIDLVRR.W.QECVIR....LDEMLYEDARKEFS.LTS...MIGFGV...DGSNKE.KQQDFEGVR.GD.F..VNNPFVTAVQEHIVNKRALGDELIERL......................................................................
A0A327QF19_9BACT/42-730              ..............................................................................................................................................YRKLTAQEIEALVR.N.DNTS..DD..WNN.I...F...V.........A...N.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIS.SCDF...GD.N.....IVVHN..........V.....-N.......FLS..H..FI........IGNEVMIANVNEM.....A.........T.T........D..Y..........AKFGNGITkeged...........esvriwMELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.H..R.A..DDV..L.QNRFKQFT.EK.QF.D........RKR.G..Y.YG..M..VGDRTVIKHCNILK.D..VIIGSDAYIKGANKVKNVTV.NS...SAE...A..P...SQIGEGCEIVNGIIGYGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAATIm.gqSNMAAGAt..iGSNH.NSR----GADGEIVAGRG---------FWPglsvtlkhnS..QF..A..CFTLISkGNYM.HELRMP-FPFSLVl.....nD..D..........H.......T..N..T.......L..K........IM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYVDRDR.RT.D...K..T..Q..--HIEYDYLAPDAIEELLHALPVYE.....T.aVG.EA.Y..Q..LQ........HNLsleedlraigknlll.......................................tnpaavaglkvfvkgIENS.NRP.V........EL....L....K...LH.......RS.....YPLF...R..SLIILYGV.QNLV..N.N.......AAAF....Q.L...N.D...L....PA.LRACC....K.D..---A.K..R.E.DWKNIGGQLMPASHL.QRIVNDIKSGEIA.S.WNALHDHYRIESNN...YKKHKLQHALAS.MLQI..AG.......LS......A..D.E...L.DGNNLQSLFDI.A.IETLET....ITHNIHHSREKDYK.NPF...R-----...--QMTYeNMEEMEKVL.GK.F..SSNGFINETKEILA-------------gfkeaakstlqn..........................................................
H9UMP2_SPIAZ/30-469                  ..............................................................................................................................................FRQLTSAEADRLMQ.F.GCRC..TD..WDQ.V...L...V.........S...D.........P...F.R.....P.........E.........AFEDCRFSGR...VYL..DTGGQ.YP..LA...ADL..P..AA.AVSLPEISIS.NSRI...GN.SyiaagSTITD..........A.....SL.......CGV..F..LE........PGVRILSSNIHGG.....Sp.......gE.S........G..A..........QPFGIGMS......................MALLNES.LP.VQLPLMPDW................T.LP-DYLE..............R..L.H..R.S..RQSpdM.RRTSAAQT.PP.TAiP........PVL.H..G.IS..I..LGRGCSVMHTRQIR.N..SYLGPGCSCTGADEVRDTTL.LN...GGA...G..P...SRVGTGCILRMAALQPGAQADTQARIERSCILETASIENSALVSDSIIGPGSAIGQGEVTASVLGPLTGLHHQ-SLLIAADWsagrGNVGYGAn..vGSNH.SSR----MADREIRIGEGMFFGLDTAVQFP.........A..NYqdA..PYSIVA.TAVV.LPPQRMAMPFSLI.......V..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------plpdflpggshrsdknlqipaganrlvpgwvldrnlfaifrnwqkyqdrftarahhidpf..........
A0A1I0Q3Z1_9BACT/4-603               ..............................................................................................................................................YRQLTPSEIEVLEN.N.VCWA..ED..WQK.V...K...V.........H...E.........N...F.K.....P.........Y.........NFHRVVFYGD...IRL..GEFNK.QV..EV...SKG..F..FK.HSGINDATLR.NVTV...GN.D.....CLIEK..........V.....GN.......YIN..N..YT........IGNDCYLSNICTL.....E.........T.T........D..D..........ATYGEGSI......................ISVLNEM.GD.GNVTLFREL................N.SQMAAFM..............V..K.Y..N.T..DKE..L.KRILEQMI.ED.EL.R........VSR.P..E.RG..F..IGNNVKIINAKDIT.N..TIIKGDCEISGAARLSECTV.MS...STD...A..P...VFIGTGVICENSIICDGCSINNSVKMQDCFVGEACQITNGFTAEASLFFANSFMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPMHWGTLERGTKTASGAYILMP.........A..TI..G..AFSVCF.GKLM.HHPDTRNLPFSYL.......I..A..........Y.......G..D..Q.......M..V........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RS.K...L..S..R..KSIINFDWLSPFTVGEIMQGIKILE.....D..LR.HA.S..G..EN........VSS.....................................................................YNFH.EYV.I........NA....S....S...LR.......KG.....LKYY...D..IALRIYMG.AVL-..K.R.......AQKE....G.Y...I.-...-....--.----G....K.P..VSSI.G..K.G.KWVDLSGLLMPESEE.QRLISDIKGGVFD.N.IQQVLDRFADIHNS...YRDYRWAWSYQM.ILDY..YH.......LD......-..-.E...L.DEAACERIRED.Y.VKARRT....WIAEIRKDAEKEYA.M--...------...------.---------.--.-..---------------------------gdveqevye.............................................................
C9MT10_9BACT/3-617                   ..............................................................................................................................................YRSLTPEEIDLLEK.N.SCWA..ED..WTH.V...K...V.........A...E........eD...F.Q.....A.........K.........FFHRVMFYGD...IRL..GKCQK.DI..EI...AKD..F..VK.HSGINDATLR.NVTV...GD.N.....CLIEK..........I.....GN.......YIN..N..YT........IGDDCIISNVSVM.....E.........T.T........E..G..........ATYGEGNL......................IAVLNEV.GD.GNVILFHDL................N.SQFAAFM..............V..K.H..F.N..DKD..L.KNAIRRLV.SE.EI.A........RTN.P..D.RG..T..IGNNVKIINTREIT.N..TVIQDDCEISGASRLSDCTI.LS...SEN...A..S...VFIGTGVICENSIISDGSSIVNSVKMQDCFVGEACQITNGFTASQSVFFANSFMANGEACAAFCGPFCASHHKSSLLIGGMF....SFYNAGS....GTNF.SNHAYKMGPMHWGILERGTKNASGSYLLMP.........A..TI..G..TFSVCF.GKLM.HHPNTTALPFSYL.......I..A..........E.......A..D..K.......M..F........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDM.RP.Q...Q..S..Q..KSIVNFDWLSPFSVGEILRGKKILE.....S..LR.QA.S..G..DN........VSA.....................................................................YNYH.EYT.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......AHKW....G.F...F.G...-....--.-----....K.P..ETEV.G..T.G.KWNDLSGLLLPESEE.MRLISDIKDGTLE.T.IQDVIERFMEINEN...YRVYQWAWTYRM.ILEY..YG.......I-......-..K.E...I.TAEDDERIKKD.Y.VEARRA....WIAEIRKDAQKEFD.MG-...------...------.---------.--.-..---------------------------dvepevfesfvnsldheidfen................................................
F3ZTN4_9BACE/4-657                   ..............................................................................................................................................YRKLLTKEIDALKQ.Q.GCQS..SN..WDI.I...E...V.........H...P.........L...F.N.....A.........K.........NVHRVTFMGN...IKL..GLLEG.TF..QL...PGG..V..TQ.QSMIKDATLH.NCEI...GD.G.....VYIDR..........V.....HN.......YIA..N..YK........IEDGTYIQNVNCI.....Y.........V.E........G..N..........SSFGNGTC......................VAVMNEQ.GG.REVIIYDYL................N.AHFAYIL..............T..F.Y..R.H..RPL..L.ISKLQDMV.KK.YS.A........YVS.S..T.MG..Y..IGKGVKIINTGSIK.N..VKVGDYTTIEGTQLLENGSI.NS...NVH...A..P...VHIGYGVVANNFIISSGVRMKDGVMLNRCFVGQACELGHTYTATDSLFFSNCQGENGEAASIFAGPFTVTHHKSTLLISGMF....SFMNAGS....GSNQ.SNHMYKLGAIHQGIIERGGKTTSNSYILWP.........A..RI..G..AFSLIM.GRHT.NNSDTSNLPFSYL.......I..E..........N.......N..D..Q.......S..I........LV.PGV.........................NL..R..S..V.G.........T...I.RDAKKFPKRDK.RT.D...P..H..P..LDFLNFNLLSPYTIQKMLKGIDVLE.....N..LK.MT.C..G..E-........SKT.....................................................................YGYQ.GCV.I........NG....R....S...LH.......RG.....IELY...H..MAIRKFLG.NSLI..S.R.......LTKC....S.C...E.S...D....EI.IRECL....K.P..DSSI.G..L.G.DWRDLAGLIAPQSEI.VKLLNDVENDRIT.N.SKQIYDQFEYLHEN...YYAIEWTWAWEK.IKSY..YG.......VN......L..N.S...I.TAQDVILIVEE.W.KKAVTG....LDKMIYEDAKKEFS.LSS...RISFGL...DGNRYV.QKVDFEKVR.GL.F..EDNDFVKTVLKHIEDKTRLGDELIHRL......................................................................
R6XAM9_9BACT/1-628                   .............................................................................................................................................m-RTLTPSEIKRLEE.N.RCHA..ED..WQK.I...T...V.........G...E.........N...F.S.....A.........D.........RLYDVQFIGE...CSI..GSNSD.TV..TT...DMG..Y..EL.PTGIRHARII.NSTI...GD.N.....TLVEN..........V.....SA.......FIC..N..AD........IGDNCIVNNVSVI.....Q.........T.T........E..G..........TTFGQGNT......................ISVMNEA.GE.GNVVLYSGL................T.SQIAALTvlppclgeqyddadA..T.I..E.A..RRQ..A.KDAVRRMV.ME.EV.M........SRM.P..K.RT..L..IEDNVRITDTIEIT.N..SWITQWTEVRGAQRISETTL.WS...RRD...N..S...VFVGAGAIIDGCIVTLGSSVSNNAIAKNCFIGENSTLTDGFSATDSLFFANSYMANGEACAAFCGPFSVSHHKSTLLIGGMY....SFYNAGS....GTNF.SNHAYKMGPIHYGIMERGAKTASGAHILWP.........A..HI..G..AFTMCM.GKIA.THPDTSSLPFSYV.......I..G..........D.......G..T..D.......T..Y........IV.PAR.........................NI..A..T..V.G.........T...Y.RDTAKWPRRDM.RP.Q...G..S..R..RSMVDTECLNPSTMTKVVEAKVTLE.....A..LR.DQ.K..G..AR........EVY.....................................................................QTAD.GSL.I........KR....S....A...LE.......KG.....ISLY...T..LAIKLYLN.RHLK..S.A.......DEEA....D.Y...N.TsfdD....TT.ASQTF....G.R..PLSR.G..A.S.LFADLGGMQISNASV.MRIVDAITSGNID.T.TEDLMAEICRYYDGgslDTDIDRKLALRI.ADAI..YG.......WN......S..-.-...M.DADDRRRLIDS.C.HEARRE....WYDMVRRDAEREYE.L--...------...------.---------.--.-..---------------------------gdvddatl..............................................................
A0A1T5DGJ6_9SPHI/41-725              ..............................................................................................................................................YRPLSETEIDRLMR.N.GNYS..PN..WAD.V...W...V.........T...D.........S...F.L.....P.........E.........QIEHSKFYGR...VRI..GDMEA.IY..LE...YRD..L..KL.PAGIYNSTIV.SCDI...GG.R.....TAVHN..........V.....-R.......YLA..H..FV........IGDEVVLFNINEM.....E.........T.S........S..N..........AKFGNGILrdgda...........esslieLELCNEN.GG.RGVLPFDGM................Q.ASDVYLW..............T..R.H..R.H..DRQ..L.QDRFSAMT.FQ.RF.D........TFR.G..Y.YS..V..VGHRTVIKNSHTIK.D..VKIGTDAYIKGVNKLKNVTV.NS...ITG...A..Y...TQIGEGCELVNGIIGHGCRIFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..vGSNH.NSR----GADGEIIAARG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDVR-LPFAMV......sH..D.........vA.......N..D..R.......L..V........IL.PAYwf.....................lyNM..Y..A..L.M.........-...-.RNNTKFLNRDR.RT.L...K..N..Q..--HFEYDVLAPDTINEAFAA---LR.....E..IE.TA.V..G..KA........FYPdvqntdwatlgrkii......................................ddatinladheillegVENS.KRK.V........VL....I....K...VR.......EG.....YVAY...R..RMVEYYAA.TQLK..H.Y.......FDGH....T.F...E.Q...F....K-.-AEYL....D.P..TVQF.G..R.M.PFENMGGQLVRKPDM.DALLDDIRTGKIA.D.WDKVHQRYHLLSNE...YPTHKLEHAIAS.LLEL..NG.......ME......K..A.E...L.TRDFIRQLIDE.S.VKTKEW....ICREIYKTRAKDYS.NPF...R-----...-QMVYE.NLDEMKAVV.GS.L..ENNAFILQQQEEYERYRAS--------aagiq.................................................................
A0A1Y4A6S9_9BACE/4-658               ..............................................................................................................................................YRALTSEEIKRLEA.Q.ACTA..TD..WNE.V...Q...V.........A...E.........D...F.T.....P.........E.........YIHHTRFSGK...VRL..GVFEG.EF..RL...AGG..V..RK.HAGLSYVTLH.NVTV...GD.N.....CFIEN..........V.....KN.......YIA..N..YE........IGESVFIENVDII.....L.........T.D........K..K..........SRFGNGVE......................VSVLNET.GG.REVMIHDRL................S.AHQAYIM..............A..L.Y..R.H..RPL..L.IERMKALI.EA.YA.E........AQA.S..E.TG..T..IGNRVSIVNSGYIK.N..VRIGDCCEIEGAGRLKNGTI.NS...NAS...D..P...VHIGYGVVCDDFIISSGAHIEDGTMITRCFVGQACRMGHNYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGAMERGAKTTSDSYILWP.........A..RI..G..AFSLVM.GRHV.NHPDTSDLPFSYL.......I..E..........D.......K..N..T.......T..Y........LA.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDL.RK.D...P..L..R..LDQINYNLLSPYTIQKMMKGREILK.....E..LA.RV.S..G..ET........SET.....................................................................YAYQ.SAK.I........KN....S....A...LN.......KG.....IKFY...E..TAIHKFLG.NSVI..K.R.......LEKI....Q.F...R.S...D....EE.IRKRL....L.P..DTSI.G..S.G.EWVDISGLIAPKSEI.ERLMSDIETGALS.T.VDQIHDRFADMHAH...YYTYEWTWAYEK.MLEF..YQ.......LD......A..E.R...I.TASDICTIVRQ.W.QDSVVG....LDRLVYEDAKKEFS.LTS...MTGFGA...DGSKAE.QKLDFEQVR.GV.F..ESNPFVTAVLEHIKVKTELGNELLDRL......................................................................
U7DAX2_9BACT/3-657                   ..............................................................................................................................................YRELTSGEIEALEK.N.GCSA..ED..WSC.V...H...V.........Q...P.........P...F.D.....Q.........S.........RVRNTRFSGE...VRL..GCFRR.SF..TN...AAG..I..KT.PSGVYDVRIH.NCEI...GS.D.....TLIHR..........V.....HN.......YIA..N..YT........IGNNVLIENVDAL.....Y.........V.K........G..E..........STFGNGVS......................VRVLNEK.GG.RAVPMFDSL................S.AQFAYFY..............V..F.Y..R.H..RPR..M.MEKLRCFA.QH.CI.D........KKR.G..T.RG..W..VGDYTRIVSSRNIV.N..VAIGENARITGAERLRNGSI.NS...TME...G..A...VRIGTGVIADNFIINENAVLLDASIVSNCFIGEGAELAKQYSAEHSLFFANFIGHHGEAFAVFAAPFTATHHRSTLLISAYL....SFMNAGS....GSNQ.SNHAYKLGPIHQGVMGRGSKTASDSYILWP.........A..RV..G..DFTLLM.GRHT.SHCDTKDLPYSYL.......L..E..........G.......K..N..S......lS..I........LV.PGV.........................NL..K..S..V.G.........T...I.RDADKWPTRDG.RT.G...H..C..R..-DLINFDLLTPNSVDAIIRGRDILL.....R..LH.EE.K..G..FN........REF.....................................................................CQYK.GVD.I........PL....Y....S...LE.......KG.....LVYY...S..MGIKKYCG.NVFC..N.R.......LQWR....T.F...S.T...V....EE.LRTVL....S.P..SSET.G..M.G.EWVDVAGCIVPKVCV.EALLEEVERGEVD.T.PDALLERMAVFHDS...YHEYAWNWVCAR.VKTF..CG.......QY......P..H.E...M.PVEKLQKYLAE.W.LEITMR....LDDYFIEDASKEFD.SRS...MVGFGI...DGDGEC.CNSDFNAVR.GC.F..ETNSFVSRINAHKQSKKQLYDFIDAK-l.....................................................................
A0A4U7NFC0_9SPIR/12-659              ..............................................................................................................................................FRKLKKNEIEFLKS.Q.GCIS..QS..WDK.I...L...I.........K...-.........N...V.D.....L.........N.........RIKDVSFHGK...IKI..KELNG.NV..SY...HNK..V..KV.EASITRATLI.DVMI...NG.N.....VYINN..........V.....GR.......LIA..N..YE........IEDGVIIENAGAI.....Y.........M.E........G..E..........SSFGNGVE......................TSPIMEG.NG.RSVKIFNRL................N.SHIAYIV..............A..M.Y..R.H..NFV..M.REKINKII.EN.YS.Y........SKI.S..K.FG..L..IKKHAKIINARLIK.N..AHIDPYTTIENTDEINNTTI.IS...AKE...S..P...SYIGTSVILKDCIVLKGAHIVDGTVIKKAFIGEGVKLGRQFSCEDSLLFANCEGEHGEMFSIFAGPYTVTHHKATLLIASHF....SFFNAGS....GTNQ.SNHMYKLGPYHHGFMERGCKTGSNSYILWP.........S..RI..G..AFSTVI.GAHY.DNVDSSDFPFSYI.......T..E..........H.......G.yH..Q.......T..R........LI.PAL.........................NL..F..G..V.G.........L...T.RDENKWIERDR.RT.G...D..K..K..-DLIIFEVFSPYTVSKMINAEKILK.....D..IK.ND.I..K..DG.......kDDF.....................................................................VMYK.NMI.I........KI....S....S...LD.......KY.....SQRY...S..IAIDLYLC.GKLL..D.F.......IKNC....-.-...K.N...I....ND.IIENL....K.C..--EK.I..Y.N.EWVDAGGLICAKERL.DNIIKDIENDKIK.D.IEDILKAFENLYNN...YYADEKSWVIDI.IKKR..YS.......I-......-..E.N...V.NKEIIIKILNE.Y.ISLLKT....SYDILYRDAKKEYD.ISK...MVSCGI...DDR-NV.MEEDFKAIR.GT.V..EDNAFVIKYKKDMDEKIKDINKIIE--ll....................................................................
V9EZ89_PHYPR/38-554                  .............................................................................................................................................f-YSLSDGEIRALEA.N.GNCA..ES..WNN.V...YktyA.........H...T.........P...L.Q.....T.........S.........RIRQCSFHGK...VVL..GRFST.FN..HN...VDG..I..PF.PCGVYNSALS.NVVV...LD.D.....SLVRD..........T.....-L.......VLR..D..VL........VDTQASVIKCGSV.....T.........GpE........E..D..........AVSANGNL......................LHVGVET.GG.RNLRVVADL................P.FALGAAV..............A..T.R..R.G..DHD..F.LKTYETFV.DN.YV.A........ALK.A..P.MA..I..VAKNARVRGCSRVQ.G..TFVGGYAVVEDSD-VVNSTL.LS...TQD...E..P...SVIRAKSIVRDSIVQWNSTVEALSVVEGSFLCDTSHVERHGVVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......G..H..S.......I.pS........LS.PAInei..................spgwVL..A..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEAAILRPEIIQYMKNARAELI.....A..AE.GK.A..K..INl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......AG.....ITAY...T..FFIKLYAL.DELL..Q.L.......VESG....H.V...S.A...D....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtvgsvdssh............................................................
A0A255T481_9BACT/1-590               .............................................................................................................................................m-RSLTVEEINVLKC.N.GCFA..ED..WAD.I...T...V.........D...E.........D...F.S.....P.........E.........YIHNVAFYGE...VTL..GLFEK.AV..TL...EQG..F..SR.HAGIYNATLR.NTTV...GD.N.....CLIEN..........V.....GN.......YIN..N..YE........ISDECVISNVGVI.....T.........A.D........D..E..........TTFGQGNK......................VAVLNEA.GD.ANVIIYDGL................T.SQMAALM..............M..M.A..A.D..NRP..L.WERLHTMV.ND.YV.S........NRK.S..S.KG..L..IGYRAKITNTREIN.N..TWIDDDCEINGASCISETTL.KG...MTE...A..S...VFIGHDVICKNSVVMAGASVLDGAKIDNCFVGEACHVGRGFSAESSIFFANSYMDNGEACAAFCGPFSVSHHKASLLIGVET....SFYNAGS....ATNF.SNHAYKMGPIHYGSLQRGSKTASGAHILMP.........A..QI..G..AFSMCM.GKIQ.SHPHSTDFPFSYV.......I..A..........D.......G..A..T.......T..W........LV.PGC.........................NL..A..T..V.G.........T...Y.RDITKWPRRDK.RP.A...N..G..R..SSVVNSKWLNPFVIQHVVEGKKSLT.....N..AI.DN.-..-..TD........GDE.....................................................................ILLD.GCT.I........KY....S....S...AQ.......RG.....IGYY...D..MAIRMFLG.ETMD..E.T.......----....C.F...-.-...-....--.---H-....L.P..SSTT.G..T.G.EWLDLSGLLAPKSEI.EQLTDDILEGVTT.D.IKSVDQRLHHIHNN...YSEYVWNYAYSL.ALTY..YN.......M-......-..D.N...I.TEDDIASIVDN.G.NVAHET....WIKRIAADAEKEFA.M--...------...------.---------.--.-..---------------------------gdvae.................................................................
U2LGB9_9BACT/4-616                   ..............................................................................................................................................YRLLTYEEIGILED.N.GCTA..ED..WTA.I...Q...V.........A...D.........D...F.A.....P.........T.........HIRHVAFYGE...VTL..GVFEK.NV..EV...SPD..F..RK.HSGIRNATLR.NVTV...GD.N.....CLIEN..........I.....GN.......YIN..N..YH........IGEECYLSNVNTI.....E.........T.T........D..G..........ATFGQGNM......................ISVLNEV.GE.GNIILFDGL................T.SQIAALM..............V..K.H..I.G..DKD..L.INAIRVLV.KA.EI.S........AKV.P..E.QG..T..IGDNVKIINTGEIT.N..THISNDCEINGACRLSDCSI.KS...ISQ...A..N...VYIGSGVICENSIIFDGSSILNSAKIENCFVGEACQITNGFTAESSVFFANSYMANGEACAAFCGPFTSSHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHYGIMERGSKTASGAYLLMP.........A..HI..G..TFSVCF.GKLM.YHPDTRALPFSYL.......I..A..........Y.......S..D..T.......M..Y........LV.PGR.........................NL..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.R...C..G..Q..KSIVNFDWLSPFSVGEILRGKEILE.....N..LR.AA.S..G..DN........VSA.....................................................................YNYH.EYV.I........KT....S....S...LR.......KG.....IKYY...D..IALRIFMG.AVLK..R.-.......---H....R.-...-.-...-....--.---LE....Q.P..QTDC.G..T.G.PWTDLSGLLLPLSEE.YRLIEDIKNGTLA.T.IDAVTDRFNRIHEN...YSEYRWAWAYRM.ILDY..YH.......L-......-..N.E...L.TPADVERIRTD.Y.VTARRV....WIAEIRKDAEKEFS.LG-...------...------.---------.--.-..---------------------------dvdekvlnsfikqldkevdfenqrl.............................................
R5CS17_9BACT/4-594                   ..............................................................................................................................................YRLLTNEEINILEE.N.GCTA..ED..WTN.I...N...V.........A...D.........D...F.Q.....P.........T.........YIKNVNFYGE...IFM..GVFEK.NI..EV...SNG..F..VR.HSGIRNATLR.NVSI...GD.N.....CLIEN..........I.....GN.......YIN..N..YA........IGEECCICNVCTM.....E.........T.T........A..E..........ATYGEGNT......................ISVLNEA.GN.GNVILFSGL................T.SNLAALM..............I..R.N..A.A..DKE..F.TAAIRGIV.RD.DI.E........RRA.R..E.KS..T..VGNNVKIVNTAEIT.N..THISDNCEINGASRISDCTL.AS...GLE...D..N...VFIGSGVICENSIVTDGSAVLNGANITNCFVGEACQITNGFTAESSLFFANCYMSNGEACAAFCGPFSASHHKSTLLIGCML....SFYNAGS....ATNF.SNHAYKMGPIHYGCLERGTKTASGSHLLLP.........A..NI..G..AFSVCL.GKIT.NHPDTRSLPFSYI.......I..S..........D.......G..R..E.......T..F........VV.PGI.........................NI..T..T..V.G.........L...Y.RDIRKWPRRDV.RI.Q...S..S..R..KSLINHDWLSPLTINEIMAGKKTLE.....Q..MR.ES.Q..G..ED........TAF.....................................................................YTCG.GCK.I........SR....N....S...LE.......RG.....IRLY...D..MAIKLFAG.DVA-..-.-.......----....-.-...-.A...G....YD.LTA--....-.E..GRDC.G..T.G.EWGDLAGMLLPEQEE.RNIVNAISNGYLR.S.TADIDMFMKNVNER...YGEYLITFTRNI.IASQ..L-.......-G......T..D.D...L.TESGIEQIIQQ.G.RAAKEA....WISEIRKDAEKEYS.M--...------...------.---------.--.-..---------------------------gdve..................................................................
A0A4Y9J437_9BACT/3-650               ..............................................................................................................................................YRDITPGEIATLRG.N.GCRA..AD..WNS.I...K...V.........K...D.........G...F.N.....P.........D.........CYARVDFSGE...IFL..GLTDE.QV..IG...TAG..F..IA.QSGIYDATLQ.NCTV...GD.N.....VHISH..........V.....AE.......CIM..N..YH........IDDHAYISNVGSV.....I.........C.T........G..S..........RSFGNGTE......................VNVLDET.GG.RSVPIYDKL................T.AQIAYII..............A..M.Y..R.H..NEA..L.VGKLKKMI.GD.YA.S........EKK.Q..S.SG..I..IGKYAKLTNIGSVT.D..VNFEKESYANGSSLLWDGTV.GQ...K--...-..-...AFVGPNVVAEHFILASEARLDKSAIVKNTFIGQASTVSNGFVAHDSLIFSNCVLECGEAAAVFAGPHTVSMHKSTLLIGGMF....SFFNAGS....GTNQ.SNHHYKTGPIHCGIMARGCKTGSNAYVMWP.........A..RF..G..YFSAVL.GSHY.DHPDTSVLPYSYV.......I..G..........A.......D..K..K.......S..I........VI.PAA.........................NL..S..T..S.G.........T...I.RDIMKWASRDC.RS.E...E.lE..R..LDIVNYNALNPLTTSLMYHAISFLN.....D..YE.RN.P..-..--........-ET.....................................................................AGSR.NIS.I........KS....S....A...IA.......RG.....RQMY...A..LGVDYFMG.WAVV..R.K.......VLSL....K.P...G.N...T....QE.LLQQL....K.P..GGKT.D..V.R.EWIDAAGMIVPKSEI.ETICAGITDGKLD.T.LESVASALKEIDDR...YSDMAWDFVVNN.FDKC..YS.......QS......I..E.D...M.TPRDIEAIIQR.W.TETVAA....LDRMRKTDALKDFG.AKV...MVGFGI...DGDKEC.ARADFDAVR.GE.P..EDNPQIRSIHNHYVDAIQ---------sglaavrhl.............................................................
A0A4Q0J584_9BACT/160-555             ............................................................................................................................ainhgatlsgaslikssi--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...-IG...A..H...ATIGHNAIIENSIIESGATVDKGTQITNCFTGQSVTLS-NFTAQHSLFFANTHLCNGEAASVFAGPFTVSEHKSTLLIGGSF....MMFNAGS....GTNQ.SNHLYKLGPIHHGSMGRGCKCASDSYIMWP.........A..RI..G..DFTMVS.GRHY.THPDTRIFPFSYL......iA..E..........A.......D..G..R.......S..R........LL.PGE.........................NL..C..K..C.G.........T...A.RDIAKWPARDR.RH.A...G..N..R..LDIISHDAPNAAITAN---ITKALS.....F..IE.AH.S..N..AT........SDI.....................................................................-ETD.GVL.I........SP....H....A...LR.......KA.....HTYY...T..NAIMRYAG.SRIL..A.A.......AESG....A.L...P.-...-....--.-----....-.-..-GGR.H..C.E.EWTDLAGYVIPSGTL.RAITGRLRQGDIA.D.TAALAAAIAGTQQA...AAEEETEYALSL.AGKW..ME.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------rfgilpgetetsvllrgylqaeeeylalvlgdaareakmagrpa..........................
I0X6P2_9SPIO/23-725                  .............................................................................................................................................k-RHLTKDEISVLKA.N.QNYNedES..WNN.F...Y...V.........D...D.........SeggF.D.....A.........S.........LIVANYFSGY...IVL..GKLRP.VM..LK...YHD..L..SL.KAGIRNSKLK.DIIT...GD.D.....FVIYK..........V.....-D.......YFE..N..YR........IGNRVVLYDIKEV.....C.........C.T........N..H..........SKFGVGLAakgas...........ddsrmwIGVANEN.NG.RQILPFESM................I.AADAYLW..............S..H.Y..R.D..DAE..L.LKRFVEMV.DS.ES.P........APV.D..T.QG..F..IDDDTVIKQTNIIK.D..AKIGKCVYIKGGLKIKNITI.LS...SPE...E..P...SQIGEGVILVNGIMGYGTHVFYNAIAVRFVLGRNCNVKYGARLLNSVLGDNSTISCCEVLNNLIFPYHEQHHNSSFLIATTVm.gqSNIAAGAt..iGSNH.NSR----SPDGEIFAKRGFWPGLCSDFKHN.........S..RF..A..SFVLVSkGSYQ.YELDIQ-YPFSLVc....pgQ..N..........G.......D..P..S.......I..H........II.PAWwf.....................iyDM..F..A..I.T.........-...-.RNKNKFLSRDK.RV.I...K..V..Q..--NIETDPCAPDTMEEILYALDRII.....N..LT.AD.Y..L..EK........QGDsgiltikgenmveeryqya..............................kdylhknpdavftlndaicqKKYG.A--.-........--....T....I...CKp.....vKG.....YKVY...R..QIVKYFAT.RTLL..E.Y.......GKSL...sS.P...S.L...T....KD.IIERI....R.K..L--P.L..Y.T.EWENVGGQIIPHKKV.VELFDGIKNGSIN.N.WESVHQFYNMCQCS...YEQYKVRYSLYL.LEKL..YS.......RG......I..E.E...F.DSEIFNNIVDD.V.SICAQI....IYDSSVKSRKKDYT.DYY...R-----...--NMVYrSKKEMNAVI.GP.L..EDNSFLKGLKEDTAKFISEVNNLFV--kl....................................................................
A0A4Y8WMB4_9PORP/1-657               .............................................................................................................................................m-RALTKDEVVVLEH.N.NCHS..DD..WTL.I...T...V.........A...E.........G...F.D.....P.........M.........CCRDVVFIGQ...CTI..GDLSG.SR..TN...EYG..V..PI.PNGIRSARIH.ECTI...GD.G.....VCIDH..........I.....HD.......CLS..R..YD........IGDHVTITNVDVV.....A.........M.K........G..E..........SSFGVGVR......................ASVLNET.GG.IEVPISRNL................N.AQTAYML..............T..L.M..SfQ..DRA..L.RVRLIELI.DA.ES.E........AVR.S..T.RG..I..IEEHVEIKNTGSIV.N..AFVGAYATIEGATKLENCSL.CS...SVE...H..P...IRIGYNVQGRDFIASLGAMIGGSSIVERCFVGQSCHIDHLFSAHDSLIFANCNLENGEACAIFAGPFTVSSHKSSLLIAGHF....SFLNAGS....GSNQ.SNHLYKLGPIHQGVVERGSKTSSDSYVLWP.........S..RI..G..AFTLVM.GRHV.HNVDTTDFPFSYL.......I..E..........S.......E..N..K.......S..F........LV.PGR.........................SL..L..S..V.G.........T...M.RDAKKWPARDK.RP.K...S..S..R..PDCINYNLLSPFTIGKMECAYNKLK.....S..LQ.DF.L..G..LH........DHV.....................................................................YAFN.NIF.I........KS....S....S...LK.......RG.....LETY...R..WGIEKFVG.NSLI..Q.R.......IQDKfgdkA.I...S.S...Q....EE.LLTAL....R.P..DHTE.G..T.G.EWIDMSGMIAPIQGI.HEIIRKIKSGALA.T.LPEVNSAVRDLHSR...YYDLEWDWSYEL.LCRW..FG.......E-......-..-.P...L.SASKVVEIIEK.W.LRAVVA....IDQALLNDAHKEYN.IIG...RVNLGI...QPDNEM.NRSYGEQIE.EE.F..SHNSIVLSVQEHIERKRALASAVLAQL......................................................................
A0A1B1Y4S0_9FLAO/4-658               ..............................................................................................................................................YRGITKEEIKQLIQ.Q.GCQS..DD..WDK.L...Y...I.........K...P.........T...T.D.....L.........L.........KIESVTFSGE...NYI..GHIEG.TR..TF...YGG..I..IK.QNSIKNVHLH.NCKI...GD.N.....AFINN..........V.....KS.......YIA..N..YN........IGDNVMIDNVDII.....A.........V.D........G..E..........CSFGNGVT......................VDVINEG.GG.RDILIFNQL................S.AQIAYLL..............A..L.Y..R.H..KTV..L.IDELKRMI.EE.YT.L........SVT.S..S.VG..H..IGDDVKILNANTIK.G..VCIGDGAYINSASKLINGSI.NS...TKE...S..Q...VYIGTDVMATNFIISSDSKVDNSSILTNCFIGQGCLIDKHYSIEHSIFFANSQGFNGEACSIFAGPYTVTHHKSTLLIAGLF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIMERGAKTTSDSYVLWP.........S..KI..G..PFTLVM.GRHY.QHVDSSDFPFSYL.......I..E..........G.......N..N..K.......S..Y........LI.PGA.........................NL..K..S..V.G.........T...V.RDAQKWPKRDN.RS.K...N..N..R..LDIINFNLLSPYTIHKVSKGLRHLY.....D..IL.DL.S..G..DK........LDE.....................................................................YNYK.DMV.V........KK....S....S...LH.......NG.....IKMY...N..IVINKFLG.NSII..S.R.......VENK....N.I...N.T...V....QE.LREVL....K.P..TSTI.G..Q.G.KWIDVCGLLCPISAL.NLFVDKVEKLEVK.T.VEDAINELNEINNH...YYEYEWNWAVEL.IESF..YK.......IK......I..E.E...I.TTENFINIVSN.W.KKAVVD....LDKMLYKDASKEFD.LHS...YVGFGA...DGEEKE.KLADFKNVR.GA.F..ESNSTVLEILSHIDRKEKLGDKIIAQI......................................................................
A0A4Q8RQ18_9BACT/3-654               .............................................................................................................................................q-RNLTPQEIEILQK.Q.GCRA..TD..WQQ.I...N...V.........P...Q.........Q...F.N.....P.........S.........FLYHVIFEGN...IRL..EDTYH.--..HN...ANH..L..HA.-PCIVNSRIR.NCRI...GK.N.....TRITN..........I.....-N.......LLA..N..YR........IGNNTVLENIACI.....E.........T.T........G..P..........TTFGNGTR......................INILNET.GG.RSIPIFNEL................S.AQLAWLM..............V..S.C..R.H..HQQ..F.ISATNEII.SN.YT.K........TCK.S..E.IG..K..IGNHVTIRHGGVIK.N..VTIGDYAILDGITKLEEGTI.CS...DKE...D..P...SIIGTNVIARDFIILEGSAITDGVILDKCFVGQGVQLGKQFSAEHSVFFANSQCFHGEAVSAFVGPYTVSHHKSTLLIGGLY....SFFNDGS....GTNQ.SNHMYKLGPMHQGILERGSKTGSFSYLLWP.........S..KI..G..PFSVVM.GKHN.NNIDTGDFPFSYI.......T..E..........E.......N..G..K.......S..I........LT.PAM.........................NL..F..T..V.G.........T...R.RDTQKWPDRDR.RK.A...A..T..T..LDFIRHDLFSPFIMQKVITATEWLD.....N..LY.QS.T..D..KK........QEF.....................................................................VKIN.STY.I........YR....L....M...LK.......SS.....KKYY...E..LGLKIHIG.DMLL..S.F.......LEEL....P.L...SfT...H....QH.IKEKT....D.S..LPNY.G..A.K.EWIDVAGAFYPKESI.DVLLDNIADCNIR.D.IPSIQEYLRKHHEH...YPIYKAAWFRHI.LNER..YN.......IE......L..S.T...I.PAEQIIQLIEE.W.KTSAIT....LNNMVLKDAQKEFY.PTS...RIGYGY...ASHPQI.RDHDFEAAH.GL.Y..NENYFVKTIKSDIRHIEEKARTTT---eri...................................................................
R6CSX3_9BACE/4-658                   ..............................................................................................................................................YRKLTEDEVLQLQS.Q.SCLA..DD..WAN.V...M...V.........A...E.........G...F.N.....C.........E.........YVHYTRFSGE...VKL..GVFDS.EF..TL...PGG..M..KK.HSGLRNATLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGCDTFIENVDII.....L.........V.D........E..L..........TTFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ISRMKEIA.DY.YS.K........KHA.L..A.VG..T..IGEHVMILNTGSIK.N..VRIGDYTKICGTCRLTNGSI.NS...NVT...A..P...VYIGDGVICDDFIISSGSKVDDGTMLSRCFVGQSCKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSDLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDN.RK.D...P..N..R..LDFINYNLLSPYTIQKMFKGRSILK.....E..LR.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAINKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..V.G.EWVDVSGLIAPKSEI.DRLIDGIENGTIN.R.LKSINACFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......IN......P..E.E...I.TAQDVVRIVKS.W.QEAVVG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSHDE.MRQDFEQVR.GD.F..ESNTFVTAVLKHINDKTALGNELIQRI......................................................................
A0A1K1MW70_9BACT/4-603               ..............................................................................................................................................YRQLRDEEIALLEQ.N.SCWA..ED..WSR.V...H...V.........A...E.........D...F.S.....P.........Y.........GFHRVLFYGD...IQL..GVFEK.QV..EV...TKG..F..TK.HSGINDATLR.NVTV...GD.N.....CLIEK..........V.....GN.......FIN..N..YT........IGDDCYICNISTM.....E.........T.T........E..G..........ASFGEGHL......................ISVLNEM.GD.GNVVLFHDL................N.SQLAAFM..............V..K.Y..F.K..DKQ..L.KDCITRLI.NE.EI.R........FTQ.P..E.RG..T..IGNGVKIINSKEIT.N..TVVKDDCEINGAARLSDCTI.LS...SKD...D..S...VYIGTGVICENSIISNGCSITNSVKMQDCFVGEACQITNGFTAEASVFFANSYMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPLHYGTLERGSKTASGAYVLMP.........A..KI..G..AFSVCF.GKLM.NHPDMRCLPFAYL.......L..A..........Y.......G..E..T.......M..Y........IV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RA.A...S..S..R..KSIINFDWLSPFTVGEIVEGKKILE.....N..LR.QA.G..G..KN........VSS.....................................................................YNFQ.EYI.I........NA....S....S...LT.......KG.....IKYY...D..IALRIYMG.AVLK..R.A.......VKGG....F.L...G.-...-....--.-----....K.P..TTDI.G..L.G.QWNDLSGLLLPASEE.RRLLNDIKNGTIE.S.IQEVTARFEEINEH...YREYQWTWTYQM.ILDY..YG.......VD......-..-.E...L.TDSAIERIRED.Y.VQARRA....WIAEIRKDADKEFA.M--...------...------.---------.--.-..---------------------------gdveqevyd.............................................................
A0A3E1NMY6_9BACT/44-735              ..............................................................................................................................................YRRLNAYEIEMLVR.N.RNSS..DD..WNN.I...L...V.........S...E.........A...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.YC..LE...FSD..L..KV.PVGLYNSTII.SCDL...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........IGSEVIIVNVNEL.....T.........T.T........D..H..........AKFGNGILkegep...........esiriwMEICNEN.GN.RSVIPFNGM................L.PGDAHLW..............S..K.Y..R.D..DDE..L.LSKFKTFT.EQ.QF.K........PER.G..Y.YG..K..IGDRTVIKNSAIIK.D..CYIGSDAYIKGANKLKNLTI.NS...GPE...G..K...TQIGEGCEIVNGIIGPGCRLFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNIAAGAt..iGSNH.NSR----GPDGEIIAGRG---------FWPglcvslkhnS..MF..A..SYTILAkGDYP.AELHIP-IPFSLV.......S..Nd........vT.......N..N..K.......L..V........IM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYTDRDK.RV.A...R..T..Q..--LLEYDYLAPDTVNEMFTSLRLLE.....L..FT.GR.A..W..HQ........HMQvpateeqaiqtgrkll.....................................tqrdpivkdlhieatgFENS.KRP.I........TV....L....K...VQ.......QA.....YTLF...E..ELISFYGT.NQLL..E.F.......IAEH....D.V...P.S...L....ES.LQQQL....T.G..AP--.V..R.G.AWLNIGGQLMPDETV.AMLKTRIKEGKIK.S.WDSVHAFYEEQGAK...YMQLKRRHALAS.LADIkqLK.......LP......I..K.K...I.DAPTFARLLDT.A.IATKEW....MTEGIYNARAKDYN.NPF...R-----...-KMVFD.TQEEMDKVM.GK.L..EDNSFILQQKKELRL------------fkekiaalkl............................................................
A0A3B7MM75_9BACT/42-735              ..............................................................................................................................................YRQLTAYEIEVLVR.N.RNTS..DN..WNH.I...L...V.........S...N.........A...F.N.....P.........E.........LVQNCKFFGL...VRI..GKLEP.YY..LE...FHN..L..RR.PVGLYNSTII.SCDF...GD.N.....VVVDN..........V.....-N.......FIS..H..YI........TGSEVILVNVNEI.....D.........A.T........D..H..........AKFGNGILkegee...........eniriwMEVCNEN.GG.RRIIPFDGM................L.PGDAWLW..............T..Q.F..R.D..DTL..L.QDKLKLFT.QQ.RF.D........TRR.G..Y.YG..S..IGDRTVIKNCRIVK.D..VNVGSDAYIKGANKIKNVTI.NS...SAE...A..P...TQVGEGCELVNGIIGYGCRLFYGVKAVRFFLASHSQLKYGARLINSYLGDNSTISCCEVLNSLIYPAHEQHHNNSFLCAALVq.gqSNMAAGAt..iGSNH.NSR----SPDGELIAGRG---------FWPglcvsikhnS..RF..A..TFTILAkGDFP.VELDIP-LPFSLV.......S..Nd........vT.......N..N..R.......L..V........VM.PAYwf.....................lyNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RI.D...K..T..Q..--HIEFNFLAPDSVNEIIQALSLLQ.....L..YT.GK.A..W..LT........REGnhkkltkeditaigkk.....................................lldnndpvvreleilaEGFE.NST.R........PV....V....L...IKv.....pAA.....YRIF...R..ELVAYYAV.QQLL..D.H.......THRN....N.I...R.S...L....DQ.LTDSL....P.A..KP--.Q..V.A.PWINAGGQLIERAAL.DKLIKQIHTGRVK.S.WKDIHAFYEQQSQS...YPQEKLSHALAA.LKEV..HG.......IN......L..K.K...A.TGPILQQLLQQ.S.ISTKEW....MVKGIYDSRAKDYN.NPF...R-----...-KMVYE.TTAAMNKVV.GK.L..SDNTFIKQEQAGLEAYKKTIQQL----skkw..................................................................
Q73PF3_TREDE/40-717                  ..............................................................................................................................................YRQLNSDEIERLIK.N.GNSS..TD..WSM.I...L...V.........E...D.........P...F.D.....T.........D.........LITNSLFAGL...VRI..ASTQN.FY..LK...YHD..F..TV.PVGITNSKII.SCDI...GE.N.....CAIHY..........C.....-A.......YLS..H..YI........IGDRVILSRIDEM.....C.........T.T........N..H..........SKFGEGLVkdged...........ekvrvtIDTVNEA.GG.REVYPFYDM................I.TADAFLW..............A..R.Y..R.D..DDK..L.IKKCEEIT.QN.SK.D........SSR.G..Y.YG..E..VGSDSAIKSCRIIK.D..VNFGSSVYVKGANKLKNLTI.KS...TAE...E..P...SQIGEGVELVNGIIGFGSRVFYGVKAVRFVLGNNCELKYGTRLIHSIVGDNSTISCCEVLNALIFPYHEQHHNNSFLVAAMIq.gqSNMAAGAt..vGSNH.NTR----GNDGEIIAGRGFWPGLSSTLKHN.........C..RF..A..SFVILAkANYP.AELDIP-FPFSLV.......L..Nd........pH.......E..D..R.......L..E........IM.PAYyw.....................myNM..Y..A..L.E.........-...-.RNNKKFLKRDK.RI.T...K..T..Q..--HIETAYLAPDTAAEILNARTLLE.....K.wIC.AA.W..I..EA........GNKalsidtilkdkk.............................................deaknlfvkgenIERS.KRR.V........KI....I....K...AV.......ES.....YAAY...Q..DMLIWYGV.TTLA..E.Y.......FDKG....L.D...K.I...G....MS.IEEF-....K.-..LSSD.F..D.F.NWVNMGGQLIPEKKL.NSIKEDIKAGKLN.T.WQDIHKSYDYAHDS...YCHDKAENAYAV.LCEL..MK.......--......V..E.K...I.DAALWNKLLDK.A.AAIRKY....IEEQIFYTKNKDYN.NHF...R-----...DITY-R.NSEERKAVL.GS.V..EDNALIIEAKKDTEY------------ylklfer...............................................................
W2CIU8_9BACT/3-614                   ..............................................................................................................................................YRKLTQCEIDALVA.S.GCEA..ED..WQR.V...E...V.........A...D........vG...F.D.....P.........T.........RLRHVRFSGQ...ISL..GSA--.--..--...---..-..--.-VDLRDATIC.DCMV...GD.G.....VRIDG..........V.....RS.......ALT..G..YE........IGRGARLIDIGTM.....T.........Y.R........A..G..........TTAGNGVR......................VAAVNEN.GG.RAVPLFDGL................T.AQTAHLM..............V..F.H..R.H..RTE..T.LRRTFDRI.DA.YA.A........TIAaA..P.RG..Y..VGEGATVEGCGRIV.D..VRIGDRATVCGATLLQNGTI.LS...QPE...A..P...TEVGVGVMARDFILAPGARVVDGAFIERCFVGEACLVEQGFTAIDCLLFANGMFAKGEAVSVFAAPHTVSHHKSSLSIACSL....SFANIGS....GSNM.SNHAYKLGAVHQSVAERGTKFGSNSYVQAP.........A..HF..G..AYSMIT.GEHR.NHPDTHALPFSYL.......M..D..........E.......D..G..Q.......S..M........LI.PAV.........................NL..F..R..T.G.........T...L.RDAMKWPKRDH.RT.A...D..S..P..RDLIRYDFLNPYLIDRIIAAVSLLT.....R..LK.EE.K..-..PD........AKY.....................................................................YTFG.NCS.I........HR....H....S...LQ.......KG.....ITYY...R..EALDVFVG.DYLI..H.G.......----....-.-...-.-...-....--.--GAI....D.T..SEGP.G..R.G.SWIDLAGLVMPRETL.EEIVRD-------.D.LFEADAAFRQAHAR...YDEYL----GRF.ITDR..YD.......LS......D..A.D...K.RIEHLKRYVS-.-.--TLDT....VRHRLSKEAALEFF.GVS...QISYGA...DCPESD.RQTDFLQVR.GE.I..ATDPFLAPLLNEMERKIKQAQDM----l.....................................................................
G5HBJ4_9BACT/2-628                   ..............................................................................................................................................YRNLQNSEIAALSA.Q.GCTA..ED..WSR.I...T...V.........A...E.........G...F.H.....T.........D.........WIRNVVFSGE...VKL..GSNGA.EI..AC...GAG..V..IR.RSGVYNAALH.NCTV...GD.G.....VLIYN..........V.....GR.......YIA..N..YD........IAEGVMIENVGQI.....S.........C.E........G..S..........GSFGNGVE......................VSAINEA.GG.REVPIYDEL................T.AQVAYVM..............A..M.Y..R.H..RTE..T.VAWLRNMV.AR.KV.R........EKT.S..S.RG..Y..IGKSASVVNTVSLV.D..VRIGAYATVDGASTLSNGTI.NS...SAE...S..P...SCIGSGVAARDFIIARSARVDTGAMLRSCFVGEGVVIENGFSAEHSLFFANSHCTHGEACAVFAGPYTVSHHRATLLIAGYF....SFFNAGS....GANQ.SNHMYKSGPVHQGIHLRGCKFSSDAYILLP.........A..ST..G..VFTIVK.GRHY.QHHDTDYMPFSYL.......I..E..........E.......R..G..D.......S..Y........LL.PAM.........................NL..R..S..Y.G.........T...A.RDIRKWPGRDR.RR.G...V..A..S..-DLIRYELMTPYTAGKIIRAIHECE.....F..LL.AR.Y..-..PT........AEE.....................................................................VTWN.RVK.I........KT....P....A...LR.......KG.....LLLY...T..QSLRGYLS.ELLE..HgT.......VPGP....G.L...A.A...L....PD.DAPAG....L.A..TPPD.G..V.I.EWIDLAGLIVPSAAI.DRLLDEVDAGRLA.G.FEILEQHLRKLDTE...YSGMVASWAVYA.LEKL..LK.......KS......A..V.R...I.TAGDLRQVIAQ.G.EADRAA....LAAGVEMDARRDFA.PLM...AVGYGI...DSE-QY.RDADFRAVR.GD.-..---------------------------ai....................................................................
A0A1T4LB04_9SPIO/26-721              .............................................................................................................................................k-RHLTEQEIAVLKA.N.GNTN..SDslWQN.V...F...V.........S...Ak......dgE...F.D.....A.........N.........LIRSSEIHGF...LIL..GRLVP.ST..LK...FHD..L..VL.DTGIYSSYVE.NVVL...ED.D.....VVIRN..........A.....-A.......YLL..N..YR........IGTRSIIFNVQEM.....S.........C.T........N..H..........SKFGNGILknges...........ekvriwIGVGNEN.DG.RAILPFEDM................I.PADAYIW..............S..R.Y..R.E..DSE..L.QKRFVELT.EY.GQ.S........KEL.D..T.FG..I..VENDAVIKNSTLIK.D..AKIGAHCYIKGAFKLKNITV.LS...SED...E..P...SQIGEGVELVNGILGFGSKVFYQAVAVRFVIGRNCQLKYGARLLNSVLGDNSTVSCCEILNNLIFPFHEQHHNSSFLIASTIc.gqSNIASGAt..iGSNH.NSR----SPDGEMFAGRGFWPGLCSDFKHN.........S..RF..A..SFTLVSkGSYQ.HELNIK-YPFSLV.......A..S..........N.......G..D..Qk.....cI..T........II.PAYwf.....................lyNM..Y..A..I.S.........-...-.RNKSKFFKRDK.RF.V...K..V..Q..--HIETDPLAPDSIQEVVCALSRII.....E..LT.GE.Y..L..VK........KGLekavnakspeelynvtkd.................................flhrnseveftlcdpesqKKYG.A-E.I........HK....-....-...PI.......RA.....YKMY...R..KIIKYFAC.SVLV..D.Y.......CALY....N.T...R.I...D....RE.ELKVI....T.T..QFPL.-..Y.T.QWLNVGGQIIPQKKI.EELFENIKSHKIE.N.WRQVHNFYDKCEKE...YLIYRTNYAIYL.LERL..YS.......TK......V..R.N...F.TPEIFNDIISD.V.TLVSNE....MLNAAHSSREKDFI.DEF...R-----...-KITFR.NDEEMAAVL.GK.I..EDNEFLTEMKEKTQKF-----------neallnlf..............................................................
A0A0A2F374_PORCN/1-651               .............................................................................................................................................m-RHLTDIEITALKK.N.GCYS..KD..WSL.V...E...V.........H...E.........A...F.D.....P.........D.........TCFYSTFIGK...CYI..GDLSG.YR..DN...ELG..I..PL.PNGIRHALIH.ECHI...GN.H.....VRIDH..........V.....ND.......CIS..R..YD........IGDHTTISNICTL.....A.........M.K........G..D..........STFGNGTA......................VSVLDEM.GG.IEIKICDLL................T.AHTAYLM..............A..F.M..G.H..DKA..L.KQSLGRLF.DT.YT.E........SLR.S..D.RG..H..IGEHVTIKNAGSII.N..ARIGAHTVIDGATLLEDCSL.NS...TPS...R..P...VYIGPNVMAEHFIAASGAKISGGSVVHYCFVGQSTKIDRLFSAEHSLFFANCQCENGESCAVFAGPYTVTMHKSSLLIAGHY....SFLNAGS....GSNQ.SNHLYKLGPMHFGVVERGSKTTSDSYVLWP.........S..RI..A..PFSLIM.GRHV.HHIDTSDFPFSYV.......I..E..........N.......D..D..E.......S..Y........LV.PGA.........................NL..R..S..I.G.........T...I.RDAKKWPQRDR.RH.P...E..D..R..TDCINFNLLSPFTIGKMERGYNRLK.....E..LR.AF.I..G..HH........GKT.....................................................................YIYN.NIN.I........RS....S....S...LE.......HG.....LKTY...D..LGIKKFIG.NSVI..Q.Q.......MKDW....D.L...T.S...E....ES.LRACL....L.P..KHTE.S..A.G.EWLDISGLIAPKTAI.DKIVEGIKDGTLS.D.LSGINAAFQSLHGS...YYDLEWEWSYHL.MCRW..YG.......IR......R.hE.D...I.DSALITRIVRE.W.MDAVIT....IDKYLHSDAYKEHE.IVG...RISFA-...----NQ.RYADIDEKM.AA.I..ENNPIVLEVTEHIEKKRTLGEQTLERL......................................................................
A0A4Q5SSR4_9BACT/42-731              ..............................................................................................................................................YRNLTAYEIEKLVR.N.NNTS..DD..WNK.I...Q...V.........S...D.........A...F.N.....A.........D.........LVRNCKFFGL...VRI..GKLES.FA..LR...HHN..V..TH.PVGLYNSTII.SCDF...GD.N.....VVVDN..........V.....-K.......FLS..N..YI........IGNEVLLLNIDEL.....H.........T.T........Q..S..........AKFGNGILkeged...........essrvwLEVCNEN.AG.RKIIPFNGM................L.PGDAWIW..............A..K.H..R.A..DGE..L.MQRLEDLT.QL.RY.D........ARR.G..Y.YG..K..IGDRTVIKNTSIVK.D..VWVGTDAYIKGANKLKNITI.NS...APD...A..M...SQIGEGCELVNGIVSYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..vGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..KF..A..SFTLIAkGDYT.NELNIP-IPFSLVs.....nD..E..........G.......N..N..R.......L..V........IM.PAYwf.....................qyNM..Y..A..L.A.........-...-.RNAHKYVDRDK.RT.R...K..R..Q..--HIEYDYLAPDSVNEIFTGIRLLE.....R..LT.AL.H..V..RG........GDAggmseqeleaeght........................................lltegktnlkagiqaYGFE.N-N.T........RP....T....I...LTk....vpEA.....WRVF...Q..DLIAYYCG.TQLL..Q.W.......MEEN....S.F...G.S...F....AE.MKESF....P.D..ESP-.-..R.G.QWHNAGGQLMPESAL.QELIEGIKSGVIG.S.WSEVHTFYEVSGAR...YPEQKRAHALTA.YFEM..IG.......MS......R..A.A...F.AEGDFHTLLER.T.LRVKEW....MVEGIFKARAKDYE.NPF...RT----...--MIYD.STKEMNEVV.GR.L..EDNSFICHQREELAALRLRVSHIL---ke....................................................................
A0A257HTP1_9BACT/44-736              ..............................................................................................................................................YRQLDAYEIEVLVR.N.RNTS..DD..WNK.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.LC..LG...FSD..L..KV.PVGLYNSTII.SCDF...GD.N.....VVIDG..........V.....-H.......YLA..H..YI........IGSEVIITNVDEM.....V.........T.T........N..H..........SKFGNGILkegee...........edvriwMEICNEN.TG.RKVLPFVGM................L.PGDAYLW..............S..K.Y..K.D..DDI..L.QEKFKQLT.AK.QF.K........PHR.G..Y.YG..K..IGDRTVIKNTKILK.D..VWIGSDAYIKGANKLKNLTI.NS...GEE...G..R...TQIGEGCEIVNGIIGYGCRLFYGIKAVRFVMADHSQLKYGARLINSYLGQNATISCCEVLNSLIFPAHEQHHNNSFLCAAVVm.gqSNIAAGAt..iGSNH.NSR----GADGEVILGRG---------FWPglcvslkhnS..KF..A..SFTILSkGDYP.AELNIQ-VPFSLV.......S..Nd........lS.......K..D..Q.......L..V........VM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKYIDRDK.RN.E...K..I..Q..--HLEYDYLAPDTINEIFIALDLLE.....L..AT.GK.A..Y..QH........K-Mhpgkkiskeecmsigkn..................................llktgnkivdqleiladgFENS.KRK.V........VY....T....K...VL.......KA.....YKVF...E..ELIVFYGV.RAML..G.L.......IKQE....G.I...T.N...F....EK.LTQAM....P.A..KT--.Q..R.N.AWVNLGGQLMPEADL.LVLRKKINTDKIK.S.WDEIHGYYETMGTK...YDEQKTAHALAS.LSEH..LG.......IN......L..K.K...I.TAEQFNSLMGT.V.ISTKEW....MAKGIYDSKAKDFV.NPY...R-----...-KMVYE.TTAEMNAVV.GK.L..EDNSFIKEQVIELKRFKREI-------saikka................................................................
R7DDJ6_9BACT/1-234                   ..............................................................................................................................................--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..----------------MLTAIDVLR.....H..LQ.ES.S..G..ET........SEV.....................................................................YSYQ.SAC.I........KN....T....S...LV.......KG.....INLY...S..KAINKFLG.NSII..K.R.......LENI....R.F...K.S...D....EE.IRERL....R.P..DNNI.G..T.G.DWLDLSGLIAPKSEI.DRLINQIESEEIK.T.LEPIQQTFISLHKR...YYDLEWAWAYEV.MQSW..YH.......RS......I..D.Q...I.TAQDITEIVNI.W.KDAVVS....LDEMLYADAKKEFS.MTA...KTGFGI...DGNTQQ.KNVDFEQVR.GA.F..ENNPFVKTVNEHIKAKTELGNELIDRI......................................................................
A0A4U2LFD0_9BACT/38-685              ..............................................................................................................................................YRTLTETDIRILIE.Q.GCKA..SN..WQT.I...K...I.........A...P.........A...L.P.....L.........E.........NIQNTIFQGE...VTL..GDEH-.-I..TE...---..-..DQ.SINISNCKVV.DCSI...AN.G.....VTLSN..........V.....-H.......LIQ..N..YQ........ILENTIIENVNSM.....T.........V.Q........G..E..........SAFGNGET......................LDILNEG.GG.RELTMFDTL................S.AQIAWLQ..............I..R.C..R.H..NTL..F.SDKLQQLI.NT.YV.T........SKK.S..T.RG..I..IGKHVSIKHTNLIE.D..VNIGDYCQINGAVHLLNGTI.RS...RME...D..P...VMIGNGVIARNFIIQEGSHIYSAAMLHHCFIGQGVMMGKQYSAEHSAIFANSECFHGEGLSIFAGPYTVTHHKSSLLIAGQY....SFYNAGS....GSNQ.SNHMYKLGPLHQGIVERGSKTGSFSYMLWP.........S..RV..G..PFSVVM.GKHT.SSFDSGDFPFSYI.......T..E..........E.......Q..G..K.......S..V........LT.PAM.........................NL..F..S..V.G.........T...S.RDIEKWPNRDR.RK.A...K..R..K..FDLIHFDFLTPYIMERVMTARDQLL.....K..LY.KE.T..P..KE........RES.....................................................................VFLN.GLH.I........YR....L....M...LR.......TC.....SKYY...Q..IAMKVYMG.QELI..K.K.......LGEE....E.L...R.N...F....AH.LEQHL....T.K..HTEI.S..A.K.HWVDMVGMLTPVCQL.EKLMQEISEEHIT.D.LTHLHERLIELYLG...YHEWSWSYCWKL.IKQE..HQ.......LE......T..D.D...I.TPDLLLKVITD.W.KDNSLK....LNKMILTDAEKEFD.AVS...RIGYGI...TNQEDT.INSDFAAVR.GA.S..SDNKKIKALHQEQGLIEEKAGEMI---klv...................................................................
E1RA53_SEDSS/39-741                  ..............................................................................................................................................YRALSAREVEILVR.N.GNCA..DD..WNA.I...L...V.........A...E.........G...F.N.....P.........E.........RVERCTFHGK...IRI..GALEE.GY..LE...YHD..L..KL.PIGIRDSVII.SSDI...GD.N.....VAIRN..........L.....-G.......YLA..F..YI........IEDQVILMSIEEM.....V.........T.T........N..H..........AKFGNGIVmeged...........pnvrirLEIGNEN.GK.RAIYPFDGM................L.SADAYLW..............S..R.F..R.D..NQP..L.VKAFEAMT.DA.AF.E........HRR.G..T.YG..R..IGTGSVIKSCRILK.D..IKIGEGAYIKGANKLKNLTV.NS...SAA...Y..P...SQIGEGVELVNGIIGYGCHVFYGVKAVRFILANHSNLKYGARLINSYLGENSTISCCEVLNALIFPGHEQHHNNSFLCAATVl.gqSNIAAGAt..iGSNH.NSR----GPDGELFAGRGFWPALATSLKHN.........S..KF..A..SYTLLAkGAYP.AELHIP-LPFTLVs.....nN..E..........A.......R..G..R.......I..E........MM.PGYwf.....................ryNM..Y..A..L.A.........-...-.RNSWKYGVRDK.RK.D...P..D..Q..--KIEFDFLAPDTAEEMRKALSLLE.....I..WA.GL.Y..I..DN........ISIssddniktslldytfafhslpeippg.................lrsiaargaawfesqkeaadeipvpaYGIE.KSK.R........DT....I....I...IRa.....fTG.....RRWY...R..EMILLYGM.EQLA..A.F.......CSRH....R.L...S.L...S....DG.I-AIL....E.K..KAAG.A..Q.T.VWHNIGGQLISDAQM.RKLQSDIVSGDID.S.WYGLHQRYRELGIS...YPDEKAAHAFSL.FRTF..YS.......GP......I..E.D...-.-------ALDR.A.AEIREL....IARNTRQSREKDYQ.NNF...R-----...--KMAYgSQEEMYAVL.GT.I..EDDSFIKNIEEKAV-------------sfrkelgrl.............................................................
A0A1H7Z503_9BACT/4-615               ..............................................................................................................................................YRNLTQDEIEVLEH.N.VSWA..ED..WQR.V...M...V.........A...D.........D...F.K.....P.........Y.........NFHRVIFYGD...IRL..GSFHK.MV..EV...SKG..F..VK.HSGINDATLR.NVTV...GN.D.....CLIEK..........V.....GN.......YIN..N..YT........IGNDCYISNICTL.....E.........T.T........D..D..........ATYGEGSV......................ISVLNEM.GD.GNVTIFREL................N.SQVASLM..............V..K.H..E.R..DKA..L.KQRLQQMI.ED.EL.R........VSR.P..D.RG..Y..IGNNVKIINAKDIT.N..TIIKGDCEISGAARLSECTV.MS...SMD...A..P...VFIGTGVICENSIICDGCSINNSVKMQDCFVGEACQITNGFTAEASLFFANSFMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPLHYGTLERGTKTASGAYVLMP.........A..TI..G..AFSVCF.GKLM.HHPDTRNLPFSYL.......V..A..........Y.......G..D..D.......C..Y........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RS.K...Q..S..K..KSIINFDWLSPFTVGEIMEGINILK.....A..LR.EA.S..G..DN........VST.....................................................................YNFH.EYV.I........NA....S....S...LR.......KG.....QKYY...D..IALRIYMG.AVL-..K.R.......AQKE....G.Y...-.-...-....--.---IG....Q.P..VSSI.G..K.G.KWVDLSGLLLPESEE.LRLIDDIKSGAID.N.IQQVLDRFSEINNN...YPEYRWAWSYQM.ILDY..YH.......L-......-..E.E...L.DAAACERIRED.Y.VKARRA....WIAEIRKDAEKEYA.MG-...------...------.---------.--.-..---------------------------dvdkevfdefvekldheidy..................................................
A0A0A2DUG5_9PORP/8-663               ..............................................................................................................................................YRPLTQEEQSILQH.N.LCSS..SD..WSL.I...R...V.........A...E.........G...F.D.....P.........A.........RCRGAHFSGE...VLL..ARFDA.EV..EL...PGG..V..RK.PTGIYHAHLH.HCSI...GD.N.....VLIEG..........V.....NE.......YIS..N..YN........IGPYTIIFNIDRM.....L.........V.C........S..E..........TTFGNGLK......................IEVLNET.GG.REVVMTHNL................S.AHVAYLM..............A..F.Y..R.H..DPE..L.IHALGQLT.ER.ES.R........ART.H..C.MG..E..VGERVLIRSTHTIE.N..TYIGPYARIEGASRLREGSL.MS...NRE...D..P...VYIGYNVSCVNFILQSGSSVLDGATISNCLVGQGTRLSHLFSAHDSLFFANCQGENGEACAVFAGPYTVSMHKSSLLIAGYY....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYVLWP.........S..HI..G..PFTLVM.GRHV.DHVDSSDFPFSYL.......I..E..........D.......H..N..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAKKWPARDR.RK.D...S..Q..L..LDSINFNLLSPYTVGKMIRAHQALS.....E..LS.HL.L..G..NT.......aDHK.....................................................................IAYR.NMR.I........QQ....R....A...LE.......RG.....IKLY...E..IAIVKFLG.NSVI..H.R.......LRDS....D.C...S.T...G....TR.LRDAL....R.P..HSER.G..L.G.SWIDLCGLIAPEQEI.DEIIQRVKSHEIE.S.LDALNAAFADLHRH...YYDLEWPWAYQA.MLEW..YG.......LE......E..E.T...I.SRADILALVDQ.W.EQCVTE....LDHMLYEDAKKEFA.KSV...KVGFGI...VSGGRT.QEADFESVR.GA.F..DTNPFVLSVLEHIEAKRALAVDMRERL......................................................................
A0A133YAR7_9BACT/3-616               ..............................................................................................................................................YRKLTEEEIITLED.R.NCWA..ED..WSS.I...Y...V.........S...D.........D...F.K.....P.........N.........YMHRVMLYGE...VYI..GAFEK.NI..EV...TKG..F..LK.HSGINNATLR.NVTV...GD.N.....CLIEN..........I.....GS.......YIN..N..YT........IGDDCHLSNISTI.....E.........T.T........D..G..........ATFGEGNL......................ISVLNEV.GD.GNLVFFKEL................N.SQFAAFM..............V..K.H..C.Q..DKE..L.KDKIRRII.RE.EI.A........MTS.P..E.RG..T..IGNRVKIVNTKEIS.N..TVIHDDCEINGASRLSDTTI.MS...SPN...A..N...VYIGTGVICENSIVCDGSSIINSVKMQDCFVGEACHISNGFTASTSVFFANSYMSNGEACAAFCGPFSASHHKSSLLIGSMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGTKTASGAYVLMP.........A..TI..G..TFSVCF.GKLM.HHPDTRNLPFSYL.......T..A..........Y.......G..S..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDL.RP.E...G..A..Q..KSIVNQDWLSPFSVGEIIRGKEILE.....K..LQ.SA.S..G..ED........VSS.....................................................................YNFH.EYV.I........NA....S....S...LK.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......VRKR....-.-...-.-...-....--.YQGIV....P.P..TTEI.G..L.G.DWNDLAGLLLPDSEE.QRMVQDIKNGTLD.T.VEKILKRFEDINDN...YRAYQWAWTYRL.ILDY..YG.......LT......-..-.E...L.TEESAEKIRHD.Y.IEARRV....WIAEIRKDAEKEYQ.MG-...------...------.---------.--.-..---------------------------dveehvfnnfvnsldheadye.................................................
J6GZU9_9PORP/9-663                   ..............................................................................................................................................YRPLTAEEISVLRE.H.ANSA..DD..WSQ.V...W...V.........K...E.........G...F.V.....P.........R.........YILNTHFSGW...VRL..GLFEK.TF..DL...PGG..I..SK.HSGLYYTYLH.NVEV...GD.N.....CCIEH..........V.....NN.......YIA..N..YT........IGEESFISNVDTI.....L.........V.D........G..E..........TTFGNGVE......................VSVLNET.GG.REVLSYDQL................S.AHEAYFM..............A..I.Y..R.H..RPA..L.ISELRHLI.WG.YI.D........GLR.S..A.HG..T..IGAHAHITDVGNIT.N..VKIGPYASIVGTRRLYNGSI.NS...VKE...A..P...VSLGYSVICTDFIISSGSSVQSGTALSRCFIGQACTLAHGYSASDSLFFSNCHEENGEACAIFAGPFTVTHHKSTLLIASQF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIMERGAKTSSDSYILWP.........A..RI..G..AFSLVM.GRHT.THPDLSNLPFSYL.......I..E..........S.......C..D..T.......T..F........LI.PGV.........................NL..K..S..V.G.........T...I.RDAQKWPRRDA.RT.D...P..H..R..LDQINYNLLSPYTIQKMLNGRMILT.....E..LR.RV.A..G..VT........SEI.....................................................................YSYQ.SAK.I........KA....S....S...LR.......KG.....IHFY...E..LAIHKFLG.NSLI..K.R.......LEGI....D.C...T.S...I....EV.VRQAL....Q.P..RTSI.G..H.G.DWVDLSGLIAPKAEV.LRIIEDIEMRSIE.A.ISELQQRLADLHLH...YYEYEWTWAYDK.IQEF..YG.......ID......L..T.E...V.TAEQIAELVER.W.RSSVVE....LDRELYADAKKEFS.LSA...MTGFGA...DGDERV.QAQDFEEVR.GD.F..DSNTYVKSILQHIEEKSALGEELLGRL......................................................................
A0A2W7P7P9_9BACT/3-634               ..............................................................................................................................................YRSLTPTEQEQLER.Q.GCSS..DN..WQW.I...S...V.........K...D.........N...F.T.....A.........S.........KIRRTHFSGH...VQI..GKLN-.--..--...--G..H..DK.PEGIHDSTID.NCTL...ED.H.....VLVSQ..........V.....-G.......RLS..H..YI........VRSHAVIENCGTI.....E.........A.I........G..K..........STFGNGTR......................ASVINEA.GG.REVPLYEGL................T.AQTAWLM..............A..F.M..R.H..RKN..F.TEQFTRLI.DE.KC.S........KAL.L..D.NG..I..IGHHARVSNCNTIT.N..VYIGDHARVEGSLHLKNGTI.NS...TES...A..P...TRCGHGVMAENFMMAAGSVTNNASIVKNSFIGQGCIVDRQFSADHTVCFANSQLYHGEACSAFCAPYTVSHHKSTLLIAGYF....AFMNAGS....GSNQ.SNHMYKLGPVHQGVTERGCKLSSDSYLLWP.........A..KI..G..AFTFVM.GRHY.SNPDIGDFPFSYL.......L..D..........E.......E..G..I.......S..S........LV.PGA.........................NF..R..S..I.G.........T...L.RDSDKWPGRDI.RT.G...T..K..A..-DRIHYNMLHAYTVSKALKGKQRLT.....A..IE.QN.Q..E..AP........NGY.....................................................................YTIG.DVR.I........KK....P....A...LR.......RG.....IDIY...N..EIATIYTG.N-II..D.R.......ISKE....R.N...L.S...I....EQ.LVEEI....R.T..HGSI.D..T.F.GWVDMAGMLMPEYKL.MQLVNEVESGQLA.S.LSKIDAFLDEAFDQ...SPQDEWQWVLSR.WDEL..TG.......MS......I..V.D...I.NADKLSQFMQN.S.HSAHQR....FTMMLVKDAQKEYS.ERS...KISFGY...NDDPKI.RFDEFTAIR.GT.C..DDNSFVQKLKQES--------------k.....................................................................
A0A143XTY3_9BACT/54-575              ...........................................................................................................................................ari--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........V.....SS.......RVR..N..YR........IGEDSLVEQVTAL.....E.........C.R........H..E..........SAFGNGTP......................VAAMNEC.GG.RTVRICDLM................S.AQAAYAS..............A..V.Y..R.H..RPQ..T.VAALERMT.ES.VV.R........ARR.S..A.MG..S..VGRGCRIVGARFVR.E..MRIGDGATIDGASRLEEGTL.A-...---...E..G...AAVGADVKASHFIAAEGARLDNGAIVERCFVGENCILSNGFTAVDSLFFANSHCENGEAASVFAGPFTVSHHKSSLLIAGMF....SFFNAGS....GANQ.SNHLFKSGAVHQSVHLRGCKFGSGAYIMSP.........A..IE..G..PFTIVL.GHHS.SHHDTSEFPYSYL.......V..E..........K.......E..E..R.......S..M........LM.PGA.........................NL..T..S..C.G.........A...V.RDIEKWAQRDR.RR.V...R..R..-..-DVVDFAEYNPYVCSGFVAAVNTLH.....A..LA.EA.-..D..PD........AGS.....................................................................YNHR.KVV.I........KA....N....M...LR.......RG.....IGLY...N..KAVVASMG.AMLA..R.G.......----....-.-...-.-...-....--.----A....S.A..PDAD.G..S.G.RWLDIAGQYITKRAV.DEILDAVDAGSIR.T.FAELDDRFRAFDAR...YDDYAHSYAENL.LASL..LG.......HR......P..S.A...-.--QEIAEAVEA.G.ANAHAA....MRRTTDADRQRDCS.PDM...AVGYGL...DSDSETeIMADYSAVR.G-.-..---------------------------l.....................................................................
E7RPZ4_9BACT/3-608                   ..............................................................................................................................................YRALTEEEILVLEN.R.NCWA..EA..WNN.V...H...V.........A...D.........G...F.E.....P.........R.........FLHHVLFYGS...VYL..GVFDK.SI..EV...SKG..F..MK.HSGINNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YMN..N..YR........VGNDCYISNVCTI.....E.........T.T........E..G..........ATYGEGNM......................ISVLNEV.GD.GNVVLFKDL................N.SQFAAFM..............V..N.H..C.H..DKE..L.KDAIRRLI.NE.EI.E........FNT.P..E.CG..T..IGDNVKIVNTKEIT.N..TVVYNECEISGASRISDCTI.LS...SPN...A..S...VYIGTGVICENTIISDGSSIINSVKIQDCFVGEACQLANGFTASASVFFANSFMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHYGFLERGTKTASGAYLLMP.........A..HI..G..TFSVCF.GKLM.HHPDTRNLPFSYL.......I..A..........R.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.Q...G..S..Q..KSIVNFDWLSPFSVGEILHGKKILE.....D..LR.NA.S..G..EN........VSS.....................................................................YIYH.EYV.I........SA....N....S...LK.......KG.....IKYY...D..IALRIYMG.AVLK..R.R.......LRLD....P.-...-.-...-....--.--SLM....P.P..SNDV.G..V.G.EWNDLSGLLLPESEE.QRVVNDIKNGELE.S.VQDVIGRFVEIDRH...YREYQWAWTYRL.ILDY..YG.......L-......-..D.E...I.TPEDAGRIRLD.Y.ITARRA....WIAEITKDAEKEYA.M--...------...------.---------.--.-..---------------------------gdveedvlsnfids........................................................
F8N5M1_9BACT/3-617                   ..............................................................................................................................................YRALTEEEINILDD.N.GCWA..ED..WSN.I...S...V.........S...D.........D...F.A.....P.........K.........YMHRVMLYGE...VTI..GGFDK.NI..EV...SAG..F..LK.HSGINNATLR.NVSV...GD.N.....CLIEN..........I.....CN.......YIN..N..YT........IGDDCYLSNISTM.....E.........T.T........E..G..........ATYGQGNL......................ISVLNEV.GD.GNAILFEGL................N.SQIAALM..............V..K.Y..S.H..DKD..F.RAALKRLI.SE.DI.K........ATV.P..D.RG..T..IGNGVKIVNTKEIT.N..TLIGDECEVSGAARLSDVTI.LS...SPQ...A..T...VYIGTGVICENSIINHGSSLINSVKMQDCFVGEACKISNGFTASQSVFFANCFMSNGEACAAFCGPFTASHHKSSLLIGSQF....SFYNAGS....ATNF.SNHAYKMGPIHWGVLERGTKTASGAYLLMP.........A..TI..G..TFSVCF.GKLM.HHPDTRNLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.K...N..A..Q..KSIVNFDWLSPFSVGEIIKGKKILE.....N..LQ.AA.S..G..TD........VST.....................................................................YNFH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......M---....-.-...K.R...D....PE.LT---....P.P..DTET.G..L.G.DWNDLSGLLLPASEE.ERIVREIKNGAID.T.IDGVVSAFRDINDH...YRQYQWTWTYQL.MLDY..YH.......L-......-..Q.T...L.NAEHVENIRQD.Y.ITARRT....WIAEIRKDAEKEYR.MG-...------...------.---------.--.-..---------------------------dvepevldnfisqldheidfen................................................
S6A3Y7_9SPIO/43-724                  ..............................................................................................................................................FRNLLSEEIERLVK.N.GNTC..NN..WTD.V...L...V.........E...D.........P...F.N.....I.........D.........LIKNNLFAGL...VRI..ASMEE.CY..LK...YHD..F..IV.PVGISNSRII.SCDI...GS.N.....CAIHY..........C.....-S.......YLS..H..YI........IGRRSILNRIDEM.....S.........T.T........N..H..........SKFGEGLVkdgee...........esvrvtIAPINEA.GG.REIFPFYDM................I.TADAFLW..............A..R.F..R.G..DPT..L.IEKLKTIT.QN.SK.D........SKR.G..Y.YG..M..VGMESVIKSCRIIK.D..VNFGECVYIKGANKLKNLTV.KS...SSE...E..P...SQIGEGVELINGIIGFGSRVFYGTKAVRFLMGNNCELKYGARLIHSVLGDNSTISCCEVLNSLIFPYHEQHHNNSFLIASLVq.gqSNMAAGAt..vGSNH.NTR----GNDGEIMAGRGFWTGLSSTLKHN.........C..RF..A..SFVLLSkGNYM.SELDIP-FPFSLV.......M..D..........N.......AhdD..R.......L..E........IM.PAYyw.....................myNM..Y..A..L.Q.........-...-.RNNKKFVRRDK.RK.T...K..M..Q..--HIETNFLAPDTAFEILSARSILE.....K.rLE.AA.W..L..EE........KKEklsfkkife..................................................ehyeeakrlfVTAE.NIE.R........SK....R....T...VKi.....iKA.....VEAYaayT..QMLIWYGV.TVLT..E.Y.......FDKT....N.S...S.F...S....DF.EPARN....T.I..DIDN.F..D.F.AWINMGGQLILEKKL.DVIQEKIKKDILK.N.WREIHTEYDAVQSE...YEKDRSENAYAV.LCKV..TG.......VN......-..-.K...I.DCDRWNILLNK.A.LEISDY....IENQIFYTKNKDYN.NYF...R---GI...T---YA.SEAERAAVL.GK.V..EENPLIEESKTD---------------slgyknlfkkfi..........................................................
B7FVS4_PHATC/44-550                  .............................................................................................................................................i-RSLYREEVDALQH.HcGCHC..SD..WTQ.T...R...LvlskdersvD...Q.........S...V.R.....L........rR.........EVSKTAFDGM...VVL..ILDRP.SLrpTT...SDY..A..KL.PLGIHNNALV.SNSIlslGA.R.....VYGN-..........-.....-G.......LVC..D..TF........VGSGAILLRCGSI.....S.........C.K........T..S..........RNY-QDLT......................VTVGPESgGG.RKIRLLC--................-.--EATMI..............E..V.G..H.Q..LKH..P.SADLRDTV.SD.SP.D........KIG.F..R.FN..V..VSSECIVRETPTID.G..IYLYPAARLDAATNVSNAVL.FS...GA-...-..-...-SICNASAVSDCILQWDCTVTDHSIVTSTFLMEQVVAGPKAIVASSVMGPDVHVSAGEVHASVLGPNTNAHHQ-SLLISVLWp..lGRGNVGY....GANVgSNHTG-RIPDQETVAGEGVFWGLSTVITFPv.......dL..SF..A..PYSIIAaGTTL.GPQRVC-MPFSLI.......A..S..........Np.....yG..G..P.......N..N........II.PGW.........................VL..K..SspY.A.........I...M.RSEKKFSIRRK.AK.R...H..S..Y..--YTGWKIIRPELIDLCLSARSMLR.....Y.gLD.AQ.S..S..NQs......eKSI.....................................................................SGIG.DSK.L........NE....K....S...RL.......SG.....IKAY...T..ECIHRFIL.SGLV..S.F.......LFDA....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------tsdgapvvetvvsm........................................................
A0A1M4VJH5_9BACT/42-729              ..............................................................................................................................................YRNLTASEIEKLVR.N.NNTS..DD..WNK.I...C...V.........S...D.........D...F.N.....P.........E.........LVKNCTFFGL...VRI..GKLEP.VY..LE...YNN..V..AL.PVGLYNSTII.SSDF...GD.N.....VVVNN..........V.....-K.......YLS..H..YI........IGNEVMIVNVDEL.....H.........A.T........S..Y..........AKFGNGIVkegeq...........egirvwLEVRNEN.AG.RKIMPFTGM................L.PGDAYLW..............S..Q.F..R.E..DKE..L.LQRFQEFT.EK.RF.D........KKQ.G..Y.YG..K..IGDRTVIKNTSIIK.D..VWIGSDAYIKGANKLKNLTI.DS...VPH...A..K...TQIGEGCEIVNGIISVGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIYPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----AADGELIAGRG---------FWPglcvslkhnS..KF..A..SFTILAkGDYP.AELNIT-LPFSLVs.....nD..T..........A.......N..N..R.......L..V........IM.PGYwf.....................qyNM..Y..A..L.A.........-...-.RNSAKYVDRDR.RK.D...K..V..Q..--HIEYDFLAPDTINEMLEALNTMQ.....R..LA.AQ.A..K..GA........IREgmtdddvlaigaa..........................................lleqpefnkillstAPFE.NSK.R........PV....E....L...LKa.....hTA.....SRMF...R..ELIGYHFV.NQLC..S.Y.......MQQK....Q.G...K.T...L....ET.VLTEL....E.Q..--EQ.G..I.A.AWQNIGGQLVPTAHM.QQMLADIRSGKTS.S.WEELHGFYSQQGEQ...YAWLKLAHAWQA.LKQT..SK.......IS......L..D.N...F.TT-LFAQVVNE.A.IATRTW....MTEKIYQSRAKDYQ.NAF...K-----...-QMVYD.NEQQMEEVV.GS.L..EDNAFIQQQREELEAFTARVTDMVSR-f.....................................................................
A0A512BHK6_9BACT/46-737              ..............................................................................................................................................YRQLSAYEIEVLVR.N.RNTS..EN..WNK.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.FV..LE...FSD..L..KV.PVGLYNSTII.SCDF...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........IGSEVIITNVNEL.....V.........T.T........D..H..........AKFGNGILkegea...........ediriwMELSNEN.GG.RKVIPFNGM................L.PGDAYLW..............T..K.F..R.D..DEP..L.LQKFKEFT.EA.KF.D........KRR.G..Y.YG..K..VGNRTVIKNCRIIK.D..VWIGSDAYLKGANKLKNLTI.NS...GPE...G..K...SQIGEGCEMVNGVMGFGCRAFYGVKAVRFVMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPAHEQHHNNSFLTAATVm.gqSNIAAGAt..iGSNH.NSR----SADGELVAGRG---------FWPglcvslkhnT..KF..A..TFTIVAkGDYP.AELNIP-IPFSLV.......S..Nd........vT.......N..N..K.......L..V........VM.PGYwf.....................myNM..F..A..L.E.........-...-.RNGWKYLDRDK.RE.E...K..I..Q..--HLENEYLAPDSVNEMVGALSMFQ.....K..FT.GK.A..W..FK........KESsdatvsdseaiakgkq.....................................lleandpivneleilaEGFE.NTK.R........KV....V....L...IKv.....lRA.....YQLF...R..ELIQYYCV.NELL..S.L.......IKEK....E.I...S.S...F....QD.LLTSL....P.T..K--Y.N..L.E.EWMNVGGQLIPRAEV.NQLTKKIRGGKIK.S.WDALHEFYEQQAGL...YKSQKLANALAA.VYEV..TG.......SR......V..G.Q...T.NKESFKALLKS.A.VATKEW....MTTGIYESRAKDYS.NSF...R-----...-KMPFE.NQQEMDAVV.GK.L..EDNTFIKQQKEEFDNYKKQAQ------iyln..................................................................
U2P8G2_9BACT/1-614                   .............................................................................................................................................m-RQLTDDEIGILED.N.SCWA..ED..WNR.V...L...V.........D...E.........D...F.R.....P.........N.........YFHRVMFYGD...IEL..GVFDK.SV..EV...SRG..F..LK.HSGINNATLR.NVRI...GD.N.....CLIEN..........I.....GN.......YIN..N..YS........IGDDCYISNVCTL.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEI.GE.GNLVSFRDL................N.SQFAAFM..............V..K.H..M.H..DRE..L.KDCIRRLI.NE.SI.Y........SNQ.P..D.RG..T..LGNNVKIVNTKEIT.N..TIIEDDCEISGASRLSDCTI.LS...NGN...A..N...VFIGTGVICENSIISYGSSVINSVKMQDCFVGEACQIANGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPLHYGMLERGCKTASGAYLLMP.........A..NI..G..TFSVCF.GKLM.YHPDTRNLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.K...G..C..Q..KSIVNFDWLSPFSVGEIIEGKRILE.....R..LC.EA.S..G..DN........VST.....................................................................YNYH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LQWG....A.F...S.-...-....--.-----....V.P..TSPV.G..Q.G.VWNDLSGLLLPESEE.KRLIEDIKEGQID.T.VEGILLSFQHINSH...YRDYQWAWTYQL.ILDY..YH.......L-......-..E.E...I.SDKDIARIHED.Y.VNARRT....WIAEIRKDAEKEYA.MG-...------...------.---------.--.-..---------------------------dvepavlddfiesldheidfen................................................
F3PRS1_9BACE/3-657                   ..............................................................................................................................................YRNLTEDEILRLKS.Q.SCLA..DD..WGK.V...T...V.........A...E.........E...F.T.....T.........E.........FVHHTRFSGE...VRL..GVFHS.EF..TL...PGG..I..RK.HSGLRHVTLH.NVTV...GS.N.....CCIEN..........I.....QN.......YIA..N..YE........IGQDTFIENVDII.....L.........V.D........G..V..........SKFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.IARMKEIT.DF.YS.N........KHA.S..S.VG..T..IGSHVMILNTGSIK.N..VRIGDYCRICGTCRLSNGSI.NS...NEM...A..P...VHIGHGVICDDFIISSGSHVDDGAMLSRCFIGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...T..N..K..LDYINYNLLSPYTVQKMFKGRETLK.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IRFY...E..IAIHKFLG.NSVI..K.R.......LEGI....S.F...R.S...N....EE.IRTRL....K.P..DTGI.G..S.G.EWVDISGLIAPKSEI.DALIDGIESGTVN.R.LKYINAEFAKMHGN...YYTYEWTWAYEK.LEEF..YG.......IN......P..E.N...I.TADDIIRIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRLE.KELDFEQVR.GD.F..ESNPFVTAVLKHIEVKTALGDELIQRM......................................................................
F5IXU2_9BACT/3-657                   ..............................................................................................................................................YRALTPQEINALKT.Q.YCIA..DN..WDN.I...E...V.........A...D.........N...F.T.....P.........D.........YIRHVNFSGK...IKM..GVFEE.EF..SL...PGG..L..KK.HSGIHHACLH.NCEL...GN.N.....VLIEN..........I.....QN.......YIA..N..YR........IGNNVLIQNIHHL.....Y.........V.D........G..E..........TSFGNGVE......................VSVLNET.GG.REVLIYDKL................S.AHFAYIL..............S..F.Y..R.H..RPV..L.TKKLQDMV.MA.YA.R........ENT.S..T.TG..T..IGNNVAIVNAGAIK.N..VRIGDYAVIEGARHLENGSI.NS...NKH...D..P...VHIGYSVMANDFIICSGSRVEDGTMLTRCFIGQACQLGHTYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIVERGGKTTSDSYILWP.........S..RI..G..AFSLIM.GRHY.HNTDTSNMPFSYL.......I..E..........D.......K..N..E.......T..V........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKFPKRDK.RK.D...P..E..V..LDQINFNLLSPYTVQKMFKAISILR.....E..ML.DT.C..G..EA........SDF.....................................................................YSYK.GCR.I........KN....S....S...LN.......KG.....IKLY...D..MAINKFLG.NSII..S.R.......LGNC....P.C...T.S...N....EE.IRSYL....K.P..DTNV.G..L.C.VWSDIGGMLAPRSEI.DKLIADIESEKIT.Q.VSEINATFAQLHKD...YYSLEWTWAWDK.IQQY..YG.......LS......L..E.T...I.TAQDIINIVER.W.KTVVVN....LDKMIYEDAKKEFS.LSS...RTGFGL...DGDRNQ.QKDDFEQVR.GV.F..EENAFVKAVLTHIDTKTKLGNEIISRL......................................................................
Q5LHM9_BACFN/5-659                   ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WNK.V...A...V.........A...E.........E...F.T.....T.........E.........FVHHTRFSGE...VKL..GVFHS.DF..IL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNNTFIENVDII.....L.........V.D........G..L..........TQFGNGVE......................TAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ISRMKEIT.DY.YS.N........KHA.S..A.VG..T..IGNHVMILNTGSIK.N..VRIGDFCRICGTCRLYNGSI.NS...NES...A..P...VHIGHGVICDDFIISSGSHVDDGAMLTRCFVGQACQLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LK.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......SG.....IRYY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...K.D...N....EE.IRRRL....K.P..DTEI.G..V.G.EWVDIAGLIAPKSEV.EKLIDGIESGEIN.R.LKSMNACFAAMHDN...YYTYEWTWAYHK.IQEF..YG.......LN......P..E.T...I.TAKDIIAIVRA.W.REAVVG....LDRMVYDDARKEFS.LSS...MTGFGA...DGSRDE.MKLDFGQVR.GD.F..ESNPFVTAVLKHIDDKTALGEELINRI......................................................................
A0A1T4L0R5_9BACT/44-737              ..............................................................................................................................................YRQLGAFEIEMLVR.N.GNIS..DN..WNN.I...L...V.........S...D.........A...F.N.....P.........E.........LVRNCKFYGL...VRI..GKLEP.YC..LG...FSD..L..KA.AVGLYNSTII.SCDF...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........IGSEVIITNVNEL.....V.........A.T........N..H..........AKFGNGIIkkdet...........edvriwLEICNEN.TG.RKVLPFNGM................L.AGDAFLW..............S..R.Y..K.D..DTV..L.QEKFKQFT.EA.KF.D........NKR.G..Y.YG..K..IGNRTVIKNCNIIK.D..AWIGSDAYFKGANKLKNLTV.NS...GPE...G..K...TQIGEGCEIVNGIIGYGCRLFYGVKAVRFIMASHSQLKYGARLINSYLGHNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIAAGAt..iGSNH.NSR----GADGEIIMGRG---------FWPglcvslkhnS..RF..A..GFTILTkGDYP.AELDIP-IPFSLV.......S..Nd........vS.......R..D..Q.......L..V........IM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNAWKYADRDK.RT.E...R..T..Q..--FLEYDYLAPDTINELLSALTLLE.....E..AT.GK.A..Y..ER.......tLDSrqkytreetiatgkql....................................lasgnkivdsleisltnVENS.KRK.V........IL....I....K...VS.......AA.....YTLF...R..DLVIYYGI.TQVL..Q.F.......CRSN....E.V...K.N...F....AS.LKEQL....P.A..F--K.K..R.N.NWLNIGGQMIPAEDI.DILKERIRNGKTK.S.WDDVHDFYRKQADK...YPDQKLKHALAA.LQEI..SG.......ID......V..R.K...T.DVHRFNALLDA.A.LSTKEW....MTKAIHDSRAKDYS.NPY...R-----...-RMVYE.SFAEMIAVI.GK.P..EDNSFIREQLKALAHFK----------keiaalkknm............................................................
A0A3P2A6P7_9BACE/5-659               ..............................................................................................................................................YRKLTEAEVLRLKS.Q.SCLA..DD..WEK.V...T...V.........A...E.........E...F.A.....T.........E.........FVHHTRFSGE...VRL..GVFRS.EF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..V..........SKFGNGVE......................VSVLNET.GG.REVLISDKL................S.AHQAYIM..............A..L.Y..R.H..RPE..L.IARMKEIT.DF.YS.N........KHA.S..A.VG..S..IGSHVMILNTGSIK.N..VRVGDYCRICGTCRLYNGSI.NS...NEV...A..P...VHIGHGVICDDFIISSGSHVDDGAMLSRCFIGQACRLGHNYSASDSLFFSNCQGENGEACSIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...T..N..K..LDYINYNLLSPYTVQKMFKGRETLL.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LN.......KG.....LKFY...E..IAIHKFLG.NSVI..K.R.......LEGT....D.F...Q.N...D....EE.IRARL....K.P..DTLV.G..S.G.EWVDISGLIAPKSEI.DALIDGIESGAVN.R.LKYINAEFEKMHTN...YYTYEWTWAYEK.LEEF..YG.......IH......P..E.Q...M.TAEDIVRIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRLE.KELDFEQVR.GD.F..ESNPFVTAVLKHIEVKTALGDELIGRM......................................................................
A0A485LRB8_9STRA/35-537              ............................................................................................................................................sp---VTAAQIQILEQ.N.GNRA..DT..WST.V...F...A.........S...G.........D...LsS.....L.........Q.........RVRNCSFRGR...VYL..GAFTK.DV..TV...D-N..V..PF.PSGCYNSNLF.DSYV...LD.N.....ALVQD..........TfllhrPC.......YPR..HvpYSpivtvgtfVNPGACVVGCGSI.....T.........C.S........G.iD..........VTYGNGTV......................LKVGVEI.GG.RDIPVFADM................P.FALGALV..............G..Q.H..R.E..AAA..E.LKAYDENV.RA.YV.Q........AAK.C..G.LN..I..VAHQAKILRCPKLS.D..VFVGEGALVEDS-VVSNSTI.LS...SPA...E..R...STITGFSRVHASILQWNAHVEGASSVERSFLCDCTHVERHGMVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..tGRGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSIKYP.........S..NFthA..PYSVIA.TGVS.TLPQKLEMPFALV......nI..P..........G.......H..N..I.......P..E........LS.PAInei..................fpgwVL.sH..S..IfT.........V...L.RNQDKFEKRNK.SK.R...T..-..P..LD---PTIFRPDIIRMMQVACQRLR.....D..AE.KK.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------pvkihhgkeliytdkqvpglgknymtetsrvvaieaysfyirvya.........................
F2NS49_TRES6/24-740                  .............................................................................................................................................k-RNPTSEEIAILEK.N.GNSS..SDseWKN.F...F...V.........S...S.........EygkF.N.....P.........S.........QIRQSDFSGT...VII..GELFD.SE..IS...FHD..L..KL.RTGIYSSNLK.NVCI...GD.N.....CAVQN..........V.....-R.......YLE..N..YK........IGSRVILFNIMEM.....S.........C.T........E..H..........SKFGEGLLkegep...........esnriwIGVGNEN.NR.RAVLPFTDM................I.PADAFLW..............S..R.F..R.E..DKE..L.MQRFVELT.EF.GK.S........KEL.G..T.YG..I..VEDDVVIKNSTLLK.D..VKICSCAYIKGALKLKNITI.LS...SED...E..P...SQIGEGVEMVNGIMGFGSHVFYQAIAVRFVIGRNCHLKYGARLLNSVLGDNSTVSCCELLNNLIFPFHEQHHNSSFLIASTVm.gqSNIASAAt..iGSNH.NSR----SPDCEMIAGRGFWPGLCSDFKFD.........S..KF..A..SFVLASkGSYV.NELNIT-YPFSLV.......A..P..........Sy.....eD..C..T.......V..H........II.PAYwf.....................lhNM..F..A..I.V.........-...-.RNKYKFQARDK.RF.I...K..V..Q..--HIETNPLAPDTVQEIIFSVNRLV.....E..LT.SR.Y..L..KL........PSDdcrkmtkensypellekfrelaks.....................akdsasllqiakdylhqnpdskflLTDD.RCQ.K........KF....G....A...IIyk...paQG.....YKEY...R..RVLKYFAA.ESLM..E.Y.......VLKN....N.R...E.S...L....--.CQTDF....S.E..IEKIpL..Y.T.KWYNVGGQLIPEEKV.EGLFEKIKSHCIN.N.WQQVHAYYDDCQKN...YTEYKARYSVYI.IEFL..YS.......KK......I..T.E...F.NAGDFENILQD.V.AFVAMN....MLESSISIREKDFT.DYF...R-----...-SITFR.NEEEKNAVL.GT.L..RDDEFLKKLKESTEDFINSLN------klfvl.................................................................
A0A662XKJ1_9STRA/153-617             ...........................................................................................................................................ffp---LSGPEIAALEA.N.GNTS..EH..WEL.V...L...K.........T...S.........EhepL.R.....T.........N.........RIRGCSFHEK...VVL..GRFTG.DA..HD...VDG..V..PF.APGVYNSALS.NVVV...LD.D.....ALVLD..........T.....-L.......VLR..N..VV........LDERACVIKCGSV.....T.........C.Sa......sA..S..........ATCGNGNV......................LHVGVET.GG.RDLCVVADMpfacedpeligeaevgV.AVDLMIV..............C..V.C..R.G..DSE..F.LKAYQAAV.DA.YV.V........AIQ.A..P.MV..I..VARNARVRGCSRVE.G..SFVGEHALLEDCD-VANSTI.LS...TAE...E..P...SVVQTKSIVRDSIVQWNSTVEALSVVENAFLCDSSHVERHGVVMNSVIGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQELFPGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFSLI......nT..P..........G.......H..V..V.......S..S........LS.PAInei..................spgwVL..A..S.sVfT.........V...L.RNEQKFRSRNK.SK.R...T..-..-..--QIESAIFRPE-------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ivhslyelatlagevspetr..................................................
A0A1T4TJ24_9BACT/41-731              ..............................................................................................................................................YRRLLAHEVEALVR.N.DNSS..DD..WNN.I...F...V.........S...N.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........LGNEVIVANVNEM.....A.........T.T........D..Y..........AKFGNGILkeges...........esgriqLELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.Y..R.D..DLQ..L.QQQFKAFT.EK.QF.D........KRR.G..Y.YG..M..VGDRCVIKNCKIIK.D..VTIGTDAYLKGANKLKNLTI.NS...SSV...A..A...SQIGEGCELVNGIIGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEILAGRG---------FWPglcvslkhnS..KF..A..SFTLISkGNYM.SELHIN-IPFCLVl.....nD..E..........H.......D..N..R.......L..K........IM.PGYwf.....................mhNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--QIEYDYLAPDSVEEMFQGLAIME.....A.aVG.NA.W..Y..AL........PENtpkkeltekdlrkkg.......................................kelllqqpeevarltILVK.G--.M........EN....S....S...RE.......VQ.....LLKV...H..KAYALFRE.LIVF..Y.G.......MKNI....I.A...A.S...K....PS.FLALQ....A.A..VKTA.K..R.G.EWHNIGGQLMKAETV.NLLKQKIRKNKIA.G.WPQLHEQYIEIGKE...YATDKLQHAVAS.MLEI..KE.......VS......L..K.N...F.TPALLAEWLED.S.TRTMEW....IAHNIRHSREKDYK.NPF...R-----...-QLAYD.NANEMNVVV.GS.L..EDNAFINETLNELGEYKNRVRKIIN--ew....................................................................
A0A1Z5KAS6_FISSO/42-541              .............................................................................................................................................m-RGLFPNEIDALQQ.Q.SCSC..ED..WNH.V...R..lV.........T...S.........A...A.T.....I.........NeshaislshAIKETRFAAT...VILvlGDEEDdSA..EI...STC..IlkKL.PPGLHSNLLI.SNSI...IDlR.....AKVYR..........-.....NT.......SIC..N..TY........IGPFATIINCGTI.....D.........W.S........S..N..........DHLGLMTI......................TVGAERG.GG.RPITVHPEV................D.M------..............-..-.-..-.-..-PD..V.VQQMKASA.LH.TT.T........HPS.GmiH.MN..I..VDKHALVRDTPTLQ.S..IYLHPHASIQGATSISNAIL.LP...QA-...-..-...-KIASGSTVHNVMLQWNASIVDHSSVTDTLLMEEAQAGPHSLVVSTILGPDVHVSAGEVHASIVGPNTNAHHQ-SLLIGCLWp..lGRGNVGY....GANVgSNHTGRL-PDQECTAGEGVFWGLSTAIKFP.........V..DLssA..PYTLVAaGTTL.SPQR-VTMPFSLI.......V..A..........S.......G..E..G.......N..D........IL.PGW.........................LL..R..SspY.T.........L...A.RNEAKYATR--.RK.A...Q..R..H..WDYTGWKILRAETLSLCWHARQALL.....SpaSS.GS.I..Y..SE........TEI.....................................................................PGLG.ANR.L........SE....K....G...RL.......AG.....VEAY...T..NCIQMFAL.RGLW..R.F.......LV--....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------dsglrrngtnlwele.......................................................
A0A069D6F5_9BACE/4-658               ..............................................................................................................................................YRKLTEDEVLQLKS.Q.SCVA..DN..WGD.I...E...V.........S...E.........G...F.D.....T.........K.........HVHHTRFSGL...VKL..GIFRS.CF..SL...PGG..I..KK.HAGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YD........IGDDAFIENVDII.....V.........V.D........K..V..........SKFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYVM..............A..L.Y..R.H..RPE..L.VNRMRQIT.DH.YS.N........KHA.S..D.RG..Y..IGNRVMILNTGSVK.N..VKVGDCCRIEGTCRLENGSI.NS...NEM...A..P...VHIGYGVICEDFIISSGSHVDDGTMLSRCFVGQACQLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..KV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......G..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...A..N..K..LDCINYNLLSPYTIQKMFKGRSVLK.....D..LK.RV.S..G..ET........SEL.....................................................................YSYQ.SAK.I........KN....S....S...LN.......GG.....IKYY...E..IAIHKFLG.NSII..K.R.......LEGL....N.F...L.N...N....EE.IRQRL....K.P..DTEI.G..L.G.EWVDVSGLIAPKSEI.DKLLCDIECGRVN.T.LKEINARFEDMHRN...YYTYEWTWAYNK.IQEF..YG.......FD......T..E.T...I.TAADVMRIVEV.W.KESVIG....LDRMVYDDARKEFS.LSS...MTGFGA...DGTQDE.RKLDFEQVR.GD.F..ESNPFVTAVLKHIDEKTALGNELINRI......................................................................
A0A1I2RSH1_9BACT/4-618               ..............................................................................................................................................YRPLTEQEISILEN.N.SCWA..ED..WTA.V...S...V.........G...E.........D...F.R.....P.........N.........YMHRVMLYGE...VNI..GAFER.NV..EV...SPG..F..LK.HSGINNATLR.NVTV...GD.N.....CLIEN..........I.....GN.......FIN..N..YT........IGDDCYISNVCTM.....E.........T.T........E..G..........ATYGNGNL......................VSVLNEV.GE.GNVVLFNSL................N.SQLAALM..............I..K.H..A.D..DTG..F.RDALRRII.SE.EV.R........LQQ.P..S.RG..T..VGNGVKIVNSKEIT.N..TVINDECEISGAARLSDCTI.LS...SQN...A..S...VFIGTGVICENSIISDGSSLINSVKMQDCFVGEACQIANGFTASQSLFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGEF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGTKTASGAYVLMP.........A..HI..G..TFSVCF.GKLM.YHPDTRRLPFSYL.......V..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.Q...G..S..Q..KSIVNFDWLSPFSVGEIIQGKRILE.....K..LR.EA.S..G..DE........VST.....................................................................YNYH.EYV.I........RA....S....S...LK.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......IKRL....-.-...-.-...-....--.-GAVE....L.P..TTTV.G..E.G.EWNDLSGLLLPASEE.RRMLDDIKSGCLD.S.IGEITRRFTEINDR...YREYQWAWTYKL.ILDY..YN.......LD......-..-.S...L.DSDDLQRIHDD.Y.VAARRT....WIAEIRKDAEKEFH.MGD...------...------.---------.--.-..---------------------------versvldnfieqldhevdfen.................................................
A0A1C2BVZ0_9PORP/4-658               .............................................................................................................................................k-RNLRPEEIAMLQA.N.ACMA..DN..WSS.V...F...V.........P...E.........N...F.D.....I.........K.........YVSHTRFSGE...VTL..GAFNK.EF..IL...PGG..L..KK.HAGLRHVTLH.NCRL...GD.N.....CLIEN..........V.....QN.......YIA..N..YD........IGENCIIQHVNVI.....L.........V.D........G..V..........SSFGNGTL......................VSVLNET.GG.REVPIYDWL................P.APLAYVI..............T..L.Y..R.H..RPQ..L.ISRISNLI.ES.YS.K........EIS.S..S.RG..S..IGNNSRITNTGTIR.N..VRIGSYATIENCTRLENGSV.NS...REE...E..P...VYVGDSVIAQDFILSAGVILSDAAKIVRCFVGQACHITHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RV..G..AFSLVM.GRHY.HHCDTSDMPFSYL.......I..E..........K.......D..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.A...G..L..Q..LDPINYNLLSPYTISKMRKAVEVLK.....N..LQ.AL.V..G..ET........SEI.....................................................................YYYQ.NTR.I........KG....S....S...LR.......NG.....LALY...G..KAINKFLG.NSLI..K.R.......LEGT....A.F...S.S...I....EE.IWAQL....Q.P..TESR.G..K.G.EWIDLSGMIAPQEVI.ENLLRSIEAGEIT.S.LEEISAIILDIQKH...YYEMEWTWAYDM.IESV..YG.......VN......L..Q.T...I.TAKELIALTEI.W.KESVVS....LDELLYADAKKEFS.LTS...KIGFGV...DGSATE.KMKDFEGVR.GD.F..ENNPFVLAVKDHIVKKEALGNELIERL......................................................................
R6PUZ6_9BACT/4-606                   ..............................................................................................................................................YRPLTTEEIEQLQQ.N.GCWA..ED..WTS.V...N...V.........A...E.........D...F.N.....P.........E.........HMRQVMLYGE...VCI..GSFDK.SI..EV...SPG..F..HK.HSGIRNATLH.NVII...GD.D.....CLIEN..........I.....GG.......FIN..N..YT........IGDECYLSNVSTI.....E.........T.T........E..G..........ATYGEANV......................ISVLNEA.GD.GNIISFSEL................S.SQLAALM..............L..K.H..S.H..NKE..F.RETLFQLV.RA.YV.S........SRL.P..E.RG..L..IGNNVKIANTKEII.N..CIINDYCEVNGAERLSDCTL.LG...DAT...S..S...VYIGTGVIAENTIIDHGASITNGANLQDCFVGEACQINNSFTASVSVFFANSVMSNGEACAAFCGPFSASHHKSSLIIGSQV....SFYNAGS....ATNF.SNHAYKMGPIHWGILERGTKTASGSYLFLP.........A..HI..G..AYSVCL.GKTM.AHPDTTSFPFSYI.......I..G..........E.......G..E..K.......T..I........LI.PGR.........................NL..V..T..V.G.........L...Y.RDINKWPKRDL.RP.A...E..H..R..KSIINQEWLSPFVISKATEGRRILQ.....E..LC.TT.C..G..TQ........CQE.....................................................................YHYQ.GLT.I........PR....S....S...LL.......SG.....IRFY...D..MLISLYLG.QVIK..K.A.......TLPE....A.A...EeE...G....HE.YTPLS....E.Q..AIHN.G..E.E.AWTDLGGLLLPQALE.SQLVEDIIDGTTE.D.IESVINALSEAHSH...YADFNQAYAFSL.IRQL..YE.......EA......T..-.-...-.-PAAFSLIETR.A.DEAKSL....WTEAIRKDAQKEYD.L--...------...------.---------.--.-..---------------------------gdvd..................................................................
A0A2Z3MRE6_9BACT/42-731              .............................................................................................................................................h-RKLKAWEIETLVR.N.DNTS..DD..WNN.I...F...V.........D...N.........E...F.D.....P.........N.........LVQHCHFYGM...VRI..GKLEP.FY..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YI........IGNEVIIANVNEM.....G.........V.T........D..H..........AKFGNGIVkegep...........envriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.H..DTV..L.MERFKAFT.EK.QF.D........KKR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...EPG...A..H...SQIGEGCELVNGIIGLGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTLIAkGNYM.SELDIP-FPFSLVv.....nD..E..........H.......D..N..M.......L..R........VM.PGYwf.....................mhNM..Y..A..L.A.........-...-.RNAWKYVDRDK.RT.D...K..T..Q..--LIEYDYLAPDSAEELLHSLELME.....Y.aVG.KT.F..H..GQ........KDKagkkalqqkgkqmll.......................................eenakvgraeilvegI--E.NSS.R........KA....Q....L...LKv.....hKA.....YPLF...R..ELVNLYAM.RNLV..K.L.......AAGF....N.I...T.S...F....KT.LQAVC....K.T..S---.R..R.T.AWYNAGGQLVKADAL.DDLKNRIRKGKIT.G.WPELHEAYRQLGAV...YEQDKLHHALAC.LLHL..HQ.......VS......A..G.E...L.TPALLKKYLEQ.S.VHTLSS....ITESIYHSREKDYL.NPF...R-----...-RMAYE.NEAEMDTVV.GK.L..EDNSFIQQTQADLKAYKKQVKEIIRQ-w.....................................................................
A0A5C1QPA8_9SPIO/42-718              ..............................................................................................................................................YKQLSAQEIEVLVK.N.SNSA..DD..WNT.I...Y...V.........T...E.........N...F.N.....P.........K.........LVKNNQFHGL...IRI..GDLEN.LY..LE...FHD..V..PF.PVGIYNSKII.SCDL...GT.N.....VSINN..........V.....-N.......LLS..H..YI........IENEVILLNINEL.....I.........T.T........N..Y..........AKFGNGILkegee...........estriwIEIANEN.GG.RKVLPYNGM................T.AGDAWIW..............S..R.F..R.E..REI..I.MDKLKLLT.QR.SF.D........NKR.G..Y.YG..R..IGTRSVLKHCRILK.D..VTIGSDAYIKGSNKLKNLTI.NS...RAD...S..P...TQIGEGVELVNGIIGYGCHIFYGVKAVRFVMDDHTNLKYGARLINSFLGCNSTISCCEVLNALIYPGHEQHHNSSFLCASTVl.gqSNMASGAt..iGSNH.NSR----GNDGEILAGRGFWPGLSTSLKHN.........C..RF..S..SFNLLVkGAYP.FEIVNP-LPFSLIs.....nD..E..........S.......H..D..C.......L..R........II.PAYwf.....................ryNM..Y..A..L.A.........-...-.RNAWKYEDRDM.RM.E...K..K..H..--LIIYDYLAPDTINEIFEAMEIIR.....I.qLE.HS.D..E..FK........QQEtfatphdyl..................................................chedlptlhaDHFE.Q--.G........KR....S....V...LI......lKP.....CEAY...R..----EYRD.MLLY..Y.C.......VKTI....-.V...T.S...N....MD.VSGLL....K.K..LQGS.G..NrS.SWDNVGGQLIRKSRV.MKFLNDVENDLVG.S.WDEIHEFYLSEAQK...YPKEMLEHSISS.LKEL..LH.......LD......N..L.K...E.DTASIQNILDR.S.IHINKK....IKDRCYESRLKDYT.NPF...R-----...-NITFS.SEKERDAVI.GK.L..EDNSFIQKTLEDSQDLEKLII------kmrksl................................................................
A0A2R5GJ84_9STRA/23-546              .............................................................................................................................................t-RKLRPEEKLALES.Q.GNSCgpEG..WDRcL...E...V.........Q...E.........D...F.S.....P.........R.........NVRGCVFLGR...NVV..GKFDE.SA..-M...VGA..H..AL.PAGLYHSTLR.DCYV...AD.N.....ARISH..........C.....-E.......LVQ..E..TF........VGKSAMIAHCGVV.....T.........R.E........R..RaaastkeglgSTFGNGVV......................LPVVIGT.GG.RDVAIYAEM................D.IEEACAV..............A..C.K..R.E..DAT..L.QTQHAQIV.SQ.YV.D........AIR.L..A.WN..V..VDDNASVDSCAYIA.D..VFVGAFAQVSGS-HVVNATI.LS...SEE...E..P...TSVRAGADVRDSILQWSVSVDSQSVVHKAFMCVHSHAERHGKLLESILGPFSGVAEGEISESLVGPFVGF-HHQALLIASYWp..sGKGNVGY....GANVgSNHTG-KAPDQELWHGEGVFYGLGCCIKFP.........S..DFshA..PYTLVA.TGVT.TLPQRLTMPFSLI.......S..S..........P.......Q..G..A......gH..G........LS.PAInqvfp..............gwalsqNM..Y..A..I.M.........-...-.RNEFKYEDRAK.RA.K...R..V..R..---IRYRVLRPQIIAMMRAARDELR.....A.aGG.KD.I..Y..TD........RDI.....................................................................AGLG.KNY.M........TE....S....A...RR.......EA.....IEAY...T..HFMCFFAA.REVF..E.R.......ACQS....G.V...-.S...L....DD.IEASL....T.Q..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------saegsyaev.............................................................
G5AEJ0_PHYSP/33-430                  .............................................................................................................................................y-FPLSAAEIRALEA.N.GNTA..DD..WRD.V...R...K.........T...H.........EhapL.Q.....T.........A.........SIRQCSFHGR...VAL..GSFSA.SY.sHD...VDG..I..PF.RCGVYNSALS.NAVV...LD.H.....ALVKD..........T.....-L.......VLK..D..VL........VDARAAVIQCGSVtg.paA.........S.A........G..A..........SACGNGHL......................LHVGVET.GG.RDLRVVADM................P.FSLGAAV..............A..T.Q..R.G..DVE..F.LKTYDAFV.DK.YV.A........EVK.A..P.MA..I..VAQNARVRGCSRVE.G..AFVGDYALVEDS-DIANSTI.LS...TAG...E..P...SVVRMKSIVRDSIVQWNSTVEALSVVEGAFLCDTSHVERHGIVMSSVIGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASVWp..kGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......A..H..I.......I.pS........LS.PAI.........................N-..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------eispgyv...............................................................
A0A024FUA6_9STRA/42-550              ..............................................................................................................................................YYRLTEEEIEDLKQ.K.NNTA..EN..WNQ.I...L...Kl.......sD...A.........K...L.R.....V.........D.........RIQSCSFHGF...VVL..GDFGS.SC..EM...VDG..V..RF.PSGCYNSAIS.HSII...LD.D.....ALIRD..........T.....-I.......LLH..H..TL........LQPKAIVIRCGILgnksdT.........Q.T........T..K..........HTFGNGLR......................INLGAET.GG.RNLTIVADL................T.FELAAIL..............T..E.KggK.E..HDE..L.QKSYTKQT.EE.YM.S........VFD.P..S.VTriI..IGEGAQVLFCSRLE.G..CFIGSRAVVEN-SALYNVTL.LS...NEK...E..P...SSISGNSIVRDSIVQWNSTIESMSFVERCLLCDSCRVERKGIVKDSVLGPNSCIAEGEVTSSLVGPFVGFHH-QSLLIAAIWpqgrGNVAYGAn..iGSNH.TLR---L-PDQELFPGEGMFFGLGVNIKYP.........T..NFiqA..PYSVIA.SGVC.THPQRMEFPFSLI......gA..P..........R.......Q..I..L.......E..G........LS.PALnei..................spgwVL..K.hS..L.F.........T...IlRAQTKFKTRNK.SE.R...M..K..K..-ASTEILYNRADLVSIMKTARERLQ.....H..A-.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------pakltapkhfytnatvpglgsnymteksrvsaintytyfirlcaleallhllelng..............
W4G7Q0_9STRA/38-413                  .............................................................................................................................lvilvgtyvshgavvvg--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........---------CGTI.....T.........C.S........G.tD..........VTNGNGTV......................LKVGVEI.GG.REIAMFADM................P.FHLAAVV..............G..E.T..R.G..NVS..E.LKAYEDLV.RT.YT.K........KVQ.C..DgFN..V..IAHQAKLLRCPKIR.D..VFVGDAAVLEDS-VVSNSTI.LS...SPA...E..V...SSILGFSQVHSSILQWNAHVHSGSSVERSFLCDCSRVERHGVVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..rGRGNVGY....GANVgSNHTLK-APDQELWPGEGVFFGLSVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALI......nT..P..........G.......H..N..I.......P..D........LS.PAInei..................ypgwVL.sH..S..IfT.........V...L.RNQDKFDKRNK.SK.R...T..N..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------vdspifrsdiimmmqvacqrlvdaekkpvnlrhgkqiiytdkq...........................
A0A1M6V3V8_9BACT/41-730              ..............................................................................................................................................FRQLTAYEIETLVR.N.DNTS..DN..WNN.I...F...V.........S...N.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...YRN..L..KL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........LGNEVIVANVNEM.....V.........T.S........D..V..........AKFGNGIVksnep...........enlrieLELCNEN.GG.RAVLPFDGM................L.PGDAYLW..............T..R.N..R.D..DIQ..L.QQQFRTFT.EK.QF.D........KRR.G..Y.YG..M..VGDRTVIKNCRMIK.D..VTIGTDAYLKGANKLKNLTI.KS...TAE...A..R...SQIGEGTEMVNGIVGYGCRIFYGVKAVRFIMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPAHEQHHNNSFLCASMIm.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..QF..A..NFTLISkGNYL.SELNIP-IPFSLVs.....nD..E..........H.......E..N..V.......L..Q........IM.PGYwf.....................lyNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RI.D...K..K..Q..--LIEYDFLAPDSVEEMFTALAIME.....I..AT.AK.A..W..YA.......lPENeprktltdkdlrkk........................................gkelllekpedvsrlTIYA.E-G.M........EN....S....H...RK.......TV.....LTKV...H..KAYPIFRE.LIVL..Y.G.......IKNI....I.A...A.A...K....PS.FVALQ....A.A..IKTA.K..R.T.PWVNVGGQLMKADTV.DGLKQRIRKNRIS.S.WDQLHDAYREIGKE...YAADKLQHAVAS.MLEI..KE.......VP......L..K.N...F.STEHLQQWLVD.S.VATMEW....MAEGIFKSREKDYK.NPF...R-----...--KMTYsNEKEMDIVV.GS.L..ENNSFINATKEELETYKEKV-------rrtiid................................................................
K3WT23_GLOUD/42-573                  ............................................................................................................................................ff--PLSRVEIEQLEA.N.GNTA..ED..WRQ.VfkiT...I.........D...A.........P...V.N.....A.........R.........RIRDCAFQGR...VVL..GRFSD.AFhhDL...EQG..V..KF.PSGCYRTVIR.NAVV...LD.D.....ALVKD..........T.....-L.......LLH..N..VF........VDAEAVILGCGPV.....VfasssatdeV.P........G..T..........DMFGNGTT......................LHVGVEI.GG.RDLRVIADL................P.FALAASI..............A..G.N..R.S..NTA..F.VQAYNQMV.DV.YV.H........EIAcA..P.FT..I..IAKHAHVMRCSRVE.N..SFIGEYAVVDD-SHIEKVTV.LS...SHE...E..P...SMIRTKSVVRNAILQWNCVIETLSVVEDAFLCDYAHVERHGVVMSSLLGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASYWp..qGKGNIGY....GANVgSNHTLK-APDQELFPGEGVFFGLGSNVKFP.........S..NFvhA..PYSVIA.TGVT.TLPQRLAMPFSLI.......N..T..........P.......G..H..V.......I.pS........LS.PAInei..................spgwVL.aH..S..V.F.........T..vL.RNEHKFQTRNQ.SK.R...T..-..-..--HVEPAIFRHEIIQYMKDARAQLH.....A..AQ.GK.A..K..IV........LTIsgepv..........................................................ytdrevLGLG.KNY.M........RE....S....A...RK.......EG.....IAAY...T..FFIQLYAL.DALL..K.L.......VENG....R.V...P.V...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------dsrvgtiscrdene........................................................
A0A517Y361_9BACT/40-540              .............................................................................................................................................l-RPLYKPEVELLEA.L.GNTA..RD..WSR.V...R...V.........A...D.........G...F.N.....P.........R.........RVRGCEFHGD...VTL..GRFTQ.YV..PL...ADG..V..EV.VAGLSNSTVI.DSVI...GH.N.....ALVRD..........V.....-R.......LLA..N..YV........VGEGAVLVDCGRV.....T.........C.S........A..G..........ATFGNGLR......................VPVALEG.GG.REVDLFAEL................D.VELAAGV..............A..R.P..G.N..AGG..Q.LDGYRAAV.AD.YR.A........RAA.S..D.RG..V..IGTGAHVWSVPRLE.D..VYIGPAARIDGAAAIVRSTL.LS...SPD...E..P...TVVESGSVVTDSLVQWGVRVTGQASVERSVLVESARVDRHGKVQNSVVGPNTEVAGGEVSSCLLGPFVGLHH-ESLLISTLWp..gGRGNVGYganvGSNH.TSR----APDQEFWAGEGLFLGLGVNVKFP.........C..DFsqA..PYTVVAcGTDL.VPQKVT-FPFSLV.......A..P..........R.......Q..E..A......fP..D........LA.PAYnqisp..............awmlreNV..Y..A..L.-.........-...R.RCEAKFRARNR.AK.-...R..S..R..---FDFAVFRRDTVELMLAAARMLE.....D..VP.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------vvrpqytdrhipglgknvltdgdrvraveayrffarywallglldrlqttgsgalaevea..........
A0A421FI25_9STRA/203-542             .........................................................................................................................................vaqna--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...--Q...E..R...TVVKTKSVIRDSIVQWNSTVETLSVVEGSFLCDTSHVERHGVVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..kGKGNIGY....GANVgSNHTLK-APDQELFHGEGMFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLMTMPFALI.......N..T..........P.......A..H..V.......I.pS........LS.PAInei..................spgwVL..S..S.sVyT.........V...L.RNDNKFRSRNK.SK.R...-..-..-..-THIEAAIFRPEIVQYMKEARADLE.....A..AE.GK.A..R..IQl......aNGEavyt.............................................................dkqvRGLG.KNY.M........RE....A....S...RR.......AG.....IEAY...T..FFIKLYAL.DALL..P.L.......VEGG....S.V...S.A...D....GT.V----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gnvdrslyelatlseevapeklireclndltsmrtdvvnka.............................
R5X1S2_9BACT/51-581                  .............................................................................................................................................r--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.---I...GT.G.....VRLRN..........V.....-G.......RLS..G..CD........IGAGATVEDTSAV.....E.........A.T........G..R..........SSFGSGIP......................AAAVNEA.GG.REIPLFTGL................T.SQLAYII..............A..M.Y..R.H..RPA..T.VERLLGMA.EReFT.L........PAA.A..S.LC..T..VGPGAHISSCGILR.N..VAIGPDAVVEGASFLSNGTV.AS...HPG...Q..R...TYIGPGVKMRDFIVCGNSIIDNGTVAERCFFGNATRAS-ALTATDSLFFAGSHCDNGEACSVLAGPYTISHHKSTLLIAGMF....SFFNAGS....GTNQ.SNHLLKSGPVHQGIHQRGCKYGSDAYMMLP.........A..LD..G..AFTTVI.GRHK.SHPDTECFPFSLL.......I..E..........Q.......E..G..Y.......S..W........LL.PGS.........................NL..A..T..A.G.........A...A.RDLAKWPQRDR.RD.R...Y..A..G..-DLINFEECNPYIAERITAAIAACE.....E..LL.G-.-..R..ET........GDV.....................................................................CTYR.RLR.I........RT....G....M...LR.......RG.....LRLY...R..LAQEKYLG.AMLA..-.-.......----....-.-...-.-...-....--.---AG....K.A..PDAD.G..T.G.RWADAGGMYIPLRVM.EGILDRIDSEELA.S.TAEVCGALKKAHER...YGEYAAGWALHR.LEEL..LG.......HR......P..T.A...-.--VDIEAAIEA.G.TAAAAK....LAAMAADDMRSEQE.TSM...AIGYGI...DAPDDEgRMADFRAVR.G-.-..---------------------------i.....................................................................
A0A4Y1WT27_9BACT/51-442              .....................................................................................................................................asgvcirns--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......GVR..N..YD........IGAGTLVEEVVRL.....E.........C.R........G..E..........SAFGNGTE......................VAVMNEN.GG.RTVRIYSGL................T.AQIAYMA..............A..V.Y..R.H..RPA..L.VAALDRMA.RR.AA.D........AAR.S..A.QG..S..IGRDCRITDCRLLR.D..VCIGHGATLEGVSVLSNGTV.G-...---...D..F...SRIGIDVKAYDFVTAEHALVDNGSLIERCFIGERCIFDRGYTASDSLFFANSHCENGEAVSIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GTNQ.SNHLFKCGAVHQAVHRRGCKFASGAYVMSP.........A..IE..G..VYTMIM.GRHT.HHHDTSVFPFSYL.......L..E..........Q.......E..G..R.......S..A........LL.PGA.........................NL..S..S..Y.G.........T...V.RDIEKWRQRDK.RS.A...G..R..-..-DLINFETWNPFVGNALAAGLDALR.....T..LY.DS.-..N..PD........AQS.....................................................................FIYN.SVH.I........KL....T....G...LR.......RG.....IQRY...E..QALAATLG.DLLA..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------rg....................................................................
R5X1S2_9BACT/6-57                    ..............................................................................................................................................YRKLTADERGRLQA.Q.GCTA..ED..WDS.I...E...V.........T...T.........D...F.T.....P.........D.........TVRGCGFRGT...VRI..GT---.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gvr...................................................................
A0A4R3VU25_9SPHI/38-723              ..............................................................................................................................................YRHLSTEEKAILIQ.N.HNYS..TD..WNS.V...M...V.........T...D.........T...F.N.....P.........Q.........QIKNSKFYGN...VWI..GNISS.QY..LN...YKD..L..NL.ACGIYNSQII.NSEI...GD.D.....NAIHY..........V.....-R.......YMS..N..YI........TGDEVILMNVNDM.....E.........T.S........P..A..........PKFGNGILkegeq...........edkriwIELCNEN.GG.RPILPFDGM................Q.ATDAYIW..............T..R.N..R.H..DAR..L.QSKFIELT.EK.SF.T........NKA.G..Y.YS..E..IGNQVVIKNCDMIH.D..VIIGDHAYLKGVNKVKNVTI.HS...IES...A..I...TQIGEGCEIVNGIIGYGCRVFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLLFPAHEQHHNNSFLCASLIm.gqSNMAAGAt..iGSNH.NSR----AADGEIIAKRG---------FWPglcvslkhnS..KF..A..SYSLIVkGDFL.YELDIK-IPFSLI......sT..D.........vQ.......N..D..R.......L..I........IV.PGYwf.....................lyNM..Y..A..V.M.........-...-.RNSKKFEARDR.RT.I...K..N..Q..--YLEYDVFAPDTINEMFDSLAIIE.....K.aVG.KS.L..M..PN.......wS-Nsseegrkilmd...............................................knikisqdiflENVE.NSK.R........KV....V....M...LKp.....rES.....YSLF...R..KLIRHYAA.LQIL..N.K.......EEWN....K.L...-.D...M....EE.LLSHI....K.N..YSNS.T..R.K.VFENIGGQLVPKEDL.QGLLDGIKADQFE.N.WHQIHKQYHAWSSN...YLEEKLVHALAS.LAEL..SN.......KP......L..A.L...W.DIDFLTDLIEE.S.KATQRW....IYDEIYKSREKDYT.NPF...R-----...-KMVYE.NEEEMNIVV.GS.L..ADNAFINTMKEETADYLAKADHILNKI......................................................................
A0A067CA14_SAPPC/32-544              ..............................................................................................................................................YAPLTPAQIQRLEA.A.GNRA..ES..WAT.V...H...T.........S...Sp.......sL...A.H.....L.........D.........RIRNCSFRGH...VYF..ETFAK.NT..V-...VEG..V..PF.PSGLYNSTLS.DAFI...AA.D.....ALVHD..........T.....-F.......LLH..G..TY........VASGASVVGCGTI.....T.........V.S........A..A..........PIYGNNNP......................LKVGVEI.GG.REIHAFADL................P.FDLAVTV..............G..Q.N..R.S..DST..E.LAAYAANV.AT.YT.A........AIT.C..A.VN..V..IGADAQVLRCAKLH.D..VFAGDFAVLQDSIVL-NSTV.LS...SNA...E..R...SRITGFSHVTDSILQWHAVVEGGSSVERAFLCEYSHVERHGIVMDSLLGPNTSIAEGEVTSSFLGPFVGFHH-QAMIIASFWp..eGKGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSVKFP.........S..NFthA..PYSVLA.TGVN.TLPQRLEMPFALV......nL..P..........G.......H..N..I.......P..A........LS.PAVnei..................fpgwVL..G..S.sIfT.........V...L.RNMDKFEKRNR.AT.R...-..-..-..-TIIEHEIFRPEIVRMMQVALERLA.....S..PK.DT.S..L..TL........GTQ.....................................................................KIYT.DKQ.VpglgknymTE....A....S...RV.......AG.....IRAY...T..FFIRFYAL.NGFY..T.A.......LRT-....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtqplesllaaspssar.....................................................
A0A484DYX9_BRELC/38-289              .............................................................................................................................................f-YPLSDSEVRALIA.N.GNSA..DD..WSN.V...R..kV.........D...A.........Hm.pL.E.....T.........S.........RVHQNSFHSR...VVF..GQFSN.SF..QH..dVDG..I..PF.PCGVYNSTLS.NVVV...LD.N.....ALVKD..........T.....-Q.......VLR..N..VL........VAARASVIQCGSV.....T.........G.P........K..Ek.......rmVSCSNGNL......................IHVGVEL.GG.RDLRILADL................P.FALGSAV..............V..T.T..R.E..NIE..F.LKAYDSFV.EK.YV.A........AVQ.A..P.MA..I..IASNARVRGCFRVH.E..TFVGDYAIVEDS-NVANSTI.LS...TKA...E..P...SFIQMKCIVPDQEFYHGEGV--------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ffglgcnvkf............................................................
A0A415DIP2_9BACT/4-658               .............................................................................................................................................t-RKLQAEEIARLQA.N.GCSA..EN..WED.V...I...V.........A...S.........S...F.N.....P.........E.........YILSTRFSGK...IVL..GCFEK.IF..TF...AGG..V..KK.HSGIRNATLH.NCRI...GD.N.....VLIED..........V.....HN.......YIA..N..YR........IDDECVIQNINVM.....L.........V.E........G..E..........SAFGNNVA......................VSVLNET.GG.REVPVYDEL................S.ASLAYVI..............A..L.Y..R.H..RPL..L.IERLQELI.AG.YA.Q........RVT.S..T.QG..Y..IGRNVRIINTGTIR.N..VCIGDYVTVENSTRLENGTI.NS...NEK...A..P...VYIGDSVIAEDFIISSGAVVADAAKIIRCFIGQACHVTHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RI..G..AFSLVM.GRHH.HHSDTSDMPFSYL.......I..E..........R.......D..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPRRDK.RT.D...P..V..H..LDRINYNLLSPYTIYKMMKASDILK.....E..LQ.VL.V..G..ET........SEI.....................................................................YYYQ.NTR.I........KG....S....S...LR.......TA.....LSLY...G..MAINKFLG.NSLI..K.R.......LEGT....A.F...R.T...I....EE.VWEQL....Q.P..TSAE.G..K.G.EWLDLSGLILPKNEL.DSLIEKIETGQIT.S.LSAIEEFFASMHHR...YYDMEWTWAYDK.IQEY..YQ.......VD......L..A.A...I.SAEKIIELVRC.W.QDSVIG....LDELLYEDAKKEFS.LTS...MTGFGV...DGSAKE.KQKDFEGVR.GI.F..ESNPFVTAVKEHIVVKRALGDELISRM......................................................................
A0A4P7DWV4_9SPHI/42-717              ..............................................................................................................................................YRNLTEEEIQILES.N.SNES..TN..WND.V...L...V.........T...D.........K...F.L.....P.........R.........QIKRSKFYGL...VRI..GDMEE.VY..LE...YRD..I..RL.AVGIYNSQVI.SCDI...GD.C.....VVLHQ..........V.....-R.......YIA..H..YI........VGNEVILLNVNEM.....E.........T.S........S..N..........AKFGNGILkegdq...........dysriyLELCNEN.GG.RSVLPFDGM................Q.AADVYLW..............T..R.N..R.Q..DKK..L.QQRFWDIT.NN.GF.D........TTR.G..Y.YS..E..IGDRTVIKNSHTIK.N..VKIGSDAYIKGISKLKNLTV.NS...TAE...A..Y...TQIGEGCELVNGIIGYGCRVFYGVKAVRFILSSYSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALIk.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..S..SYTLIVkGDFL.HELDIK-IPFSLIs.....nD..T..........A.......N..D..R.......L..V........II.PGYwf.....................myNM..Y..A..L.M.........-...-.RNTNKFISRDK.RS.F...K..N..Q..--YFEYDILAPDTVNELFTSLKEIE.....I.aVG.HS.I..N..ST........DAIswlege.........................................................gdskveITLQ.NAE.F........SK....Rk..vV...LMk....prES.....YKLF...R..KLIRYYAV.CQIL..D.Q.......VEPE....Y.F...-.-...-....EA.FCASI....S.-..DLEV.K..R.E.EFENIGSQLMPVSKL.DALLGDIKEERLD.T.WTDIHHRYHEISAD...YLKDKLIHAVAS.LQEV..TA.......IS......A..S.K...W.DRGFWEDVLDE.A.LETKTW....ICEEIYKSRSKDYS.NPF...R-----...-LMVYE.NEEEMNEVV.GR.L..EDNSFINQQTAELERFKAAVDGI----ravi..................................................................
A0A5B8UFP9_9BACT/39-726              ..............................................................................................................................................YRNLSAYEIEVLVR.N.RNTS..DD..WNK.I...Q...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLES.IA..LE...YHN..I..VL.PVGLYDSTII.SCDF...GD.N.....VVVNN..........V.....-N.......YIS..H..YI........VGNEVMIANVNEL.....H.........A.T........D..H..........SKFGNGIIkeget...........edvriwLEVCNEN.GG.RKILPFNGM................Q.PGDAYLW..............S..K.Y..R.N..DEA..L.MERFKEFT.ER.KF.D........KQR.G..Y.YG..K..IGDNCVIKNTAIIK.D..VWVGPHAYIKGANKLKNLTI.NS...SAE...A..P...SQIGEGCELVNGIVGFGCRIFYGVKAVRFFMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPSHEQHHNNSFLIAATVm.gqSNIAAGAt..lGSNH.NSR----AADGEMVTARG---------FWPglcvslkhnS..KF..A..SFTLVAkGDYP.AELNIP-LPFSLI.......S..Nd........vT.......N..N..R.......L..V........VM.PAYwf.....................myNY..Y..A..L.A.........-...-.RNSAKYVDRDK.RT.K...K..I..Q..--HIEYDYLAPDSVNETFDALRLLQ.....K.tVA.RA.A..G..KK........GDEtvlinegeallng..........................................tdvdfkntavyadgFEGS.SRL.V........QI....V....K...VR.......EA.....YFIY...K..ELIVYYGI.EQVV..S.F.......VNRH....S.I...S.S...F....EE.MLQAL....P.S..S--P.Q..R.F.AFLNVGGQLLPERSV.QTLLEQIKRDEIK.S.WNEVHRFYQQNGKA...YAEQKLQHAFAS.LLEI..LK.......IG......K..M.E...F.TPERFASLLKQ.A.LQTKRW....MVDQIYDSRAKDYN.SEF...R-----...-RMVYD.DEAEMAKVV.GT.L..EDNVFINQQREELRLFSETVQEIAER-f.....................................................................
W2Z3V0_PHYPR/38-554                  .............................................................................................................................................f-YSLSDGEIRALEA.N.GNCA..ES..WNN.V...YktyA.........H...T.........P...L.Q.....T.........S.........RIRQCSFHGK...VVL..GRFST.FN..HN...VDG..I..PF.PCGVYNSALS.NVVV...LD.D.....SLVRD..........T.....-L.......VLR..D..VL........VDTQASVIKCGSV.....T.........GpE........E..D..........AVSANGNL......................LHVGVET.GG.RNLRVVADL................P.FALGAAV..............A..T.R..R.G..DHD..F.LKTYETFV.DN.YV.A........ALK.A..P.MA..I..VAKNARVRGCSRVQ.G..TFVGGYAVVEDSD-VVNSTL.LS...TQD...E..P...SVIRAKSIVRDSIVQWNSTVEALSVVEGSFLCDTSHVERHGVVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......G..H..S.......I.pS........LS.PAInei..................spgwVL..A..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEAAILRPEIIQYMKNARAELI.....A..AE.GK.A..K..INl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......AG.....ITAY...T..FFIKLYAL.DELL..Q.L.......VESG....H.V...S.A...D....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtvgsvdssh............................................................
A0A2T8HM90_9SPHI/43-718              ..............................................................................................................................................FRHITTEEIDQLIA.H.GNES..SN..WND.V...L...V.........S...K........aG...F.I.....P.........D.........QIRHSKFHGL...VRI..GKMDE.IY..VE...YRD..L..RL.ASGIYHSQII.SSDI...GD.Y.....CAIHH..........V.....-R.......YMA..H..YI........VGKEVILTNIDEM.....E.........T.S........S..N..........AKFGNGVLkdgdd...........pesriyLELCNEN.GG.RSVLPFNGM................Q.AGDVYLW..............T..R.H..R.E..DAD..F.QRRLHEIT.DL.QF.S........SKR.G..Y.YS..M..IGERTVIKNCHTIK.N..VQIGSDAYIKGVNKIKNVTV.NS...ISS...A..Y...TQIGEGCELVNGIVGYGCRIFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLLFPAHEQHHNNSFLCASLIm.gqSNMAAGAt..vGSNH.NSR----AADGELMAGRG---------FWPglcvslkhnS..RF..A..SYSLIVkGDFL.HELDIR-IPFSLI.......S..Nd........vH.......Q..D..R.......L..V........II.PGYwf.....................myNM..Y..A..L.M.........-...-.RNTSKFTARDN.RK.L...K..N..Q..--HFEYDVIAPDTVNEMFNTFSEIE.....N..AV.SL.L..G..DE........ALRalkdpaad....................................................fqyevlltnV---.ENS.R........RK....V....V...LKk....pkEV.....YHLF...Q..RLIRYYAA.TQIL..S.F.......IETN....T.L...-.-...-....ED.FWQLL....Q.S..-EPL.Q..R.K.AFTNVGSQLIPDQDL.QSLISDIKTGALN.S.WLEIHQRYHQLSST...YLTEKLLHSIAS.LQEL..SA.......LS......A..A.T...W.DALFVQQLMEE.S.LETKRW....IRGEIERTRAKDYE.SDF...R-----...--KMLYnSDEEMEAVV.GK.L..SDNSFILSQNKEMVEFESRIKNLLD--vl....................................................................
C5K8Q3_PERM5/204-390                 .............................................................................................................................................l-RPLTVEEIEGLEA.S.GCSS..ED..WQE.V...M...Vi.......gE...E.........P...L.A.....V.........K.........MIRNCTFQGR...VEI..GVVEG.SK..VTlsdYNR..H..QL.PCGITNSVLQ.DVVV...EA.G.....TLIKD..........C.....-G.......LVA..S..TV........VRKGAALIRCGVI.....Eg......psQ.S........D..C..........CRYGNGHT......................LPLAEET.GS.RETRQFAEL................S.IEIAAKV..............A..S.-..-.-..DRK..L.ADGYHRAV.ND.YV.A........AV-.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------eacgkgrtiveena........................................................
A0A1I2GSI9_9BACT/6-660               ..............................................................................................................................................YRKLTQAEIQQLEI.N.NSSA..DN..WDN.I...Q...V.........K...D.........G...F.D.....T.........K.........RVYACHFSGE...NRI..GVLAG.SM..TF...FGQ..L..ER.PCGLYHAHFH.NCTI...GD.D.....VYINQ..........V.....KN.......YIA..N..YD........IEDHVLIDNIDLC.....A.........V.D........G..E..........SSFGNGIE......................ISVLDET.GG.RKVMMYDKL................S.AHMAYIM..............A..F.Y..K.H..RTV..F.IERIEQMI.LH.YT.Q........GVC.S..A.RG..F..IGHHAKITNCREIK.N..VRIGAHTLVDGSSQIENGTI.NS...NEH...A..P...VRIGHDVILKNFIVSSGAVVTGAALVANCFVGQGCVLGSQYSAENSLFFANCQGFHGEACAVFAGPYTVTHHKSTLLIAGMF....SFCNAGS....GSNQ.SNHMYKLGPIHHGIVERGSKTTSDSYLLWP.........A..KI..G..AFTLVM.GRHY.KNSDTSDMPFSYL.......L..E..........N.......D..D..E.......S..W........LA.PAI.........................NL..K..S..V.G.........T...I.RDVLKWPRRDK.RT.D...P..H..K..MDCVNFNLLSPFTIQKMGNAIHKLK.....E..IK.AI.S..G..ET........TAV.....................................................................FSYN.NTK.I........ER....H....A...LN.......RG.....LKLY...H..LAIMKFIG.NSII..T.R.......LNTC....S.L...N.T...A....ND.VKACL....Q.P..DSQI.G..Q.G.DWIDLAGLIAPKHAI.VELLNQVEQGDIQ.E.LQQVEDCFYSLHDN...YYNYEWNWTANF.AATY..FN.......KP......L..T.S...M.SIEEIIQIIEE.W.RKSVVA....IDKMLYEDAKKEFR.LEA...MTGFGM...DGDHKT.KQLDFESVR.GK.F..ESNDFVKEILTHIERKTALGERVIKQL......................................................................
A0A098C0E4_9BACT/4-658               .............................................................................................................................................e-RSLTDQEIDLLKS.Q.NCEC..DD..WTL.V...T...V.........A...P.........G...F.N.....P.........H.........FVKNTRFSGK...IRI..GLLDE.EF..EL...AGG..L..RK.HACINNAVIH.NCEI...GN.N.....VVIEN..........I.....QN.......YIA..N..YV........IGDNCFIQNVDVI.....L.........V.D........G..M..........TTFGNGTE......................VNVLNES.GG.REVHIHDKL................S.AHFAYVY..............S..L.Y..R.H..RPN..L.IRRMRAMV.DF.YA.R........KHA.S..E.MG..Y..IGDHAMIVNVGYIK.N..VKIGSYSKITGAMKLKNGSI.NS...NGQ...A..S...VYVGRNVIAEDFIISSGSRVDGGSIISRCFIGQACHLDHGYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIIERGAKTTSNSYVLWP.........A..KV..G..PFSLIL.GRHY.QHSDTSNLPFSYL.......V..E..........N.......N..N..A.......T..H........LA.PAI.........................NL..R..S..V.G.........T...I.RDAKKWPERDK.RR.D...P..N..K..LDYINFNLLSPYTIQKVFAGVEILK.....N..LQ.AT.A..G..ET........SEI.....................................................................YTYQ.SCI.I........KN....A....A...LR.......RG.....LELY...E..IVIHKFLG.NSLI..K.R.......LEKT....G.F...T.S...N....VE.IRERL....K.P..DTPI.G..T.G.EWVDISGLIAPKSEI.DKLLCRIENGEIT.R.LKEINKVFKELHEQ...YYTLEWTWAWEK.IQEF..YN.......VT......P..E.S...I.TAGEIIEIVEK.W.KAAVVK....LDEMIYNDAKKEFS.LSF...KTGFGS...DGDIQD.QAMDFEYVR.GA.F..DKNPFVVATLRHIEDKKALGNELIERI......................................................................
A0A0C1IGG8_9BACT/42-731              ..............................................................................................................................................YRHLSAYEIEVLVR.N.RNQS..DD..WNK.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.YC..LE...FNN..L..RM.PVGLYNSTII.SSDF...GN.N.....VVVDN..........V.....-N.......YLS..H..YI........IGNEVMLVNINEL.....A.........T.T........N..H..........SKFGNGIIkeged...........ekvriwLEVCNEN.GG.RRILPFDGM................L.PGDAYLW..............S..R.Y..R.D..DIA..L.QKKFVEFT.DR.RY.D........ELR.G..Y.YG..M..IGDRTVIKNSRILK.D..VQIGEDAYIKGANKIKNVTI.NS...SSD...A..H...TQVGEGCELVNGIIGVGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIYPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----SADGELIAGRG---------FWPglcvslkhnS..RF..A..SFTILAkGDYP.AELNIE-LPFSLV.......S..Nd........vS.......K..D..E.......L..H........VM.PAYwf.....................qyNM..Y..A..L.A.........-...-.RNSWKYVDRDN.RI.D...K..A..Q..--QIEYEYLAPDTANEILKGIAILE.....K..IT.GE.A..F..YR........KEGkpvseavarkkgkvll.....................................rqqdpviegleirlenA--E.NSQ.R........PV....V....V...LKa.....aMA.....YRWY...V..DLLEYYAA.REIL..A.F.......CERF....P.D...L.N...L....SR.IARKL....P.E..A--A.K..P.R.EWDNIGGQLMEKDTV.RAILQQIKKGQLR.S.WKELHNIYRSQSSL...YADQKLAHALSI.YKST..SG.......VN......L..S.S...-.DIKAVRQLLEK.S.VTFRKE....LADRIHESRAKDYQ.NPF...R-----...--AMVYgSDDELIKVV.GD.L..RSNTFIQENQKAFRKYQKQVTALLE--d.....................................................................
A0A1M5G7Q5_9BACE/4-658               ..............................................................................................................................................YRMLTEDEVLQLKS.Q.SCLA..DD..WNN.V...L...V.........S...S.........D...F.N.....T.........A.........YVHHTRFSGN...VKL..GSFDG.EF..TL...KGG..I..KK.HAGLRHVTLH.NVTV...GD.C.....CCIEN..........I.....QN.......YIA..N..YE........IGDHTFIENVDII.....L.........V.D........G..L..........SKFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRIKEIT.DF.YS.N........KHA.S..D.KG..A..IGSHVMIVNTGSIK.N..VRIGDYCYIEGTCRLKNGSI.NS...NAD...A..P...VHIGYGVICEDFIISSGSHVDDGTMLSRCFVGQACQLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......G..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..K..LDYINYNLLSPYTIQKMFKGREILK.....E..LK.RV.S..G..ET........SEI.....................................................................YSFQ.SAK.I........KN....S....S...LN.......KG.....IGFY...E..IAIQKFLG.NSII..K.R.......LEGV....D.F...K.S...C....EE.IRARL....K.P..DTEI.G..L.G.EWVDVSGLIAPKSEV.DKLLDGIENGDIN.R.LDEMNTSFETMHQN...YYTYEWTWAYNK.IQEF..YK.......LN......S..D.E...I.TVQDIINIVNQ.W.KEAVIG....LDKMVYADAKKEFS.LSS...MTGFGA...DGSREE.KEQDFEQVR.GV.F..ESNPFVTAVLKHIDDKTVLGNELINRI......................................................................
A0A1H9EX99_9SPIO/27-726              .............................................................................................................................................k-RHLTASEIEVLEK.N.LNHN..EDpsWNN.V...Y...V.........D...D.........SddgF.D.....P.........S.........LIHLSFFAGF...IVL..GKIKR.IV..LK...YND..L..RL.ECGIQRSKLS.NVVT...GE.L.....CVIRN..........V.....-F.......YLD..N..YR........LGDRVILFNINEM.....S.........C.T........N..H..........AKFGNGILkegep...........eehriwIGVANEN.EG.RKVLPFEDM................I.PGDAYLW..............S..H.Y..R.D..DEE..L.LKRFVELT.EY.GV.S........HEL.N..T.FG..T..VGNDAVIKNVSIIK.D..SKIGPAAYIKGAFKLKNITV.LS...SEE...E..H...SQIGEGVEMVNGIMGYGCKVFYQAIAVRFVLGRNCQVKYGARVLNSVLGDNSTVSCCEILNNLIYPFHEQHHNSSFLIATTVm.gqSNIAAGAt..iGSNH.NSR----SPDGEIFAKRGFWPGLCSDFKHN.........S..RF..A..SFVLVSkGSYQ.YELDIP-YPFALVa....pgS..N..........G.......S..S..K.......I..T........II.PAWwf.....................myDM..F..A..I.T.........-...-.RNKDKFTKRDK.RV.K...R..I..Q..--FIETDPLAPDTMQEVMNALERII.....G..LT.IG.Y..L..KS........TNNeyiegkltpeeqyqaakd.................................flhqnpdaeftvedsicqKK--.---.Y........GA....E....I...VKp.....aQA.....YKTY...R..KVVKYFAT.RTLM..S.F.......CQDL....N.Q...E.K..lT....FE.LVEGI....R.R..--LP.L..F.T.EWENVGGQIIPSDKI.QELFASIKNGTVK.N.WADVHEFYKLCECS...YEQWKVRYALYL.LEKL..YS.......RP......I..E.E...F.SVDLYRNITDD.V.SIVAYD....IYNASLRSREKDYT.DYY...R-----...--NMVYrSEKEMDEVI.GP.L..EDNSFLLKLRNDTAEFTSKIKEI----fvgl..................................................................
R6EW46_9BACT/3-614                   ..............................................................................................................................................YRKLTENEISTLQA.N.SCWA..ED..WQR.I...E...V.........S...E.........D...F.E.....P.........R.........FFHRVMFYGD...IRL..GAFTD.NV..EV...SRG..F..MK.HSGVNNATLR.NVTI...GN.N.....CLIEN..........I.....SG.......YIN..N..YT........IGDDCIISNVCTM.....E.........T.T........D..G..........ATYGEGNL......................ISVLNEM.GE.GNLILFHGL................T.SQVAALM..............V..K.H..F.H..NRP..L.KDTIRRLI.RE.EI.E........RTA.P..D.MA..A..IGNRVKIVNTKEIT.N..TVIYDDCEIAGAAQLSDCTL.MS...NSN...A..S...VYIGTGVICENSIIGDGSSIINSVKMQDCFVGEACKLSNGFTAAGSVFFANSYMANGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGTLERGSKTASGAYILMP.........A..HI..G..AFSVCF.GKLM.YHPDTRSLPFSYL.......I..A..........Y.......N..D..T.......M..Y........LV.PGR.........................NL..T..T..V.G.........L...Y.RDIRKWPKRDM.RP.A...G..T..R..KSIVNFDWLSPFTVGEILRGKKILE.....D..LR.DA.S..G..ED........VST.....................................................................YNYH.EYV.I........KN....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.-.......----....-.-...-.-...-....--.-HAPV....E.P..TTTV.G..T.G.PWTDLSGLLLPVSEE.QRLVDDILSGEID.T.TEGIAERFEEINAN...YSEYRWAWSYQM.IMDY..YG.......F-......-..A.E...L.NEENVERVKRD.Y.VTARRA....WIAEIKKDAAKEYR.LGD...------...------.---------.--.-..---------------------------veeevfnnfneqldkevdfenqk...............................................
A0A521CSE9_9BACT/3-650               ..............................................................................................................................................YRNLREEEIVLLKK.Q.NCRS..LD.gWDK.I...Q...V.........T...D.........N...F.I.....A.........S.........NIKDVVFSGI...NCL..GLFTE.RI..NL...PSG..V..SD.MAGIYNAHIH.NCIV...ND.Q.....CFIKN..........I.....GT.......SVS..N..YF........VGEGAIIQNVATL.....I.........V.E........G..E..........SSFGNGIE......................VAAINEG.GG.REVLMYDEL................S.VHTAYMM..............A..F.Y..R.Y..RPK..L.ITSLQQSI.RS.YV.N........RVS.S..S.QG..R..IGEKAVLVNCGNLK.N..IIVGNSAHLSGVTLLNNGSV.NS...SAE...A..P...VYIGEGVNAQNFIVSSGSRVSDGVYLRQCFVGQGCEISNSFTADNSLFFSNSQCLQGEACSIFAGPYTVTHHKSTLLIAGYY....SFFNAGS....GTNQ.SNHMYKLGPVHQGTIERGGRTGSNAYVLWP.........A..QI..G..AFTMLL.GNHY.SNTDTTSLPFSYL.......I..E..........D.......N..G..K.......S..V........LI.PGQ.........................NL..F..N..V.G.........T...V.RDVKKWPNRDN.RK.G...T..H..R..LDYLVKDALNPYTIDKITEGIRVLE.....E..LR.QK.V..K..AE........ARH.....................................................................IMYK.NIQ.M........SP....S....S...IQ.......RG.....IKLY...E..QALIKYVG.DVLV..E.L.......LERD....D.F...L.S...K....R-.-----....-.A..DFSP.D..N.H.VWLDVAGLIVNSASL.ENWMGAVEGNKI-.E.INQWNSFFKSEAEA...YPSLKQAHALQI.LQSY..FS.......ID......I..A.S...C.GSTEIINFLER.W.IDSNNK....IKSAILLDAKKEFN.VKS...KTGYGR...DGEHIM.KDIDFEAIR.GT.M..SANSFVQEIELEYEKDNQKARQLIARL......................................................................
A0A1Y4ALV1_9BACT/54-576              ........................................................................................................................................ariyrs--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......RVR..N..YD........IGERSLVADVTAL.....E.........C.R........H..A..........SPFGNGVP......................VATMNEG.GG.RTVKIFTAL................S.AQTAYLA..............A..L.Y..R.H..RPQ..L.VAALERMA.AE.EA.G........RVR.S..E.FG..R..IGSDCRITACRLLR.E..VLTGDRVELDGVSLLENGTL.CD...GAR...-..-...--AGIDVKARDFIAAEQAQLDNGVIVERCFIGECCRLDKGYSATDALFFACSHCENGEAASIFAGPFTVSHHRSSLLIAGMF....SFFNAGS....GTNQ.SNHLFKSGAVHQAVHLRGCKFASDAYVMSP.........A..LE..G..AFTMVM.GHHT.HHHDTSDFPFSYL.......I..E..........K.......E..G..R.......S..V........LM.PGA.........................NL..A..S..Y.G.........T...V.RDIEKWPTRDH.RT.R...R..R..-..-DVVNFEAFNPYLTQAMLHAVDTLH.....T..LS.DE.-..E..PD........APF.....................................................................YNYR.KTV.I........RQ....T....A...LR.......RG.....IALY...N..KAIAASLG.AMLE..-.-.......----....-.-...R.G...E....AP.LEASL....G.E..P---.-..-.A.HWLDVAGAYITRSEV.EALCDAIERGELT.S.PDLIDERFRSFARR...YDDHARRWALSI.YARL..LG.......HL......P..S.Q...-.--EEVDEAVRG.G.AHARRA....LREMTDADRARDCS.PDK...AVGYGL...DGGEEE.RLLDYRAVR.G-.-..---------------------------l.....................................................................
A0A562T5Z7_CHIJA/42-736              ..............................................................................................................................................YRKLNAQEIEILVR.N.DNTS..DD..WNC.I...F...V.........A...E.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........A.....-N.......FLS..H..YI........IGNEVIIANVNEM.....A.........T.T........D..H..........SKFGNGIIkdgeq...........eniriwLELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.N..R.D..DAA..L.QQQFKAFT.EK.QF.D........KKR.G..Y.YG..M..VGDRSVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...MAG...A..A...SQIGEGCELVNGIIGYGCRVFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEVIAGRG---------FWPglcvslkhnS..KF..A..CFTLIAkGNYM.QELNIP-VPFSLVl.....nS..E..........H.......D..N..T.......L..K........IM.PGYwf.....................lhNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEMIASMPLME.....T..AV.AK.A..W..YA........LQPgqkpempgepalqkkgrq.................................lllqepeavarltvlatdMENS.QRK.V........QL....L....K...VD.......KA.....YPLF...R..ELVVLYGI.RNLL..T.H.......MDAS....G.I...N.S...F....AS.LQAF-....-.-..ARTA.K..R.G.PWINVGGQLMKATTV.EELKTRIKKGRIN.S.WPQMHEAYVQIGEQ...YTADKLQHAVAS.MLHI..QG.......IT......A..K.E...L.TPAVFKHNLQQ.S.VYTLGW....LTESIYRSREKDYQ.NPY...R-----...-KMAYE.NEAEMEAVV.GK.L..ADNGFIQETITELKAYKRKVKELLKK-w.....................................................................
A0A2U0ZDG2_9BACT/44-738              ..............................................................................................................................................YRRLTAYEIEILVR.N.GNTS..DD..WNS.I...L...V.........S...E.........A...F.N.....P.........Q.........LVKHCKFYGL...VRI..GKLEP.YC..LE...FSD..L..KV.PVGLYNSTII.SCDL...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........IGNEVIIVNVNEL.....T.........A.T........D..H..........AKFGNGIIkdgeq...........esiriwMEICNEN.GG.RSVIPFNGM................L.PGDAYMW..............S..K.Y..R.D..DDA..L.LQQFKNFT.EQ.QF.T........KQR.G..F.YG..K..IGDRTVIKNSSIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GPE...G..K...SQIGEGCEIVNGIIGYGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGSNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNIAAGAt..iGSNH.NSR----SPDGELIAGRG---------FWPglcvslkhnS..RF..A..SFTILAkGNYN.AELNVP-LPFSLVs.....nN..E..........T.......L..N..Q.......L..T........IM.PAYwl.....................myNM..Y..A..L.A.........-...-.RNAWKYGDRDK.RT.D...K..T..Q..--YLEYDYLAPDSINELFTSVELLE.....K..WV.GK.A..W..FL........KEKsgksipaaatciskgke..................................llqagdpvisdleivadgI--E.NAK.R........KT....-....V...ITk....aaKA.....WQIY...K..ELIAYYGV.QQLL..Q.F.......IKER....K.T...N.S...L....AE.FKSAL....P.S..VPP-.-..R.G.EWLNIGGQLMPAEEV.QLLKEKIKDNRIK.S.WDGIHAFYAEAGNK...YPQQKLKHALAC.LSEL..LE.......IN......I..K.K...A.DSSLFDTLLEN.A.VATKEW....MTQGIYDSRAKDYQ.SSF...R-----...--KMVYgNKAEMEKVV.GK.L..EENSFIQQQQQELAALKRQVKS-----vkkal.................................................................
A0A448YYF7_9STRA/205-674             vsnthfdgfvvldlttkiddedgsmgetntatsewsxlppglhsnacvsesivalrscrvyrnlfvsrtfvgsetvlannghvsasvggedgfgtiaitvgaesgggrsllltaestmhdvarqlgsadhhqeprdpssass--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........--P.F..A.FN..V..VSHGSMIRDTPTVR.N..VFLHPFSSIESACSVVDSTL.FG...H--...-..-...SKIGNASVASNVLMQWNATIXDNSRISNVLMMEHSHCGPSSILESTIMGPDSHASAGEIHASVFGPNTNAHHQS-LLVGVLWpmgrGNVAYGAn..vGSNH.TGR----LPDQECTAGEGIFWGLSCVVKLP.........V..DLsqA..PYSIVAaGTTL.PPQRIT-MPFSLV.......V..E..........SstfssssR..S..R.......N..D........IV.PGW.........................VL..Q..HspY.T.........L...V.RNDKKYATR--.RK.A...T..R..H..ADYTGWKILRPDTVERCRHARKLLR.....K..TQ.LP.T..D..HEhy...iplQSV.....................................................................SGVG.ACA.L........TE....R....A...RD.......GG.....IKAY...D..NCIQLYAL.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------egllawcsnafggds.......................................................
A0A4Q8RTZ7_9BACT/4-658               .............................................................................................................................................h-RHLSPNEIELLKQ.Q.GCSS..TD..WNN.I...L...V.........A...D.........A...F.D.....A.........K.........TLKFVTFSGN...IKL..GAFSR.KF..LF...PGG..V..EK.SAGISYATIH.NCTI...ED.D.....VYINQ..........V.....KN.......HIA..N..YH........IHSNVVIENVDSI.....T.........T.E........S..E..........SYFGNGLR......................VAALNEA.GG.REITIYNDL................S.AHMAYLM..............S..L.Y..R.H..RPV..M.IEKLQTMV.DN.YA.K........SIC.S..P.IG..K..IEPYAKLINCRTLI.D..VNIGPHAAIEGVYRLKNGSI.NS...SKE...H..P...SYFGPGVIAENFICTSGATITDATLVSKCFIGQGCELGKHYSAENSVFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYF....SFLNAGS....GSNQ.SNHMYKLGPIHQGVLERGSKTTSDSYLLWP.........A..KI..G..AFSLVM.GRHY.RNPDTSILPFSYL.......I..E..........K.......K..D..E.......S..Y........LA.PGV.........................NL..Q..S..V.G.........T...I.RDARKWPKRDK.RK.D...F..K..Q..LDYINFNLLSPFTIQKMLDGKNLLE.....K..MQ.KT.S..G..IT........SEY.....................................................................YMYN.SVK.I........TN....S....S...LQ.......RG.....IKLY...N..LGIIKFLG.NALI..K.K.......LEDI....I.F...V.D...S....EH.LRRSL....L.P..VSPF.G..Q.G.EWIDLAGMLLPKERV.LTLLDDIECEKIA.N.LEQINEEFKMLHIQ...YFDFAWTWCTHV.LRDE..FH.......LD......V..E.T...V.KVDQLLSFIDK.W.KEKVIE....LDHMLYADAHKEFT.LKS...QTGFGI...DGSEET.RHLDFEQVR.GE.F..ESHPSVQDIQRHIKEKSELARELKERL......................................................................
A0A6F9ZGS1_9BACT/4-658               ..............................................................................................................................................YRSLTQEEIQQLKE.R.SCTA..VN..WAD.I...E...V.........V...E.........N...F.K.....T.........D.........YIYHTRFSGK...VRL..GVFED.EF..TL...AGG..M..CK.HSGLYHATLH.NVTV...GD.N.....CCIEN..........I.....KN.......YIA..N..YI........IGDYTFIENVDII.....L.........V.D........G..R..........SKFGNGVE......................VAVLNET.GG.REVPIHDRL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ICRMKAII.DR.YA.E........ENA.S..D.TG..T..IGHHVTIVDAGYIK.N..VRIGDYCKIEGAGRLKNGSL.NS...NEQ...A..P...VHIGYGVVCDDFIISSGSSVEDGTMLTRCFIGQACHLGHNYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGAMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDQINYNLLSPYTIQKMMKGRSILK.....E..LR.KV.S..G..ET........SET.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..TAIHKFLG.NSLI..K.R.......LEEI....R.F...K.S...D....EE.IRARL....M.P..DTEI.G..T.G.EWVDISGLIAPKSEI.ERLMADIECGMLT.N.VDQIHDRFVEMHRN...YYTYEWTWAYGK.MLEF..YH.......LR......P..D.E...M.TAKDVIAIVKK.W.QEAVVG....LDKMVYADAKKEFS.LSA...MTGFGA...DGSREE.MEQDFEQVR.GV.F..ESNPFVTAVLQHIEVKTALGNELIERI......................................................................
A0A482SK99_9ARCH/195-515             ............................................................................................................................................ad---LSPEQITKLES.Q.GNRS..PN..WAA.I...K...L.........T...G.........T...V.NsydlsL.........E.........RIRNCYFGGS...AFI..GVFVK.NV..SM...EHN..V..SL.PSGLYNSNFMgTCIF...SD.N.....SYVNN..........C.....-S.......AIS..N..VF........LGRNSCLVGCGTV.....V.........C.E........G..S..........TSYGTTQS......................ICVGSEG.KNaSEVQLNV--................T.ASYGEVC..............AqvI.M..G.S..KRK..E.D-DKNKKS.NR.SD.D........YIR.F..D.MS..I..ICDEVEVKQCDVIR.N..VFVGSYSKITS-SGVNNCTI.LT...H--...-..-...CVISHSLV-ADCVMHNNTSITTQSQAEGVLLFSQAHIAQSAKVQHSVLGPDSSVSVGECKKSLVGPM-VGFHHQSLLIATVWpmgrGNLAYGSm..vGANH.T-----------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gmfclsi...............................................................
A0A3N2MVP5_9BACT/3-648               ..............................................................................................................................................YRNLLEYEIAQLEA.S.GCTA..TN..WNT.V...S...V.........K...D.........G...F.N.....P.........S.........CYIRVNFSGN...VKL..GNTRD.LF..-V...RNG..V..PV.RSGIYDATIH.NCEI...GD.N.....VHISK..........I.....GE.......AIA..N..YR........IGDNCYIANVNAM.....F.........A.T........G..A..........SSFGNGCE......................VNVMSET.GS.RSLYIYEGL................T.SQIAYLT..............A..M.Y..R.H..NEA..F.TTRIKALA.KE.YS.D........RQR.C..A.TG..L..IESNVTIAGCGTIS.D..TIVRTGACIEGATHLFDGTV.GR...D--...-..-...CKVGDNVIASHFIMASQARVDSGSTIERVFVGQASSLANGFIAHDSLFFANCACECGEACAVFAGPHTVSMHKSTLLIGGMF....SFFNAGS....GTNE.SNHLYKLGPVHHGIMERGCKTASNAYITWP.........A..HI..G..PFTLVA.GSHT.SHPDTTELPYSYL.......M..E..........R.......K..G..K.......S..L........LI.PAA.........................NL..K..T..S.G.........T...I.RDILKWGKRDR.RSrD...I..E..R..LDLINYDALNPLITWRVYQAINTLD.....R..CE.--.-..-..VD........PEY.....................................................................PLTR.NFT.I........EY....H....A...LR.......RG.....RELY...A..LAADYFMG.ESVV..N.K.......LLSL....D.F...D.S...S....TP.IEQQL....K.P..EY-S.G..L.D.QWIDLAGLIVPRKKV.GFIIDDIVNGTIN.S.LEGIVERLKSLYDN...YEAMKWSFVVDN.LRKC..YS.......KE......L..D.A...M.NLQDFIAISKR.W.SESIVA....ISKFRYHDAMKDYS.ESM...KVGFGV...DSEGQN.VEADFQAVR.GL.P..EQDPNVEEMNRHYDIALKNATTAIKR-l.....................................................................
A0A254RG24_9BACT/33-561              ..............................................................................................................................................FRALSGEEISALEK.D.GNRC..ED..WSR.V...L...V.........D...A.........N...F.A.....P.........G.........RIRNSVFMGD...VRL..PAFYG.TL..LL...PGD..V..SF.PTGIYDSLVC.NCII...E-.N.....ALVYK..........V.....-G.......MLC..N..VL........VRNSAVVQNVGSL.....V.........S.S........G..K..........INYMIGST......................IAVGNEM.GA.RKVRVFPDI................T.TDLVDVQ..............L..F.H..K.G..EPD..V.EAAFDEQL.KL.FR.E........ETA.L..P.FG..V..VGKGAVVSNTNIVR.N..SWIGSHARIEGASKIRNTVI.LS...SLE...E..S...THIYDSVIIENTNVQMGVKVHTGAEVQGSVLMSRVRVGSKAIVKSSIVAPCCHIEEGEVNSSYVGPL-VQMHHHSLLIAALWp..eGCGNIGY....GANVgSNHT-GRMPDQEIMPGQGMFFGLGVNIKFP.........AnyRE..S..PFTLVA.SGVT.TLPQRLKFPFSLI.......R..P..........G.......D..P..Q.......L..MgvpaklneLV.PAW.........................NYtrN..A..Y.A.........M...D.RNLFKYSQRGK.GC.V...P..A..S..----FFSIFNPDTVRQVYDAYNRLQ.....V.gQV.RD.V..Y..TK........EHI.....................................................................DGLG.ENF.M........RE....R....V...RQ.......GA.....LTAY...G..EYLERYVL.DLLI..T.L.......VEAD....D.SllkQ.T...P....RE.LRKLL....T.G..DL--.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------nreiarvvplpetldelvkrf.................................................
A0A4R2EBZ4_9BACT/41-720              ..............................................................................................................................................FRKLTGQEVDMLVR.N.GNMS..DN..WDT.V...L...V.........D...D.........P...F.N.....P.........G.........LVRNCIFYGL...VRI..GKLEP.QC..LE...YHD..L..RL.PVGLYNSMII.SSDV...GD.N.....VAIHN..........V.....-G.......YLS..H..YI........LDSESMLFNIDEM.....E.........T.S........N..K..........SKFGNGIIkdget...........eaqrlwMEICNEN.GG.RKVLPFDGM................L.TSDAYLW..............S..K.F..R.D..DKE..L.MRRFQEIT.EN.AY.S........SKR.G..F.YG..R..VGKGCVIKNTSSIK.D..VNIGDCTYIKGANKLKNLTI.NS...TED...S..P...TQIGEGVELVNGIIGTGCKAFYGVKAVRFVMGVNSSLKYGARLINSFLGENSTISCCEVLNSLIYPSHEQHHNNSFLIASCVq.gqSNIAAGAt..lGSNH.TSR----ANDGEIIAKRGFWAGLSTTIKHN.........S..RF..G..SFTLLTkANYL.HSINID-LPFALVg.....nN..E..........S.......E..N..R.......L..E........II.PAYww.....................ryNM..Y..A..L.E.........-...-.RNAWKFVMRDK.RG.E...V..G..Q..--KFEYSYLAPDSVSEILVALDKLY.....R.wIA.EE.V..E..PC........ATDnhraiaekaiae............................................gynpasilissegI---.EAS.S........RK....V....L...LKk....pvQA.....VMAY...R..EMVKYYA-.--LI..S.F.......IDY-....M.M...A.N...N....AG.LEGIL....S.L..DSDG.I..D.R.CWMNVGGQIFRCSFI.EELKHRVKSNELN.S.WDAIHAAYRSQDDT...YIYDKARYAKYA.MEQI..IG.......--......-..Q.K...L.SLESLFQLADE.G.VAIAQM....VKERVFQSRLKDYN.DPF...R-----...-KIVYD.NQEEMDAVI.GS.I..NDNDFIAHSEAVCQQTLNDIESL----fvr...................................................................
U2IXU4_9SPHI/42-724                  ..............................................................................................................................................FRQLTAQEIQQLTN.Q.LNYS..SD..WSK.V...W...V.........S...E.........P...F.F.....P.........E.........QIQHSKFYGL...VRI..GAMEQ.TY..LS...YRD..L..RL.PTGIYNSTIV.SSDI...GA.C.....SAIHH..........V.....-R.......YMA..H..FI........IGEQVLLSNINEM.....E.........T.S........N..N..........AKFGNGILkeges...........pdkriwMELCNEN.GG.RSVVPFDGM................Q.AADVYLW..............S..R.H..R.E..DSI..F.QNRLLEIT.DR.HF.S........TQR.G..Y.YS..T..LADNVVLKNSNTIK.D..VKIGPYAYIKGVNKLKNVTV.NS...SKE...A..F...TQIGEGCEIVNGIIGYGCRVFYGVKAVRFILSSHSQLKYGARLINSFLGDNSTISCCEVLNSLLFPSHEQHHNNSFLCAALIk.gqSNMAAGAt..iGSNH.NSR----AADGEIIAGRG---------FWPglcvsikhnS..KF..A..SYTLLVkGDFL.HELDIR-IPFSLVs.....nE..A..........D.......K..N..R.......L..L........IV.PGYwf.....................lyNM..Y..A..L.M.........-...-.RNTTKFNDRDK.RT.L...K..N..Q..--YLEYDVLAPDTVNEMFDALHEI-.....-..-E.MA.V..G..QA.......wPEIepeataqirgrrllm.......................................dpnfdlnqrevyltnTEFS.NRK.V........VV....V....K...AR.......AC.....YHTF...K..RMIHYYGA.VHLA..D.C.......LEKD....T.C...G.T...S....AP.-----....-.S..AIPE.Q..R.E.QFENVGGQLIPQKHI.KTLIEDIKTQKID.S.WTEVHERYHTWSKL...YPKSKIDHALAS.LAQI..TE.......TS......P..A.D...W.DTDFINHTLAQ.S.LDTKKW....IYSEIKKSRGKDYE.NPF...R-----...-MLTYN.SKEEMEKVV.GK.L..EENSFLIKQQAEFTCYEEKIAKI----ttk...................................................................
A0A1I1ITY1_9SPHI/42-727              ..............................................................................................................................................YRPLHEAEIDSLIR.N.GNYS..PN..WKD.V...W...V.........A...D.........P...F.L.....P.........D.........QIQQCKFYGR...VRI..GPMEP.VY..LE...YRD..L..QL.PTGIYHSIVV.SCDI...GA.R.....AAIHN..........V.....-R.......YLA..H..FI........IGEEVMLFNVHEM.....E.........T.S........S..N..........AKFGNGILkdgda...........asslieLELCNEN.GG.RAVLPYDGM................Q.ASDVYLW..............T..R.N..R.H..DRQ..L.QERFKAMT.FG.RF.D........SRR.G..Y.YS..V..VGHRTVIKNSHIIK.D..VKIGTDAYIKGVNKLKNVTV.NS...IAG...A..Y...TQIGEGCELVNGIIGHGCRIFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCASLVm.gqSNMAAGAt..vGSNH.NSR----GADGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFM.HELDIR-MPFAMV.......S..H..........Dv.....pN..N..R.......L..L........IL.PAYwf.....................lyNM..Y..A..L.M.........-...-.RNNMKFISRDR.RT.L...K..N..Q..--YFEYDVLAPDTINETFSALREME.....T.aVG.KA.Y..H..PA........ADSgewarlgrellad..........................................pgadlrereilldgVENS.SRK.V........VL....I....K...VR.......EG.....YAAY...K..RMITYYAA.TQLK..Q.Y.......FDTH....T.Y...A.Q...F....E-.-TAYL....T.D..GLTA.E..R.A.LFENVGGQLIRKTDL.AALVDDIRGGRIN.D.WDTVHQRYHQLSSQ...YPTHKLEHALAS.LLEV..NG.......ME......K..V.Q...L.TAPYLQTLIEE.S.VATKQW....ICKEIYKTRAKDYQ.NPF...R-----...-LMVYE.NEQEMDAVI.GR.L..ADNAFIRQQQEEYDRYA----------rsvktyla..............................................................
A0A2S9JGE3_9SPHI/42-731              ..............................................................................................................................................YRPLTEQEKQLLIR.N.GNYA..AN..WDN.V...K...V.........T...A.........H...F.L.....P.........D.........MIRNSSFSGL...VRI..GDMTP.SV..LE...HKG..L..EL.PVGIYNSHIV.SCDI...GP.D.....AAVHN..........V.....-K.......YLA..H..FI........LEREVMLSSIDEM.....L.........T.S........P..V..........AKFGNGIVkegeq...........eeqrivLELCNEN.GK.RAVTAFEGM................Q.ASDAYLW..............T..R.Y..R.D..DDI..L.QRRFQEIT.DK.KF.D........RRR.G..Y.YS..V..VGEGVVIKNSKTIK.D..VHIGAYAYIKGINKLKNVTV.NS...RAD...A..I...TQIGEGCELVNGIIGFGCRVFYGVKAVRFFLSSFSQLKYGARLINSFLGDNSTISCCEVLNALIFPAHEQHHNNSFLCAALVk.gqSNMAAGAt..vGSNH.NSR----GADGEIIAERG---------FWPglcvslkhnS..RF..A..AYTLLVkGDFL.YELDIR-LPFSLV......sL..D.........lK.......N..D..R.......L..V........LL.PGYw.......................fLY..N..A..Y.A.........L...M.RNTDKFAGRDN.RK.L...K..N..Q..--YFEYDILAPDTVNAMFEGLEIIE.....L.aVG.KS.L..S..GK........SGLndmayreigqsv............................................llsnqptplgevlIEGV.ECS.K........RD....V....V...LAk....pyEA.....YQVY...R..RMIAYYAG.SEIM..T.A.......LDRV....S.M...G.-...-....-E.FLLLL....D.T..LGDT.G..R.A.TFDNVGGQLVDVEEL.QGVLERLKTGEID.S.WEEIHSWYHETSAS...YPMTRLQHALAS.YAEL..QG.......GA......PwqN.E...H.DLEWLLHLLHD.T.LETKKW....LCTQIFRSREKDYT.NPF...R-----...--KMVYgNDNEMDKVV.GA.L..HDNAFIRKQEQECQTMETTINNIIL--el....................................................................
W7U6L5_9STRA/55-432                  ..............................................................................................................................nerdrataskdspviy--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.-T..I..IGHDAIVQCCPRVV.A..SFIGPFARLENS-EVESSSL.LS...GRE...E..A...TWVVEGSVVSRSLLQEGVAVRGHALVRDSLLMEHSSVDTGGKCSHVVLGPDSGVATGECHHSLVGPC-VGFHHQSLLIAALWprgrGNVAYGAq..iGSNH.TGR----AADQECLVGEGIFFGLGVLVKLP.........V..NLshS..PYSLVAaGTSL.DQQRLH-FPFSLI.......A..A..........S.......R..D..G.......A..F........LR.QCLedrmgdmetradappilpnilrpawVL..R..AspY.T.........V...F.RNESKYMHRSK.SR.R...H..K..A..--MVTEPLFRPEIIDMMVEARARLQ.....Q.aLG.SR.G..G..WD........EKStgkpf..........................................................fskkdlDGSG.SNV.V........TW....R....G...AN.......EG.....VDTY...T..VWIKRYAL.RGLY..D.R.......LKYL....E.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------keemgineggveea........................................................
A0A4Q0J0N7_9BACT/3-628               .............................................................................................................................................l-RHLTTDETDMLVR.N.GCRC..AR..WER.I...K...V.........N...D.........P...F.I.....A.........T.........AYRNATFMGD...IEL..HPAEG.TV..-A...CGG..V..TF.EAGISNAVII.DSVI...GR.G.....AHIAN..........I.....GD.......FMA..R..CV........VGDGAVIRNTGTI.....D.........C.R........Q..E..........TSHGAGTV......................VDVLSET.GG.REVPIYYGL................T.AREAWTI..............A..M.F..R.H..DMA..T.VDRLKDAI.SD.RA.A........AKR.C..R.RT..I..IGAKAVVTGAGYID.S..MDIMAGAEVNGASRLVNGTV.GE...GA-...-..-...-KAGCGVMASGFILARGAEVDTGARLDHVFVGEGSRVANGFSAHHSLIFSNCILENGEAAALFAGPYTVSMHKSTLLIGAMT....SMFNAGS....GANQ.SNHLYKSGPCHHGILERGVKLASDAYIMWP.........A..HI..G..AFTTVM.GRHK.SHPDTSALPFSYI.......V..E..........T.......D..G..H.......T..L........VI.PAI.........................AL..G..N..I.G.........V...A.RDADKWPRRDR.RP.R...P..A..T..-DIITFPLLNPYTAQRISQGIDLLD.....S..LL.TS.Q..-..PD........TET.....................................................................LTCR.GYV.I........KR....P....H...AV.......RA.....LSLY...N..MALRHYML.GTLL..R.R.......IADG....L.-...-.-...-....--.---PL....D.A..AETT.G..A.G.RWIDMAGTAIPAALA.QAEL-----PEAS.Q.WDTFS---------...-RQLEWDWIAAR.LATS..AD.......ID......L..H.S...P.DRDTVERLLDE.W.RQLDDK....LTEMLRRDAAKEFD.LTNpdmTAGFGL...A-DPEA.LAADFTNAR.GT.L..DSAAAACLLKARREQPDALSSAVKHR-l.....................................................................
A0A512RDK2_9BACT/42-735              .............................................................................................................................................h-RKLKAWEIETLVR.N.DNTS..DD..WNN.I...F...V.........D...N.........E...F.D.....P.........N.........LVQHCHFYGM...IRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YI........IGNEVIIANVNEM.....G.........V.T........D..H..........AKFGNGIVkegep...........esvriwMELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.S..R.Q..DQA..L.MDQFKSFT.EK.QF.D........KKR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGTDAYLKGANKIKNVTI.NS...EAG...A..P...SQIGEGCELVNGIVGLGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..KF..A..SFALISkGNYM.SELRVP-FPFSLVv.....nD..E..........H.......E..N..M.......L..K........IM.PGYff.....................lhNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--PIEYDYLAPDSVEEILESLELME.....I.aVA.KA.Y..Y..RK........QDKnieklskntirqtgrnl...................................lleenakvsrmeilgenIENS.QRK.V........QL....L....K...VH.......KS.....YPLF...R..ELITLHAI.RNLI..K.N.......ATAF....N.I...S.S...F....SA.LQAYC....K.-..--NV.K..R.S.AWHNAGGQLIKAETL.EDLKNRIRKGKIG.S.WPQLHDAYREIGAS...YEQDKLQHALAC.LLQL..HD.......IS......P..K.E...L.TKQQLKKFLEQ.S.VFTFGT....LTEGIYHSREKDYR.NPF...R-----...--QMTYeNEAEMEAVV.GK.L..EDNSFIQQTINDLKTYKKQVKEMIKK-w.....................................................................
A0A1V9FVE3_9BACT/42-735              ..............................................................................................................................................YRHLSAYEIEVLVR.N.RNTS..DN..WNN.L...L...V.........S...D.........A...F.N.....P.........E.........LVQNCKFFGL...VRI..GKLEP.YY..LE...YHN..L..RR.PVGFYNSTVI.SCDF...GD.N.....VVVDN..........V.....-N.......YIS..H..YI........IGNEVILVNCNEI.....A.........T.T........D..H..........SKFGNGILkegep...........eniriwMELCNEN.AG.RSILAFDGI................L.PGDAFLW..............T..Y.F..R.D..DDK..L.LNRFKEFT.EK.KF.D........ALR.G..Y.YG..T..IGDRTVIKNCRILK.D..VKIGTDAYLKGANKIKNVTI.NS...SAE...A..N...TQVGEGCELVNGIIGYGCRLFYGVKAVRFVLASFSQLKYGARLINSYLGDNSTISCCEVLNSLIFPSHEQHHNNSFLCAALVq.gqSNMAAGAt..vGSNH.NSR----SPDGEIIAGRG---------FWPglcvslkhnS..KF..A..CYSIVAkGDYS.AELHIP-IPFSLI.......S..Nd........lS.......N..D..Q.......L..V........VM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--TLEFNFLAPDSINDLLQSLPLLQ.....K..FV.GK.A..W..LK........REGnhkkmsdddiiaigqvl...................................ldtqdpvvnelvvladnFENS.RRP.V........RL....I....K...VM.......KS.....YHLF...K..ELVMYYLV.QQLL..E.H.......IRSN....N.I...K.T...H....EQ.LIESL....P.S..K--A.V..I.A.SWMNVGGQLILRSEI.DKLNKQIVAGKIK.D.WDAVHAFYVQQGKN...YPMEKLAHAMAA.VKEV..FD.......IN......L..K.K...S.SAGIIKSLLQQ.S.IATKEW....MVKEIYESRAKDYR.NPF...R-----...--KMVYeTPEAMNKVV.GK.L..EDNSFIKQEQKALEEYKKEIQQLVTKL......................................................................
A0A1T5KN27_9BACT/43-734              ..............................................................................................................................................WRHLTSDEIEALVM.N.DNTA..AS..WDT.I...W...V.........T...D.........E...F.R.....P.........H.........GVKNNKFYGT...VRI..GRVTE.NG..LQ...FHD..L..RL.PIGITNSSIH.SCDI...GD.D.....CAIHN..........V.....-H.......YLS..H..YI........IGNRCMLFNIEEM.....C.........T.T........D..H..........AKFGNGIIkegep...........eevrvkIEVMNET.GC.RAVYPFDGM................T.TADAYMW..............A..K.Y..I.D..DEP..L.QQKLREIT.QA.SV.D........SHR.G..Y.YG..T..VGEGCVIKNSSIIK.D..ARIGASCYIKGASKLKNITI.NS...SEK...E..P...SQIGENVIMVNGIMGVGSRVFYSCTAIRFVIGNNSALKFGARLINSILGDNSTISCCEVLNNLIFPAHEQHHNNSFLVAACVk.gqSNMAAGAt..iGSNH.NSR----TNDNEVVAGRGFWPGLCTSIKHS.........S..VF..A..CYTLLAkADYP.AELNIP-LPFSLLs.....nN..A..........K.......E..D..R.......L..E........LT.PGFww.....................seNL..Y..A..L.A.........-...-.RNNWKYKTRDK.RI.T...K..T..Q..--NIEFDTFAPDSMEEVIHARELLE.....L..WT.AK.A..W..YR........KENkpfdklkdeqlrakgrdl.................................lngdsemvdalevfgeglE---.--K.S........KR....P....A...LIrk...prRA.....YHAY...G..DMLVHYAM.VNVM..D.Y.......LEAN....P.G...E.T...L....TS.LSAFL....K.S..R---.R..Q.R.EWVNLGGQLMMATEF.DRLRSDIRSGKLA.S.WKDIHKRYNDIWRR...YPVDKLRHAYLS.LCCL..MG.......VE......R..-.-...M.DAAAWQQAIEA.E.IRIQRF....ICDEVYRTRQKDYE.NPF...R-----...-KATYR.NAEEMTAAI.GT.L..EDNSFVKQIRSETAVNLKRLEELRER-i.....................................................................
A0A0M3C9B9_9SPHI/41-726              ..............................................................................................................................................YRNLTVEEIVILIE.N.GNRA..DN..WEN.I...L...V.........S...E.........S...F.I.....P.........Y.........QIRQSNFFGL...VRI..GHMAP.TY..LE...YRN..L..KL.ESGIYNSTIV.SSDL...GD.Y.....VAIHH..........V.....-R.......YMS..H..FI........IGNDVILSNISEM.....E.........T.S........S..T..........AKFGNGVLregea...........edlriaLELCNEN.GV.RSILPFDGM................Q.AADAYLW..............T..R.N..R.Q..DTV..L.QHRFKELT.EK.RF.S........TVR.G..T.YS..M..IGDRCIIKNSQNIK.N..VQIGSDAYIKGINKLKNLTI.NS...SPE...A..F...TQIGEGCELVNGIVGYGCRIFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAATIm.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLLVkGDFP.YEMDIP-IPFSLV.......N..Nd........vK.......N..D..K.......L..M........II.PGYwf.....................myNM..Y..A..L.V.........-...-.RNANKYASRDK.RL.L...K..N..Q..--YLEYDMLAPDTINELFNSLRIIE.....L.eVG.SQ.M..N..EE........SNSltkeeiiragrakl........................................tgpldqiptsvlvkgFEHS.KRK.V........EL....V....K...IG.......TA.....YPLF...K..RFIKYYGT.IHMI..D.F.......LETH....S.F...E.-...-....-E.LKN--....-.E..MTNS.Q..R.L.EWENIGGQLIEKNAI.DQLLREIKSGKID.D.WEDIHKYYHELSRS...YLETKRAHAFAS.LLEI..TD.......VT......S..E.S...I.SIEIVQAWLKE.A.ISHRTW....MVDEIYASRAKDYE.NPF...R-----...--NMVYnSEEERDLVV.GK.L..SENSFILQQRDELNGFVKCAHKLISKL......................................................................
A0A3S1CQ45_9BACT/41-731              ..............................................................................................................................................YRNLFAYEVEALVR.N.DNSS..DD..WNK.I...F...V.........S...N.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........LGNEVIVANVNEM.....A.........T.T........D..Y..........AKFGNGILkegea...........eggrivMELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.Y..R.D..DQQ..L.QQQFKAFT.EK.QF.D........KRR.G..Y.YG..M..VGDRSVIKNCKIIK.D..VTIGTDAYLKGANKLKNLTI.NS...SSE...A..K...SQIGEGCELVNGIIGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..CFTLISkGNYM.SELHIN-IPFSLVl.....nD..E..........H.......D..N..R.......L..K........IM.PGYwf.....................mhNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEMFTALQIME.....T.aVG.KA.W..Y..AI........EENrpkkeltekdirkk.........................................gkellteqpeavaqLTIL.ATG.M........EN....S....S...RE.......VQ.....LLKV...H..KAYPLFRE.LIVL..Y.G.......IRNI....M.S...A.G...K....PS.FLALQ....A.A..IKSA.K..R.G.EWHNVGGQLMKADTL.TLLKNKIRKNKIS.G.WPQLHDAYAEIGRE...YASDKLQHAVAA.MLEI..KD.......VP......L..K.N...F.TTALLAQWLED.S.IQTMEW....ITANIRRSREKDYQ.NPF...R-----...--KMTYeNDQEMNAVV.GS.L..ENNSFINETLNELGEYKNRVRQIIN--ew....................................................................
C3J9H9_POREA/13-660                  .............................................................................................................................................l-RHLSSEEIAQLEA.N.HCSA..TD..WNL.I...F...V.........P...E.........K...F.T.....P.........T.........AYQFVEFRGE...CHL..GTTLG.AT..PS...RPN.fA..SR.PTGIYHAIIE.DCSI...GN.E.....VYIGH..........I.....GN.......KIS..N..YS........IGEGSIISHIFSL.....T.........A.R........Q..G..........SSCGIGTK......................VSVLDET.GG.RALRIVRHL................P.AAVAYCM..............V..F.G..K.A..DKA..L.MQAWEQAV.DI.AT.S........EVE.E.rG.YA..V..IGKDNLIAQSGILE.D..ISTEHSSTIIGVQHLAEGYI.GC...NV-...-..-...-KMQGSIVSEHFIVEDDTHLGNC-SLHHCYVGEGCRLDGGFSAHDSLIFANSNLSNGEASAAFLGPYTVSMHRSTLLIGGAF....SFFNAGS....GTNQ.SNHQYRLGPIHHGLMERGVKCSSDSYMLWP.........A..RV..G..AFSKLV.GRFY.RHPDTAEFPFAVL.......T..S..........D.......G..G..E.......M..Q........IQ.PAV.........................TI..G..H..I.G.........T...W.RDFEKWPLRDN.RT.S...T..L..P..DDRLVFRLWQPAIMYRVWQGWKQLS.....L..AQ.DL.A..Q..EG.......kSYH.....................................................................HLMG.GCA.I........AE....G....D...IT.......YG.....IQLY...Q..SLLSAYIG.RLLY..S.E.......ASLT....L.P...Q.L...L....EE.LSA-I....K.P..--SE.S..P.S.PVLDLMGFAISEKGY.LAWRKEVTKGGM-.S.PSQIKQSLEQ-HAL...SQEEEKEWALRL.LRQL..LS.......DD......L..E.D...-.---SLRAFIQA.I.PTAEQL....LQKRVFSDGRKELSpSRS...SVGFGLlplPEAEKA.AEEDFLAVR.QD.L..IKQDFVGKLKRDFSQYIEQAEKLKERL......................................................................
A0A5P2FZR3_9BACT/43-728              ..............................................................................................................................................YRQLTAFEIEALVR.N.RNTS..DN..WNK.I...L...V.........S...D.........L...F.N.....P.........E.........LVKNCKFFGL...VRI..GQLEN.VC..LD...FSD..L..SM.PVGLYNSTII.SCDF...GD.N.....VVVND..........V.....-H.......YMS..H..VI........VGDEVILSNINEL.....V.........T.S........N..H..........SKFGNGIVkdged...........esvriwLEICNEN.GG.RKVLPFNSM................L.SGDAWLW..............S..K.Y..R.D..HAE..L.LEKFKIFT.EK.EF.K........TKN.G..Y.YG..K..IGDRTVIKNTAIIK.D..VWIGSDAYIKGASKIKNVTI.NS...GEE...G..I...SQIGEGCEIVNGIIGFGCRIFYGVKAIRFVMGNHSQLKYGARLINSYLGSNSTISCCEVLNSLIFPGHEQHHNNSFLCAALVm.gqSNIPAGAt..iGSNH.NSR----SADGEFIAKRGFWPALCSNIKHN.........S..KF..P..TFTMLArGNYA.YDLDIK-IPFSLVs.....vN..E..........S.......E..N..R.......L..D........IM.VGYwf.....................lyNM..Y..A..L.T.........-...-.RNAWKAGDRDA.RI.Q...K..P..L..--LLEFDYLAPDSVNEIIVALGIIE.....N.aVG.EA.Y..L..LKy......pN-Eskennsskigkqlls.......................................egnsvideleiclknVEHS.NRK.V........LL....T....K...VR.......KG.....YDVF...R..EMLYYYSL.NELY..R.Y.......F---....-.V...I.E...N....HS.LDTIY....Q.W..EIVG.N..M.H.DWLNVGGQLMTQNSV.SELIGKIENEKIQ.S.WDDVHHFYQKQAAI...YPKQKLSLALVI.LKDY..FS.......SD......Y..P.N...W.IEKDLSRFFED.F.IAIESK....INQAVIQSRQKDYE.LSF...R-----...-KMMYD.NQQEMDEVL.GA.F..DKNAFILQKKDELEVI-----------kqklvkf...............................................................
R6X8B8_9BACT/4-613                   ..............................................................................................................................................YRPLTSEEIEVLKQ.N.NCWA..ED..WTS.V...N...V.........G...E.........N...F.K.....P.........N.........FMHRVMLYGE...VNI..GGFDK.NV..EV...SQG..F..VK.HSGINNATLR.NVTI...GD.D.....CLIEN..........I.....GN.......FIN..N..YT........IGDDCYISNISTL.....E.........T.T........E..G..........ATYGEGNL......................VSVLNEV.GE.GNVILFSDL................N.SQLAAFM..............V..K.H..F.S..DKE..L.KERIRQLI.KT.DI.D........TKM.P..E.RG..R..IGNNVKIINTKEIT.N..CVINDFCEVNGASRLSDCTL.LG...SIH...G..N...VYIGTGVIAENSIIAEGASVINSVKIQDCFVGEACQLSNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGSKTASGAYLLMP.........A..TL..G..TFSVCF.GKLM.HHPNTRNLPFAYL.......I..A..........D.......G..D..K.......M..F........LI.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDL.RA.M...E..N..R..KSIVNFDWLSPYSVGEVLKGKKILE.....N..LR.EV.T..G..DN........VSQ.....................................................................YLYH.EYI.I........PS....S....S...LH.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKL-....-.-...-.-...D....PA.I---T....P.P..TTHI.G..E.G.DWDDLSGLLLPVSEE.QRIIDDLKDGTIS.D.ILTLLKRFEDINAN...YRDYQWAWTYKM.VCDY..YH.......I-......-..D.E...I.TLEDANRIHED.Y.IKARRS....WIAEIKKDAEKEFA.M--...------...------.---------.--.-..---------------------------gdveeevfrnfvdsldqe....................................................
A0A329SKK5_9STRA/39-554              .............................................................................................................................................f-YPLSDGEIRALEA.N.GNSA..EN..WHN.V...R...K.........T...D.........A...Y.T.....Pl......etS.........RIRQCSFHGK...VVL..GRFST.TF.rHG...VDG..I..PF.LSGVYNSALS.NVVV...LD.D.....ALVRD..........T.....-L.......VLR..D..VL........VDSRASIIKCGSV.....T.........GpE........E..D..........AISANGNL......................LHVGVET.GG.RDLRMVADL................P.FALGAAV..............A..T.K..R.G..DHD..L.LKAYNAFV.DK.YV.A........AVK.A..S.LA..I..VAQNARIRGCSRVQ.G..TFVGEYAVVEDSD-VVNSTI.LS...TKE...E..P...SVIRTKSIVRDSIVQWNSTVEALSVVEGSFLCDTSHVERHGIVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NF..AkaPYSVIA.TAVN.TLPQLVTMPFALI.......N..T..........P.......G..H..T.......I.pS........LS.PAInei..................spgwVL..S..S.sVfT.........V...L.RNEDKFRSRNN.SK.-...-..-..R..-THIEADIFRPEIIQYMKDARVELE.....A..AE.GK.A..K..INl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......AG.....ITTY...T..FFIKLYAL.DELL..K.L.......VESG....H.V...S.A...D....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtvgsmds..............................................................
R6E856_9BACE/4-659                   ..............................................................................................................................................YNLITAEQIARLEA.Q.SCRC..ED..WNN.V...L...V.........D...P.........E...F.D.....T.........E.........YVRNVTFSGQ...IKL..GSFKK.IF..TL...AGG..I..RK.HSGIFHATLH.NVVV...GD.D.....CMIEH..........V.....RN.......YIA..N..YV........IGSGSYLENVTDL.....I.........T.Y........G..E..........TSFGNGIK......................VNVLNET.GG.REVIIHDNL................S.SHEAYIS..............A..L.Y..R.H..KPA..L.TEALDKMV.GK.YV.Q........SVT.A..S.FG..V..IGENVEILDAMHIV.N..VNIGPYARIKGVSRLRNGSV.IS...CKE...D..P...VEIGMNVIADDFIVESGSKITDGVMISKCFVGQACALGHGYSASESLFFSNCQGENGEACSLFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGILERGAKTTSDSYILWP.........A..KI..G..AFSLVM.GRHV.NNLDTTDLPFSYL.......I..E..........Q.......Q..G..S.......T..Y........IV.PGV.........................NL..K..S..V.G.........T...I.RDVKKWPERDK.RK.D...P..H..R..LDHINFNHLSPFTVQKMFAGIDILE.....R..LK.EA.S..G..LR........ADN.....................................................................YSYK.KAT.I........RN....A....A...LF.......KG.....IKYY...Q..TAIVKFLG.NSLI..S.R.......IQDA....D.I...S.T...D....EG.LRLAL....R.K..DTAV.G..S.G.QWVDISGLIAPASEI.ESICDDVISGKIA.D.VNVLSDRFLDIFAH...YYNYEWTWAHDA.IERY..WK.......ID......L..A.R...I.TRNEAADIVKQ.W.KNAVVS....LDKLIYEDARKEFD.LTT...MTSFGA...DGDKTR.RDEDFNAVRgGG.F..DDNPFVQEVIDHIRRKSALGDGIIARL......................................................................
W0EUK6_9BACT/4-658                   ..............................................................................................................................................YRKLNRTEIERLTA.Q.ECMA..DN..WNQ.V...H...V.........A...E.........G...F.S.....P.........A.........YIAHTRFSGE...VYL..GRFEQ.EI..EL...PGG..L..RK.HAGLRHVTLH.NCTI...GN.N.....TLIEN..........I.....PN.......YVA..N..YQ........IGDYCYIQNVNLL.....L.........T.E........G..E..........SCFGNNTE......................VSVLNET.GG.REVPIYNRL................S.AQLAYIV..............A..M.Y..R.H..RPD..L.IGRLGQMI.AD.YA.R........SVK.S..T.RG..T..IGNGVHIVNTGTIR.N..VCIGDACRIEGASRLDNGTI.NS...CTE...A..P...VYIGANVTAEDFIISSGACVSDGVVLSRCFIGQACHLTHLFSAHDSLFFSNCQGENGEACAIFAGPYTVTMHKSSLLIAGMF....SFLNAGS....GSNQ.SNHMYKLGPIHQGVVERGSKTTSDSYMLWP.........A..KI..G..AFSLIM.GRHV.THPDTSGMPFSYL.......I..E..........H.......G..N..R.......S..Y........LV.PGA.........................NL..K..S..V.G.........T...I.RDAQKWPKRDR.RT.D...P..D..K..LDCINFNLLSPYTIQKMLQGIDTLQ.....G..LK.QT.S..G..ET........SEC.....................................................................YSFQ.STT.I........KN....S....S...LE.......KG.....INLY...T..LAVHKFMG.NSII..K.R.......LEGT....P.F...A.D...L....DD.LHSRL....Q.P..TDPL.G..E.G.EWIDLAGLIIPKQAM.QEEIERIVHQSDY.T.LEAAEAFFRTLHHR...YYDMEWTWVCSK.MQRW..YG.......KS......I..D.Q...L.TPQDIIGIVRQ.W.NEAVVS....LDRMLYDDARKEFS.MIS...RIGFGV...DGSASQ.RDFDFEQVR.GE.F..ESDPFVKMVCRHIEEKTALGDELLERL......................................................................
A0A3L8ADE5_9BACE/4-658               ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGN.V...L...V.........A...D.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFES.EF..TL...RGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGSDTFIENVDII.....L.........V.D........G..L..........TTFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKSIA.DY.YS.N........KHA.S..A.VG..S..IGNHVMILNTGSIK.N..VRIGDYCHICGTCRLTNGSV.NS...NVT...A..P...VHIGHGVICDDFIISSGSQVDDGTMLSRCFVGQSCKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RQ.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LR.RV.S..G..VT........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..T.G.EWVDVSGLIAPKSEI.DRLLDGIENGTIN.R.LKSINACFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......LN......P..E.N...I.TAQDVIRIVKS.W.QEAVVG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSHDE.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEEKTELGNELIKRI......................................................................
E0NPP0_9BACT/16-606                  ..............................................................................................................................................YRALTEKEIQTLEH.N.GCTA..ED..WTS.V...S...V.........D...T.........D...F.A.....A.........A.........YVKNTTFYGD...VNL..GVFEK.NI..EA...GEG..I..VV.HSGLRNVVLR.DVTI...GD.N.....CLIEN..........V.....SN.......YIS..L..YD........IGEECYISGVGKI.....A.........S.T........G..G..........ATFGQGET......................IAVLNEA.GR.GNVKLFEGL................T.SQLAAFM..............V..R.H..H.A..DRE..L.IAALFALI.ER.RI.A........ARK.T..E.RG..V..IGYRVKIVNTKEIV.D..TNISDDCEINGASCLGNCTL.EG...TQE...T..G...IYVGHDVICENTIVTAGAALLDGAKIKNCFVGEACHIGSGFTATDSVFFANSHMDNGEACASFCGPFTVSHHKSTLLIGGMF....SFYNAGS....GTNY.SNHAYKLGPVHYGTLARGSKTASGAHLLMP.........A..SI..G..AFSMCM.GKIP.CHPDTRKLPFSYL.......L..A..........S.......G..D..E.......V..Y........LV.PGR.........................NL..T..T..V.G.........T...Y.RDVGKWQKRDV.RP.R...G..E..R..KSLVHFDWLNPVTVGACIEGKRLLE.....K..ML.CE.Q..G..VV........TDA.....................................................................YRYE.GCL.I........TP....R....A...LQ.......QG.....IVSY...D..MAIRLFIG.MQLS..S.R.......----....-.-...-.-...-....--.--TTV....S.P..VETT.G..A.D.TWIDLSGLLMPEVEE.RRLAEEIRQGIVT.D.VEELADRFLDSYHR...YEDYLWAYAYEL.MKEY..YQ.......LD......-..-.A...L.AGEDLDRIRQD.C.RQAHDE....WLALIRRDAEKEFA.L--...------...------.---------.--.-..---------------------------gdve..................................................................
A0A1Y3VAC0_9BACT/52-575              .........................................................................................................................................sgarv--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........I.....RS.......RVR..N..YR........IGAGSLVESVTAL.....E.........C.R........H..R..........SAFGNGVG......................VATMNEC.GG.RTVRIFDTM................S.AQVAYVM..............A..V.Y..R.H..RPQ..T.IAALERMI.DA.HA.E........SRS.A..E.IG..D..VGRNCRIVGARFIR.E..VRIGNDVEIDGASALENATL.C-...---...N..G...VRIGVDVKAYDFIAAEGARIGNGSIVERCFVGESCILDKGFSAAESLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGAVHQSVHLRGCKFASGAYIMSP.........A..LE..G..AFTMVM.GHHS.YHHDTSAFPYSYL.......I..E..........K.......E..G..R.......S..H........LM.PGS.........................NL..T..S..Y.G.........A...V.RDIEKWPARDR.RT.V...R..R..-..-DVIDFAEYNPYVTGAMIEAVNILH.....T..LQ.EQ.-..D..PD........AAV.....................................................................YTYN.KTL.I........RS....A....S...LQ.......RG.....LKLY...N..RAIVAALG.ALL-..D.R.......GE--....-.-...-.-...-....--.-----....S.N..PRYD.G..T.G.RWADLAGQYITHRAV.TEILDAVDRGELA.G.LPAIDNRFRVFDVH...YDDYAHSWAMDV.YTAL..LG.......HT......P..-.-...-.TAAEMNEAIAA.G.HNAHAA....MRRTTDADRDRDSS.LDM...AVSYGL...DDDRDEvRREDYFAVR.G-.-..---------------------------l.....................................................................
D8DVN1_PREBR/4-599                   ..............................................................................................................................................YRSLTEEEIQILEK.Q.GCIA..ED..WTA.I...N...V.........A...E.........D...F.S.....P.........L.........YLKNVEFSGE...IYL..GVFEK.NI..TF...EDG..F..SR.HSGIRHAILR.DVTV...GD.N.....CLIEN..........I.....GG.......YIY..N..YT........IGEDSILVNIGKI.....N.........T.S........T..E..........YTFGRGNI......................ISVINES.DN.GNTILFEGL................T.SNIAALM..............V..K.H..A.D..DKE..F.KSSMWKLV.RN.VI.Q........SNT.P..E.RG..E..IGYGVKITNTLEIT.N..SIIMDHCEVNGASRICETTL.FTypmDAD...S..G...IFIGNDVILENCIVVANASIMDGAKINNCFVGEACHIGKGASADNSLFFANSYLDNGESCAAFCGPFTVSHHKSTLLISGQY....SFYNAGS....NTNY.SNHAYKMGPIHWGIIERGSKTASGTHILWP.........A..QI..G..SFSMCM.GKIQ.NHPCTLDLPFSYI.......F..G..........S.......N..D..S.......T..Y........LA.PGR.........................NI..T..T..V.G.........T...Y.RDISKWPKRDM.RV.R...S..G..K..NSIINFDWLNPTTIQECCRGKKVLE.....D..LR.TE.Q..G..EH........MAS.....................................................................YIYK.GCN.I........RN....K....S...LE.......KG.....IKYY...D..LAIRLFIG.ETLQ..K.H.......LDID....-.-...-.-...-....--.-----....L.P..STSI.G..S.G.EWNDLAGLILPEEKE.LELIDNIKNGCIT.S.YSELQEEMQNIHAH...YEEYKWAWAFRI.ILSF..YH.......LD......-..-.T...I.GQEDIIHIQQD.Y.QQALNE....WNNAIKYDAENEFK.MG-...------...------.---------.--.-..---------------------------dvai..................................................................
A0A419W4Y7_9BACT/6-660               ..............................................................................................................................................YRSLSPDEIESLKM.Q.GCAA..DN..WET.I...R...I.........A...E.........G...F.E.....S.........E.........RFFNVQFSGN...VRI..GIQNQ.NI..EL...YGG..V..KK.KCGVYHAHLH.NCIV...GN.N.....VYINH..........I.....KN.......YIA..N..YE........IHDHVIIDNSDIC.....A.........V.E........G..I..........SRFGNGTG......................VEVLDET.GG.RKVVIYDEL................S.AHLAYIM..............A..F.Y..K.H..RRD..V.IVNLDKMI.QD.YC.H........KVK.S..D.MG..V..IGEHSRIFNCREIR.N..VKIGPYTHINGASVLQNGSI.NS...NHS...A..P...VLVGHDANLKNFIVSSGSEVSDGAIIANCFIGQGCTLGAQYSAQNSLFFANCQGFHGEACAVFGGPYTVTHHKSTLLIAGMF....SFCNAGS....GSNQ.SNHMYKLGPIHHGIAERGTKTTSDSYLLWP.........A..RI..G..AFTLVM.GRHY.KNSDTSDMPFSYL.......I..E..........N.......D..D..E.......S..W........LV.PGV.........................NL..R..S..V.G.........T...I.RDVLKWPKRDK.RT.D...K..H..K..LDYINFNLLSPFTIQKMDHAIRILH.....Q..IQ.KI.S..G..ET........TEV.....................................................................FSYN.NTK.I........KR....D....A...LQ.......RG.....LKLY...H..MAIMKFIG.NSII..T.R.......LNKG....Q.L...H.S...P....HE.VTDCL....L.P..TSAI.G..L.G.DWIDLSGLIAPKEEV.IKLMEAIERHEIT.T.LTEIDQKFREFHAN...YYEYEWNWTVEF.IQKY..LG.......KP......I..T.E...F.AIEEIIDIVKQ.W.RESVVE....LDQMLYDDARKEFR.IDV...MTGFGI...DGDQQI.KQRDFESVR.GR.F..EENDFVKEILLHIERKTKLGERVINQL......................................................................
A0A1I5Z269_9BACT/44-736              ..............................................................................................................................................YRNLTAYEIEALVK.N.RNAS..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.YF..LE...FKD..M..KY.AVGLYNSNIV.SSDL...GD.N.....VSVEN..........V.....-N.......YLS..H..YI........IGNEVIIANTNEV.....A.........T.T........D..H..........AKFGNGIVkegep...........esiriwMEICNEN.GG.RSVIPFTGM................L.PGDAYLW..............S..K.F..R.D..DER..L.LQRFKEIT.EK.EF.K........KER.G..Y.HG..K..IGDRTVIKNSAIIK.D..CWIGSDAYIKGANKLKNLTI.HS...SEE...A..P...TQIGEGCELVNGIISKGCRIFYGVKAVRFVMAAHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIPAGAt..iGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTMLVkGDYL.YELDIP-LPFSLIs.....lN..Y..........K.......N..D..T.......L..E........IM.PAYwf.....................myNM..Y..A..L.A.........-...-.RNEWKYKDRDN.RT.E...K..F..Q..--LLEYEYLAPDSVNEMFASLQLLE.....L..FT.GK.A..W..YI........KNNkndinddeciqkgkq......................................llqqndtvineleivaTGFE.NSK.R........K-....T....V...IRk....aqAA.....YNAY...K..EMILHYGL.VHLI..K.S.......AEAN....E.I...T.D...A....SK.FSKAF....S.E..E--G.R..N.A.KWLNIGGQLMSEKDV.EVLKEQIKNQTIN.S.WDELHEAYYNEGKI...YPFKKAQHALAS.LLEI..EN.......IQ......P..E.N...I.SDKKIIEWLDK.A.VLINEG....ITKRIIQSRKKDYT.NPF...R-----...--KMVYgSEEEMNNVT.GS.F..NSNSFIKQKQEELESFRQLVQKL----kmkf..................................................................
C7PCB1_CHIPD/43-736                  ..............................................................................................................................................YRKLTALEIEILVR.N.DNTS..DD..WNN.I...F...V.........A...N.........E...F.N.....P.........Q.........LVKHCHFFGV...VRI..GKLEP.YY..LE...FHN..L..RL.PVGLYNSTIS.SCDF...GD.N.....AVIHN..........V.....-N.......YLS..H..YI........IGNEVIICNVNEM.....T.........T.T........D..H..........AKFGNGIVkeges...........eslriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.D..DAA..L.QQQFKVFT.EN.QF.D........KKR.G..Y.YG..M..VGDRSVIKNCKIIK.D..VTIGTDAYLKGANKIKNVTI.NS...SAE...A..T...SQIGEGCELVNGIVGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEVIAGRG---------FWPglcvslkhnS..RF..A..SFMLIAkGTYM.YEMDVP-FPFSLVl.....nD..E..........Q.......H..N..T.......L..R........IM.TGYwf.....................mhNM..Y..A..L.A.........-...-.RNSWKYIDRDK.RT.D...K..T..Q..--LIEYDYLAPDSVEEMIHSMALME.....-..IA.TG.Q..A..WY........LKFehdnaslsvhdfqekgkd.................................lllhdpeeagklqiyaanVENS.SRK.V........QL....L....K...VH.......RS.....YPLF...K..ELINLYAI.RNIF..S.Y.......IAQD....E.T...H.N...F....TT.LRGIV....E.-..--TA.E..R.G.PWHNVGGQLMKEETL.ADLKNQIRTGTIK.G.WAELHENYRIIGAH...YATDKLQHAIAS.LLHI..EE.......KK......A..R.D...F.TPAFLKECLLQ.S.LHMQTY....LTENIYRSRAKDYQ.NPF...R-----...--QMTYeNEAEMEAVV.GK.L..DDNSFIQQTLADLATYKQQVSTLIEQ-w.....................................................................
A0A437PRI1_9BACT/41-709              ..............................................................................................................................................FRPLSIREINILES.N.LNEA..EN..WKD.I...F...V.........K...E.........G...F.N.....A.........H.........LVKNCRFFGI...NRI..GKLEN.CF..LE...FKN..L..RM.PVGLYNSTII.SCDF...AD.N.....VAIDR..........V.....-N.......MLS..H..YQ........VGNEVMILQVNEL.....A.........T.T........A..T..........AKFGNGSVkkgee...........ekiriwLELGNEN.GG.RKVIPFLQM................K.PGDAYLW..............T..R.N..R.D..DKA..L.QEKYIEMT.LK.EF.S........SER.G..F.YG..Q..IGDRTVIKNTGIIK.D..VNMGPDTYIKGANKLKNLSI.LS...VPE...A..P...SQIGEGCELVNGIIHEGCRIFYGVKAVRFILAAHSQLKYGARLINSYLGSNSTISCCEVLNALIYPAHEQHHNNSFLCAAVVq.gqSNMAAGAt..lGSNH.NSR----GADGELQAGRG---------FWPglsvalkhnS..KF..A..SFNLISkGNYP.AEIHNP-IPFSLIg.....nD..D..........K.......T..G..G.......L..L........II.PAYwf.....................lyNM..Y..A..I.A.........-...-.RNAWKFEARDQ.RL.V...K..D..D..--LLEFDYLAPDTVFELLNAINLFE.....K..WA.GQ.E..W..LNd.....pkN-Anenle...........................................................lyvdgIENS.KKK.T........KI....A....K...VY.......KA.....YHAF...K..DILYYHAA.KELL..A.T.......MERN....Q.-...-.-...S....KD.PILLL....K.E..TISK.StpI.V.DWENVGGQLIPKSAL.QELKNNIKSGKVN.S.WLQVHQFYQAQAKL...YPDQKFENALNG.LIQV..LG.......KK......E..-.L...Y.EKETFTAWLNK.A.IIVSQN....LADGIKNSRKKDFQ.DPF...R-----...-LAMFG.NEEEMKKVI.GD.W..KSNDFILQAEKANKE------------fveklwkif.............................................................
D5EVI0_PRER2/4-603                   ..............................................................................................................................................YRQLTQNEIDVLEN.N.VCWA..ED..WQR.V...L...V.........D...E.........N...F.K.....P.........Y.........NFHRVMFYGD...IRL..GAFNK.MV..EV...SKG..F..TK.HSGINDATLR.NVTV...GN.D.....CLIEK..........I.....GN.......YIN..N..YT........IGNDCYISNICTL.....E.........T.T........D..D..........ATYGEGSV......................ISVLNEM.GD.GNVTIFREL................N.SQLASFM..............V..K.H..N.N..DKN..L.KQTLQQMI.ED.EL.R........VSR.P..D.RG..Y..IGNNVKIINAKDIT.N..TIIKGDCEISGAARLSECTV.MS...SMD...A..P...VFIGTGVICENSIICDGCSINNSVKMQDCFVGEACQITNGFTAEASLFFANSFMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPMHYGTLERGTKTASGAYVLMP.........A..TI..G..AFSVCF.GKLM.HHPDTRNLPFSYL.......L..A..........Y.......G..D..D.......C..Y........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RS.K...Q..S..R..KSIINFDWLSPFTVGEIMQGIQILK.....D..LR.HA.S..G..DN........VTT.....................................................................YNFH.EYV.I........NA....T....S...LR.......KG.....LKYY...D..IALRIYMG.AVL-..K.R.......AQKE....G.Y...I.-...-....--.----G....K.P..VSTT.G..Q.G.RWIDMSGLLLPESEE.QRLVEDIKNGNID.N.IHDVLDRFVEINNN...YSDYRWAWSYQM.ILDY..YQ.......L-......-..E.E...L.DEAACERIRED.Y.VRARRA....WIAEIRKDAEKEFQ.MG-...------...------.---------.--.-..---------------------------dveqdvye..............................................................
A0A1H4AHA9_9BACT/4-613               ..............................................................................................................................................YRQLTQDEINVLEN.N.SCWA..ED..WTR.V...M...V.........D...E.........A...F.S.....P.........Y.........GFHRVIFYGD...IRL..GKFEK.QV..EV...TKG..F..TK.HSGINDATLR.NVTV...GD.D.....CLIEK..........I.....GN.......FIN..N..YT........IGDDCYISNVSTM.....E.........T.T........E..G..........ATFGEGHL......................VSVLNEM.GD.GNVVLFHDL................N.SQLAAFM..............V..K.H..F.S..DKQ..L.KDTLLRLV.NE.EI.R........FTQ.P..E.RG..T..IGNGVKIINSKEIT.N..TVVKDDCEINGAARLSDCTI.LS...SKD...A..S...VYIGTGVICENSIISNGCSITNSVKMQDCFVGEACQITNGFTAEASVFFANSYMANGEACAAFCGPFSASHHKSSLLIGGEF....SFYNAGS....NTNF.SNHAYKMGPMHYGTLERGSKTASGAYVLMP.........A..KI..G..AFSVCF.GKLM.NHPDMRCLPFAYL.......L..A..........Y.......G..E..T.......M..Y........IV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RA.S...S..C..R..KSVINFDWLSPFTVGEIVEGKHILE.....S..LR.QA.G..G..KN........VSS.....................................................................YNFQ.EYI.I........NA....S....S...LT.......KG.....IKYY...D..IALRIYMG.AVLK..R.A.......-AKG....G.F...L.-...-....--.----G....K.P..TSTT.G..E.G.KWNDLSGLLLPASEE.QRLIDDIKNGTIE.S.IQDVLDRFNDINDH...YREYQWVWTYKL.ILDY..YG.......L-......-..E.E...L.NDAAMQRIRED.Y.VRARRA....WIAEIRKDAQKEFE.MG-...------...------.---------.--.-..---------------------------dveqdvfddfiskldhet....................................................
A0A2T5C700_9DELT/1-129               ..............................................................................................................................................--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................-MYN.SVK.I........TA....S....A...LE.......RG.....IEMY...Q..LGLVKFLG.NGLV..K.K.......LETA....E.Y...T.T...T....EE.MRKAL....Q.P..EGNE.G..V.G.DWVDIAGLLVPKEKV.DWLVEEIESGSLN.N.LNDINSKFATWKDA...YFHWAWNWIVPR.LKQY..AN.......LD......I..N.T...A.T----------.-.------....--------------.---...------...------.---------.--.-..---------------------------pk....................................................................
G1WBJ6_9BACT/1-614                   .............................................................................................................................................m-RQLTNEEINILEV.Q.SCWA..ED..WTN.I...H...V.........S...E.........D...F.K.....P.........N.........YMHRVMLYGE...IHI..GDFEK.NI..EV...SRG..F..LK.HSGINNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YT........IGDDCYISNVSAM.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GD.GNVILFSDL................N.SQLAAFM..............V..K.H..F.N..DRT..L.KDQLRHLI.NE.DI.A........RHR.S..D.QA..Y..IGNHVKIVNTREVN.N..TIVHDDCEINGASRLSDCTI.LS...TPA...A..N...VYIGTGVICENTIISEGSSITNSVKMQDCFVGEACHISNGFTASTSIFFANAYMSNGEACAAFCGPFTSSHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGTKTASGAYILMP.........A..HI..G..TFSVCF.GKLM.YHPDTRNLPFSYL.......V..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RM.P...G..S..H..KSIVNFDWLSPFSVGEILQGKEILE.....K..LR.EA.S..G..TD........VAS.....................................................................YTYH.NYV.I........HA....S....S...LN.......KG.....IKYY...D..IALRIYMG.AVL-..K.R.......VYKQ....Q.G...N.-...-....--.---YA....K.P..TTTV.G..Q.G.TWNDLSGLLLPDTEE.QRLCHDIKQGNIE.T.IQDVICRFEEIHRH...YRDYQWAWTYHM.ICNY..YH.......V-......-..D.D...I.TETTAEQTHDD.Y.VQARRA....WIAEIRKDAEKEYA.MG-...------...------.---------.--.-..---------------------------dvephvlddfinsldheinfe.................................................
A0A1H3WQQ1_9BACT/42-736              ..............................................................................................................................................YRQLSAFEIEVLVR.N.RNTS..DN..WNN.I...L...V.........S...D.........N...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.FF..LS...FSD..L..KV.AVGLYDSTII.SSDI...GD.N.....SVINN..........V.....-H.......YLS..H..YI........IGQEVILTNINEI.....Q.........T.T........D..I..........CKFGNGIIkegeq...........esvriwLELCNEN.GG.RKILPFNGM................L.PGDAWLW..............S..K.Y..R.D..DEA..L.LEGFKQLT.ET.EF.K........TAR.G..F.YG..K..IGDRTVIKNSNIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GEE...G..R...TQIGEGCELVNGSVGYGSRIFYGVKAVRFVTASHTQLKYGARLINSYLGSNATISCCEVLNSLIFPGHEQHHNNSFLCAATVm.gqSNIPAGAt..iGSNH.NSR----GADGEIVAGRG---------FWPalcvslkhnC..KF..A..SFTMLAkGDYN.YELNIP-FPFSLIs.....iH..P..........I.......T..N..A.......L..V........IM.PGYwf.....................myNM..Y..A..L.K.........-...-.RNAWKYGDRDQ.RK.E...K..A..Q..--HLEFDFLAPDTIWEMMESIRLLE.....K..YT.GL.A..Y..FK........SQSpqgqpfkepdldtliqkgk...............................ellsdpdspvesltilasgIENS.KRN.V........EI....I....K...VR.......HA.....YRCY...N..DMVRLYGY.QALF..S.E.......QRLN....E.V...K.H...L....KG.LLENL....P.T..--SP.K..R.Q.PWLNVGGQLILEKNV.ETLKDRVRNRKIQ.S.WDQLHEFYKTQGDK...YEEQKRTDALAV.LSEV..LA.......LN......P..A.T...L.SKDQLTGLAED.Y.LRIQKW....MVDQIVISRKKDYT.NAY...R-----...-KMMYE.NEKEMEAVV.GK.F..SDNSFIKDQKKTLKKLTEQL-------srfv..................................................................
A0A3N4QKE7_9BACT/42-731              .............................................................................................................................................h-RKLKAWEIEALVR.N.DNTS..DD..WNN.I...F...V.........D...N.........E...F.D.....P.........N.........LVQHCHFYGM...VRI..GKLEP.YY..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVVHN..........V.....-N.......FLS..H..YI........IGNEVIIANVNEM.....A.........V.T........D..H..........AKFGNGIVkegep...........envriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.H..DTA..L.LDRFKAFT.EK.QF.D........KKR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VMIGSDAYLKGANKLKNLTI.NS...EPG...A..P...SQIGEGCELVNGIVGFGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTLIAkGNYM.SELDIP-YPFSLVv.....nD..E..........H.......D..D..T.......L..K........VM.PGYwf.....................mhNM..Y..A..L.A.........-...-.RNAWKYVDRDK.RT.D...K..T..Q..--LIEYDYLAPDSAEELLNALELFE.....Y.aVG.KTfY..G..QK........DKAgkkslqqkgkqlll........................................eenakvgrtdifvegI--E.NSS.R........KA....Q....L...LKv.....hKA.....YPLF...R..ELINLYAI.RNLV..K.L.......AATF....N.I...Q.S...F....SA.LQAFC....K.N..---S.K..R.T.AWHNVGGQLVKADAL.EEVKNRIRKGKIG.S.WPELHDIYRELGAA...YEQDKLHHALAC.LLHL..QQ.......IS......A..K.E...L.TPALLKKCLEQ.S.VYTSGM....ITEGIYHSREKDYL.NPF...R-----...--QMTYeNEAEMNMVV.GK.L..EDNGFIQQTIADLKAYKKQVKEMIKK-w.....................................................................
A0A1N6N564_9SPIO/51-718              ..............................................................................................................................................WRNLTSQEVERLVK.N.NNYA..EN..WDT.L...L...V.........A...D.........P...F.D.....A.........G.........QIRNNRFFGL...VRL..GAVRD.VV..LE...YHD..L..LL.PAGISNSLII.SCDI...GN.D.....AALHN..........V.....-S.......YIA..H..YI........VGDRTILFNLDEV.....H.........T.T........N..Y..........AKFGNGIVkdgea...........edvriwLEVMNEG.GD.RKILPFDGM................L.SADAYLW..............A..R.Y..R.D..DRA..L.QQRLVEIT.QK.SF.D........SRR.G..Y.YG..T..IGNGSVIKNSRILK.D..VKVGDGCYIKGANKLKNLTI.NS...SLQ...E..P...SQIGEGVELVNGIIGYGCSVFYGCKAVRFILGNNSGLKYGARLINSFLGDNSTISCCEVLNNLIFPAHEQHHNNSFLVAAVVk.gqSNIAAGAt..lGSNH.NSR----ANDNEIEAGRGFWPGLATSLKHS.........S..RF..A..SFVLLAkADYP.AELNIP-FPFALV.......S..N..........Nv.....sR..D..R.......L..E........IA.PAFww.....................rhNM..Y..A..L.Q.........-...-.RNGWKVRHRDR.RL.S...P..G..Q..--AIEFDVLAPDTTEEICQALTILE.....P..WK.DA.E..G..PVeisreglsGES.....................................................................FGYE.RSR.R........-P....V....V...VHn....paGA.....CQAY...R..EMLVTYAV.TTLL..P.L.......AEELl..qQ.G...L.P...R....GG.VPEAL....D.A..AAEG.A..A.R.EWVNLGGQLVPEDEV.KRLRQDIGQGILA.D.WDSIHQRYQDLWNR...YEAQKRSHAAEL.LRFW..GG.......--......Q..E.R...I.DEPLWARACRE.A.IALQEM....IAERVYLSRQKDDL.NPF...R-----...-RATYR.CAEEMYAVV.GS.A..GENSFVLQVQADTKELAR---------riagv.................................................................
R5I224_9BACT/5-660                   ..............................................................................................................................................YRQLTAEEISVLRT.Q.GCWA..ED..WQH.I...Y...V.........S...E.........R...F.T.....P.........E.........SIVRVNFYGV...VRL..GAFSG.SI..AL...PGG..L..SI.HSGIYDATLF.NVNV...DD.D.....ALITH..........I.....HG.......YIA..N..YD........IGPRVYICDVGKI.....Y.........M.E........G..V..........PSFGIGTR......................VNVLPET.GG.REVAIHEEL................S.AQTAYLS..............A..M.Y..R.H..RPE..L.TERLHAMA.DI.RA.R........AVA.S..E.RG..T..IGPGARIENVGIIR.N..VRIGEAAVLQGCLRLFDGTV.VS...STD...A..P...VLIGSGVVCTDFIVQSGSVVENGAVVTRSFVGQGVTLSKGFSCSDCLFFANSHCENGEAVSVFAGPFTVSHHKSTLLIGSMF....SFMNAGS....ATNF.SNHQYKLGPVHQGVFGRGVKCGSGSYMMLP.........V..RV..A..PFTTVL.GHHT.GRIDTPDMPFSYI.......L..E..........S.......E..G..R.......S..Y........LV.PGV.........................NL..R..S..V.G.........L...F.RDIRKWPSRDR.RS.L...S..G..R..MDNISFEVFSPYTAGAMLSGRDRLV.....Q..ML.SE.E..R..FS........GTP.....................................................................SSYG.GCT.I........AG....S....S...LT.......SG.....VERY...E..KALKYYVG.LQVA..L.A.......LRGR....K.L...G.S...D....EA.ITAAL....T.P..VSPV.G..D.G.RWIDVAGLLAPKAEI.DQIVEEVVSGSLD.T.PGAVESRLSAIASN...YQLYEWRWVYAH.IRTV..YN.......VD......P..Q.K...I.TRKKLIELLRQ.W.RAASES....LFADIEMDASKEFG.EGG...MTGFGL...DVTDRDeILADFRHVR.GE.F..DSDSQVAAVRETRERVAMLADEVLSA-l.....................................................................
A0A3N2N7V4_9BACT/79-558              ............................................................................................................................................di--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..-R........IGADVTIENVGLL.....E.........M.E........T..E..........ALCGIGTE......................VCVLDET.GS.RSVRIFPGL................T.AQLAMLV..............A..R.D..P.AwaEGP..V.KESFDEHI.NN.YP.L........DR-.-..-.--..A..IGDGAVIRNCGLLF.N..VAVGREVRIEGASSLRNGAV.IN...NAAhgrA..L...ARIGAGVDADGFIIEDGV-VDSAAIIRHCYIGQGAVIEKGFTAHDSLVFSNCSLENGEACALFAGPYTVSMHKSSLLIGCQT....SFMNAGS....GTNQ.SNHMYKLGPVHWGLLERGVKTSSGSYLMLG.........A..KI..G..AFSLLM.GQHK.THPDSSQFPFSYL......fG..D..........D.......R..G..A.......T..V........VV.PGA.........................ML..R..S..C.G.........L...M.RDEKKWPTRDR.RQ.K...R..R..LplHDRIIFDVLNPLTVGAMLDALEVIR.....K..LL.AL.P..A..DD........DRF.....................................................................LRYK.GMK.F........TR....A....A...LE.......RA.....SHLY...R..LAIYKYLH.LHTA..-.-.......----....-.-...-.-...-....EN.GFPA-....-.R..EPGV.E..A.A.SWVDIAGLLMTRTSL.EHAMS---KES--.-.ITEIEQVFDNAFRH...YPNLQRSWIAGR.FDDS..WR.......RP......A..E.V...I.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------adyaaefdrmieedrhky....................................................
A0A1W9N6S8_9SPIO/23-682              .............................................................................................................................................p-RPLSNEEISLLEQ.Q.GNRA..ES..WRD.I...S...V.........G...E.........G...F.Q.....A.........E.........RIHGCRFLGK...NYI..GGTSR.QE..LD...AAE..Q..QH.PIGLYNSLII.GCHI...AG.N.....AAIHN..........V.....-R.......RLA..N..IR........VEARAALFNIGEI.....S.........T.E........P..G..........AEFGAGTW......................MKIANEN.GG.RSVQAVDGM................L.PADAWLW..............A..K.Y..R.G..DEE..L.MQRFAEIS.RQ.AI.NasiaatpaEQN.P..P.GG..I..IGAGTIIQHCGILR.N..LRIGPSARIEGSSRLQNLSI.NS...SPQ...A..P...TIIEEACTLSDGIISHGCRINSGASAQRFVLGEHSTLELGACLTDSVLGPNSRISCGEVRCSLLFYTHSQPHKSSFLCAAVIk.gmSNLAAAAa..iGSNH.NSR----VGDGEISAERGFWPGLGVSLVHN.........S..RF..A..AFTLIAkGAYP.AQLDIP-LPFCLL.......S..N..........S.......P..DgkE.......L..R........VM.PGYwf.....................qyNL..Y..G..L.A.........-...-.RDCAKTAARDA.RT.G...T..H..Q..--PLEYHWLAPDTAEQMLHACKLLE.....Q..WE.SE.Y..E..AP........SLAtanpti.........................................................mlppgiLEAS.SRP.I........RI....L....H...AG.......HA.....YRNY...L..RLLRFYAV.QVLL..T.S.......GAAE....D.L...T.L...S....QP.QPPAS....S.S..PRPL.P..P.P.EWDNIGGQLIKKTTL.ETLKTALKTGRIN.D.WPGVHRFYAEAAAA...YPAHRRAQALQL.LRQC..AP.......GE......-..-.-...-.---SPQSLIRE.A.LATAEF....IHNGISASRRKDYE.SQF...R-----...-NHLYS.SEHERDAVL.GH.F..DADELIAASKQQLDEFRRL--------agfl..................................................................
G8TPC3_NIAKG/42-735                  ..............................................................................................................................................YRHLSAYEIEVLVR.N.RNTS..DN..WNN.L...L...V.........S...D.........A...F.N.....P.........E.........LVQNCKFFGL...VRI..GKLEP.YY..LE...YHN..L..RR.PVGFYNSTVI.SCDF...GD.N.....VVVDN..........V.....-N.......YIS..H..YI........VGNGVILVNCNEI.....A.........T.T........D..H..........SKFGNGILkeges...........envriwVELCNEN.AG.RSILAFDGI................L.PGDAFLW..............T..Y.F..R.D..DDN..L.LNRFKEFT.EK.KF.D........ALR.G..Y.YG..T..IGDRTVVKNCKILK.D..VKIGSDAYLKGANKIKNVTI.NS...SSE...A..N...TQVGEGCELVNGIIGYGCRLFYGVKAVRFVLASHSQLKYGARLINSYLGENSTISCCEVLNSLIFPSHEQHHNNSFLCAALIq.gqSNMAAGAt..vGSNH.NSR----SPDGEIIAGRG---------FWPglcvslkhnS..KF..A..SYAILAkGDYA.TELNIP-LPFSLI.......S..Nd........lS.......K..D..Q.......L..V........VM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKYIDRDK.RI.D...K..I..Q..--QLEFSFLAPDSVNDLLQSLPLLA.....K..FT.GK.A..W..LK........REGntkkmtddeiiaigqvl...................................ldtkdpvvnelvvladgFENS.KRP.V........RI....I....K...VM.......KA.....YHLF...K..ELVMYYLV.QQLL..E.H.......IRTN....N.I...K.T...H....EQ.LIESL....P.S..K--A.A..R.A.PWMNVGGQLILRSEI.DKLNKQIVAGRIK.D.WDAVHNFYVQQGKN...YQMEKLAHAMAA.VREV..FD.......IN......L..K.K...A.SPGIIKSLLHQ.S.ITTKEW....MVKEIYESRAKDYR.NPF...R-----...--KMVYeTTEAMNKVV.GK.L..EDNSFIKQEQKALEEYKKDIHQLVTKL......................................................................
F9D8R2_9BACT/3-600                   ..............................................................................................................................................YRALTDNEIFILEN.N.NCWA..ED..WSK.I...E...V.........D...E.........D..gF.Q.....P.........K.........FLHRVILYGD...IRL..GAFEK.NV..EV...SKG..F..FK.HSGINDATLR.NVTV...GN.N.....CLIEK..........I.....GN.......YIH..N..YT........IGDDCLIANVSVM.....E.........T.T........E..G..........ATYGQGNV......................ISVLNEA.GD.GNIIMFPEL................S.SQFAALM..............V..K.H..F.K..DKD..L.KNAIRRLV.SE.EI.A........RLT.P..A.VS..T..IGNNVKIVNSKEIT.N..TIIHNDCEISGASRLCDCTI.LS...SAH...A..N...VYIGTGVICENSIISEGSSISNSAKIQDCFIGETCHIANGFTASQSVFFANSYMANGEACAAFCGPFSVSHHKSTLLIGGLY....SFYNAGS....GTNF.SNHAYKLGPLHYGTLERGCKTASGSHIVMP.........A..TI..G..AFSVCF.GKIT.NHPNTKTLPFSYI.......I..A..........Y.......N..D..K.......P..C........IV.PAR.........................NI..A..T..V.G.........L...Y.RDIKKWYKRDL.RP.Q...G..S..Q..KSVINFEWLSPFTANEIVRGRNTLR.....A..LK.KA.S..G..AT........SDC.....................................................................YIYS.GYT.I........KA....S....R...LN.......KG.....IQLY...D..IALHIYMG.EMLR..K.A.......----....-.-...K.H...L....GI.LDK--....-.P..LELD.S..I.N.AWSDLGGLLLPDFEE.QRILEDIKSGSLE.T.IEDVNDRFKEINSN...YYRYAWDWTRFL.IKSY..YD.......--......S..K.E...V.TEDIEAQIVSD.Y.NDALKT....WISEIRKDAEKEYS.MG-...------...------.---------.--.-..---------------------------dvdke.................................................................
A0A1R3T8W8_9BACT/4-658               .............................................................................................................................................h-RNLTQSEIDQLEK.N.GCSC..TD..WGL.V...T...V.........K...E.........G...F.N.....P.........R.........YVRESHFSGK...VEI..GIFEK.IF..SL...PGG..L..QK.HAGINRAVIH.NCTI...GN.N.....VMIEN..........V.....QN.......YIA..N..YT........IGDNCFIQNIDVI.....L.........V.D........G..M..........TTFGNGVQ......................VNVLNET.GG.REVHINDKL................S.AHFAYIY..............S..L.Y..R.H..RPK..L.VERMKAII.DY.YC.D........KHS.S..D.RG..I..IEHDCKIVNVGYIK.N..VRIGSFCKITGAMKLKNGSI.NS...NEY...D..P...VYIGRNVIAEDFIICSGSTIDGGSIISRCFIGQACHIDHGYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIIERGAKTTSNSYVLWP.........A..KV..G..PFSLIL.GRHS.QHADTSNLPFSYL.......V..E..........K.......D..N..G.......T..Y........IA.PGV.........................NL..R..S..V.G.........T...I.RDAKKWPERDR.RK.D...P..D..R..LDCINFNLLSPYTIQKVFAGVGILK.....N..LQ.AV.A..G..ET........SEF.....................................................................YTFQ.SCV.I........TN....S....S...LL.......RG.....LKLY...E..IIIHKFLG.NSLI..K.R.......LEKT....R.F...K.S...N....EE.IRQRL....D.P..QGAP.G..L.G.EWVDVSGLIAPKSEI.DDLLCKIESGEIT.K.LKEINHIFQQLHQD...YYDNEWTWAWDK.IQSF..YG.......IK......A..D.E...I.TASDVISIVEK.W.KAAVIG....LDEMIYSDAKKEFS.LSF...KTGFGA...DGNIQD.RAMDFEYVR.GA.F..DKNPFVIATLKHIEEKRALGDELIERI......................................................................
A0A3N2M144_9BACT/67-570              ............................................................................................................................................pd--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.-VSV...GE.G.....ATLQN..........I.....SG.......RIS..N..CH........VGANAVIDNVYLI.....E.........F.D........K..E..........AACGVGTA......................VCALDET.GS.RPVVIYPGL................S.SQAATLM..............A..-.-..R.I..PKW..F.ENNIHPTL.HD.FL.D........T-R.S..V.RT..E..IGENAVVRDCGRLV.N..VSVGAGVKVEGARSLVNGAI.IN...NVL...SgrP..lAYVGYGVDAENFIIEDGMA-DCGAILRNCYIGQGAHVEKGFSAHDSLFFTNCSFENGEACALLAGPYSVSMHKGTLMIGCQT....AFMNAGS....STNQ.SNHMYKLGPVHWGVLERGVKTASGAYIMFG.........A..KI..G..AFSMIM.GAHK.THPDSSDFPFSYL......fG..D..........E.......R..G..A.......T..V........VV.PGA.........................ML..R..S..C.G.........L...L.RDEQKWPTRDR.RL.K...H..RmpM..YDRITFDVLNPFTVDSMLKAIDTIT.....T..LL.SR.P..A..DD........DLY.....................................................................IRHK.GMK.F........TR....A....A...LE.......RA.....KTLY...T..AAIYKYLS.KTLP..D.S.......V---....-.-...-.-...-....--.----F....P.D..SDGE.E..A.E.DWLDVGGQIMPRPYL.DKALEA------T.S.LDEVEKIFDDAFAN...YAELERKWIARR.FGAE..WR.......RR......S..D.F...I.T----------.-.------....--------------.---...------...------.---------.--.-..---------------------------mgaqqfdemviddrqeyldnlsr...............................................
A0A4R6IXJ4_9BACT/44-736              ..............................................................................................................................................YRMLNAYEIEVLVR.N.RNTT..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.YC..LG...FSD..L..KV.PVGLYNSTII.SCDF...GD.N.....VCIDN..........V.....-N.......YLS..H..YI........IGSEVIITNVNEL.....V.........V.T........N..H..........AKFGNGIIkqges...........eevriwMEICNEN.TG.RRVLPFNGM................L.AGDAYLW..............S..R.D..K.H..DHV..L.QEKFRSFT.EA.RF.D........NKR.G..Y.YG..K..IGDRTVIKNCNIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GEE...G..R...TQIGEGCEAVNGIIGFGCKMFYGVKAVRFIMASHSQLKYGARLINSYLGHNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIAAGAt..iGSNH.NSR----GADGEIIMGRG---------FWPglcvslkhnS..VF..A..GFTILTkGDYP.SELNIR-LPFSLV.......S..Nd........vS.......K..D..Q.......L..V........IM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKYVDRDK.RT.D...R..A..Q..--LIEYDYLAPDTVNEMFASLSIIE.....E..AT.GR.A..Y..HQ........QQNnskkilsqeeaivmgkq..................................lltgnnklvddleitvdgFENS.KRK.V........VI....T....K...AR.......IA.....YHLF...I..ELIRYYGC.IHLL..D.L.......ITEL....Q.I...K.S...V....DA.LKAAI....P.-..-LKI.K..R.G.EWVNIGGQLITAEDH.LQLKERIKTGKIK.S.WDDVHAQYIILGNK...YPAQKRTHALAS.LAEI..AE.......LS......F..K.K...L.TQDQLSQLLNN.T.LTTKEW....MTKGIHDSRAKDYQ.NPF...R-----...--KMVYeSFEEMNVVV.GK.L..EDNSFIKQQLTELTVFK----------qkiaglkk..............................................................
W7Y5M9_9BACT/3-651                   ..............................................................................................................................................YRSLTSKEITTLES.N.HCTA..ID.gWDK.V...Q...V.........A...A.........N...F.V.....S.........K.........HLKNVTFSGY...NYL..GVFSD.KI..KL...PST..A..LD.YSGIYNAHLH.NCTI...KD.K.....CYIKN..........I.....GT.......SIS..N..YI........IEENCIIQDVSTL.....M.........V.D........R..V..........SSFGNGTT......................VKPINEA.GG.REVIIYDAL................S.AHTAYLM..............A..F.Y..R.H..NPT..F.TENIQKSI.LN.HV.K........NLQ.S..P.TG..Y..IGTNTVIINCASLK.N..IKVGPHALLEGVQNLNNGSI.NS...SYL...A..P...SHIGPGVDAADFIISSGSTISGNTYLRNCFVGQGCEMSHSYSAENSLFFANSQCMQGEACSIFGGPYTVTHHKSTLLIAGYY....SFYNAGS....GTNQ.SNHMYKLGPVHQGIIERGGKTGSDSYIMWP.........A..QI..G..AFTMIL.GRHY.NNPDTASLPFSYL.......I..E..........V.......E..G..K.......S..V........LM.PAQ.........................NI..F..N..V.G.........I...T.RDAQKWIKRDK.RK.G...N..K..H..LDYIISEVLNPHTIHKILDAIKTLR.....Q..LQ.QK.A..S..PQ........SKN.....................................................................IMYK.NVQ.L........SL....A....S...IN.......RG.....IKLY...E..QALVKYVG.DELL..S.V.......LKHT....N.F...D.H...-....--.IKKSF....V.-..--FP.Q..H.N.QWVDLSGLICKTSRL.NKFIEQIENNSL-.N.IDEWNLFYKEQFDD...YKMLKQAHVFFV.LKQY..FK.......ID......I..T.H...C.TTTELVNFIKE.W.SANNTQ....IMHSIIMDAKKEFN.AKS...KIGFGI...DGNQDC.RNIDFNIVR.GS.A..DNNSFIQELELEYKNKDEEAARIIKQL......................................................................
A0A1M4X3C3_9BACT/42-733              ..............................................................................................................................................YRNLTAYEIEVLVR.N.NNTS..DD..WNK.L...H...V.........S...D.........A...F.T.....P.........E.........LVKNCKFFGL...VRI..GKLEA.IS..LE...YHN..V..CM.PVGLYNSTII.SCDF...GD.N.....VVINN..........V.....-N.......YIS..H..YI........VGNEAMISNVHEL.....H.........V.T........D..H..........AKFGNGILkegeq...........enirvwVEVCNEN.AG.RKILPFNGM................L.PGDAYLW..............S..K.Y..R.D..DDE..L.MEKFKQLT.EK.QF.D........KLR.G..Y.YG..K..IGDRCVIKNTSIIK.D..VWIGSDAYIKGANKLKNLTI.NS...NPM...A..Q...SQIGEGCELVNGIIDYGCRIFYGVKAVRFVMGSNSQLKYGARLINSFLGNNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIAAGAt..iGSNH.NSR----AADGEFVSARG---------FWPglcvslkhnS..KF..A..TFTLLAkGDYP.NELNIP-LPFSLVs.....nD..E..........S.......K..D..R.......L..I........VM.PAYwf.....................myNL..Y..A..L.A.........-...-.RNETKYLDRDI.RP.E...K..I..Q..--FIEYDCLAPDSINEIFSAVSLLK.....K..LV.AR.A..Y..DP........SLSsdtvsettlehkgea......................................ilndqtidfskleivaHGFE.NNT.R........PV....I....I...IKa.....kEA.....YFVY...K..RLIVYYAA.VNLL..R.Y.......VEDN....K.I...L.T...F....ES.LVDSL....P.A..E--P.I..R.L.SWANIGGQLMPEPSV.STLLNSIKTGNIQ.S.WEEVHDFYRINGAL...YKDQKLQHAYAS.LMEM..AK.......PP......S..K.R...L.TKDLFKQILDE.A.LATKEW....MTENIYTSRAKDYQ.NYF...K-----...--KMVYdSEKEMEAVV.GK.L..EDNSFINQQNEELATFRKRVQNL----lln...................................................................
A0A4R1LZX2_9SPHI/42-736              ..............................................................................................................................................YRNLSAFEIEVLVK.N.GNTT..DN..WNN.I...L...V.........S...D.........A...F.N.....P.........E.........LVKACKFYGL...IRI..GKLEP.YF..LE...YND..F..RV.PVGLYNSTII.SSDF...GD.N.....VAIDH..........V.....-N.......YMS..H..YI........IGNEVVIVQVDEM.....K.........T.T........A..N..........AKFGNGIIkdges...........estriwLEICNEN.GG.RKVIPFNGM................L.PGDAWMW..............S..K.Y..R.D..DKA..L.LDNFIKFT.ET.EY.K........TEP.G..Y.YG..K..VGDRTIIKSTNILN.D..VWIGSDAYIKGANKLKNLTI.KS...SAE...G..R...TQIGEGCELVNGIIDFGCRIFYGVKAVRFVIASNSQLKYGARLINSYLGSNTTISCCEVLNSLIFSAHEQHHNNSFLCAALIl.gqSNIPAGAt..iGSNH.NSR----GADGEVIAGRG---------FWPglcvsmkhnS..KF..A..NFTILAkGDYD.YELNIP-IPFSLIs.....iD..E..........E.......H..N..S.......L..I........VM.PGYwf.....................myNM..Y..A..L.Q.........-...-.RNTFKYKDRDK.RY.E...K..I..Q..--HIEYDYLAPDTINEMFSSISLFE.....T..LV.GK.A.yN..EK........FDKdsilteeeyaaigkkl....................................lteknevindleitapnLENA.KRK.V........KI....I....K...IQ.......RA.....YDLF...H..SMIRFYGI.THLM..A.H.......ATQH....N.E...F.S...M....KK.LVADL....S.R..KRL-.E..R.T.EWLNVGGQLIPEEDV.LELRKSIRSNEIK.S.WDAIHEYYVEEGER...YEEKKTLHAITA.LLEI..EE.......IT......I..S.K...V.NKKLFTEWVKE.I.KNTKQW....MVDSIESSRKKDYT.NPF...R-----...-KMMYD.TQEELDEVL.GK.F..DDNVFIKDQKAELKVFNKNLNSF----akki..................................................................
G0GBI4_SPITZ/26-462                  .............................................................................................................................................s-RPLTPTERAALEA.Q.GNRA..ED..WEA.I...R...V.........H...P.........S...F.T.....P.........R.........GIWYSTFRGS...CYL..GLFEP.S-..--...-DN..D..LF.PEGIYHSVIR.HTVV...CS.H.....ARIHH..........C.....-P.......LLS..N..LY........IDVGAEVIH---T.....T.........S.H........T..P..........GPFHAGVLp....................tISPGIET.GG.REITPCDVL................T.PDLAIAL..............T..T.R..P.L..PDS..L.EEAYANFL.TH.YR.G........TTL.F..P.FS..Y..IGPKAHVAHCSTLS.S..VYTGPHAAVTGS-SLTYVTI.HS...SEE...A..P...SIVGDHTILQEAILQEGVHVTTGALVRRSLLMEATGVEDHGKVETSIILPNTHIAKGEVTASLVGPFVGFHH-QSLLIAAWWpegkGNIAYGAn..vGSNH.TSR----QPDQEIWPGEGMFFGLGCSIKFP.........A..HFrdA..PYTTIA.TAVM.TMPQRMEYPFSLItqpisypS..E..........V......pT..A..Y.......N..Q........LM.PGW.........................ML..TgnA..Y.S.........L...F.RSEEKFRTRNK.AR.R...Y..R..P..----EFEIFRPRILFLMDRALDRLS.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------sigsp.................................................................
A0A1B1S881_9BACT/4-654               ..............................................................................................................................................FRELTIDEITQLRQ.N.GCHS..NE..WVR.V...K...V.........A...D.........P...F.Q.....P.........C.........HYHDCVFIGD...IRL..GITEG.SL..RG...LGG..L..DF.PTGIYSATLR.DCEI...GD.N.....VRISH..........I.....RE.......CIV..N..YR........IGSNTCISNVGSI.....I.........C.N........G..R..........TAFGNGVK......................VNVMEET.GS.RVNLIYDKL................S.AQISFLQ..............T..I.Y..A.E..NTQ..L.IEALHNMI.RR.YA.E........EHS.S..D.TG..E..IGSYVTITDTTRIQ.N..VRILDRATISGASALINGTV.GF...RA-...-..-...-TVGCNVIAENFIISSEAVVENSVLVHNAFVGQASQIRNGFTAHDSVFFANCHMECGESCSIFAGPHCVSHHKSTLLIAGYY....AFFNAGS....NSNQ.SNHLYRTGPIHNGILEHGCKTGSNSYIIWP.........A..HF..G..DFTLVL.GKHS.RHPDTSALPFSYA.......I..G..........Q......pN..G..E.......S..L........IY.PGA.........................NV..K..T..A.G.........T...I.RDILKWRIRDK.RS.H...D.iP..K..LDYVNTVSLSPLTAIVLYRALSVLE.....Q..IE.AD.-..-..EN........YDY.....................................................................PRRH.NFR.L........KR....E....Y...IR.......KG.....REYY...A..LAIDYFMG.ETIV..K.K.......LLHT....P.L...N.P...D....KT.LWEQL....Q.E..EPVN.V..A.G.DWADIVSLIVPESKI.KDIFSSIIDGTIT.S.VEQLSERLNYEGSQ...YDHYAWTFVCHN.FNKC..YS.......VN......I..E.D...I.TPEILVSVIDR.W.TESVRS....LDQMRRDDAMRDFT.--Q...QIGYDT...DFDSPG.EWLDDSMIN.KE.FnpESNPQIMSMHNHYVQA-----------lldahqvttel...........................................................
R6SVY6_9BACE/4-659                   ..............................................................................................................................................YISLTAQQIAQLEA.Q.SCRC..ED..WTN.V...L...V.........D...P.........E...F.D.....P.........E.........YIRNANFSGQ...IKL..GAFRK.IF..TL...AGG..I..HK.HSGIYHATLH.NVVV...GD.D.....CMIEH..........V.....RN.......YIA..N..YV........IGRGSYLENVTDL.....I.........T.Y........G..E..........TTFGNGIK......................IKVLNET.GG.REVAIHDHL................S.SHEAYIS..............A..L.Y..R.H..KPA..L.TEALDAMV.ER.YA.A........SVC.A..P.FG..V..IGENVEILDAMHIV.N..VNVGAYCKIKGVSRLRNGSI.IS...CKE...D..P...VEIGMNVIADDFIVESGSKITDGVMISKCFVGQACVLGHGYSASESLFFSNCQGENGEACSLFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGILERGAKTTSDSYILWP.........A..KI..G..AFSLVM.GRHV.NNLDTTDLPFSYL.......I..E..........Q.......Q..G..S.......T..Y........IV.PGV.........................NL..K..S..V.G.........T...I.RDVKKWPERDR.RK.D...P..H..R..LDHINFNHLSPFTVQKMFSGIDILE.....R..LK.EA.S..G..LR........ADN.....................................................................YSYK.KAT.I........RN....A....A...LF.......KG.....IKYY...Q..TAIVKFLG.NSLI..S.R.......IQDF....D.I...S.T...D....EG.LRRAL....R.R..DTSV.G..S.G.QWVDISGLIAPASEI.ERICDDVISGVIA.D.VNVLSDRFLDIFNH...YYSYEWTWAYDA.IERY..WK.......ID......L..S.K...I.TRSEAAEIVKQ.W.KNAVVS....LDKLIYDDASKEFA.LTS...MTGFGA...DGDKTR.RDEDFNAVRgGG.F..DDNPFVQEVLDHIRRKSALGDSIIARL......................................................................
K5Y9S5_9BACT/7-661                   ..............................................................................................................................................FRHLQSEEIVDLEM.N.GCTA..DN..WEN.V...K...V.........A...S.........P...F.H.....A.........E.........HVCNVHFSGS...VAL..GLFEK.EF..TL...PGG..V..KK.HSGIRNATLH.NCKI...GD.N.....TLIEN..........V.....HN.......YIS..N..YF........IGDDCFIQNVNVV.....Y.........V.E........G..R..........SSFGNNVE......................VSVLNET.GG.REVPIYNGL................S.ASLAYLI..............A..L.Y..R.H..RPA..L.IHRLQAMI.AD.FA.D........LQT.G..S.YG..F..IGNHVKIINTGTVR.N..TVIADYATVENCTRLDNGTV.NS...NEN...A..P...VYIGDSVIAEDFIISSGAVVADAAKIIRCFIGQACHVTHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RV..G..AFSLVM.GRHH.HHSDTSDLPFSYL.......I..E..........K.......D..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..E..R..LDMINYNLLSPYTIYKMMKAVGILK.....N..LQ.EL.V..G..ET........SEV.....................................................................YYYQ.NTR.I........KG....S....S...LR.......TA.....LDLY...G..MAINKFLG.NSLI..K.R.......LEGT....D.F...R.S...M....DE.VWAQL....R.P..TSSA.G..R.G.EWLDLSGLILPREEL.DGLIEKVEEGEIT.S.LDAIGEFFAAMHSN...YYDMEWTWAYDM.LEEY..YG.......VN......L..S.S...I.SAAQIVDLVRR.W.QDSVIG....LDNLLYKDAKKEFS.LTF...MTGFGV...DGSDKE.KQEDFEGVR.GA.F..ESNPFVTAVKEHIVVKRALGDELIGRM......................................................................
R5C5X4_9BACE/25-679                  ..............................................................................................................................................YRNLTEDEIFRLKS.Q.SCQA..DD..WEK.I...R...V.........S...E.........N...F.S.....T.........E.........FVHHARFSGE...VKL..GVFQT.EF..TL...PGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDIL.....L.........V.D........G..V..........SKFGNGVE......................VSVLNET.GG.REVVINDKL................S.AHLAYIM..............A..L.Y..R.H..RPE..L.TARLKEIA.DY.YA.G........KHA.S..S.VG..T..IGCHVTILNTGSVK.N..VRIGDYAYISGACRLSNGSI.NS...NEA...A..P...VRVGDGVICDDFILSSGSHVDDGAMLTRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RK.D...P..N..K..LDFINYNLLSPYTVQKMFKGRDTLL.....N..LC.QA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....S...LV.......NG.....IRFY...E..IAIHKFLG.NSVI..K.R.......LEGI....D.F...R.N...D....DE.IRTRL....C.P..DTSI.G..S.G.EWVDISGLIAPKSEV.DMLIANIENGTVN.R.LKEINAEFERMHRN...YYTYEWTWAYEK.LEEY..YG.......VK......P..E.E...V.TAADIICIVEK.W.KEAVIG....LDRMVYEDAKKEFS.LAS...MTGFGV...DGSRLE.KEMDFEQVR.GD.F..ESNPFVTAVLKHIEVKSALGDELIERM......................................................................
W4G6I9_9STRA/41-493                  ...........................................................................................................................................spv----TPAQIQLLEQ.H.GNRA..DS..WDT.V...Y...T.........S...G.........S...L.A.....T........lI.........RVRNCTFRGR...VHL..GSFTK.DV..MV...-DN..V..PF.PSGCYNTTIV.DSFV...LD.D.....ALVQD..........T.....-F.......LLH..R..TY........VSHGAVVVGCGTI.....T.........C.S........G..T.........dVTNGNGTV......................LKVGVEI.GG.REIAMFADM................P.FHLAAVV..............G..E.T..R.G..NVS..E.LKAYEDLV.RT.YT.K........KVQ.C..DgFN..V..IAHQAKLLRCPKIR.D..VFVGDAAVLEDS-VVSNSTI.LS...SPA...E..V...SSILGFSQVHSSILQWNAHVHSGSSVERSFLCDCSRVERHGVVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..rGRGNVGY....GANVgSNHTLK-APDQELWPGEGVFFGLSVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALI......nT..P..........G.......H..N..I.......P..D........LS.PAInei..................ypgwVL.sH..S..IfT.........V...L.RNQDKFDKRNK.SK.R...T..N..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------vdspifrsdiimmmqvacqrlvdaekkpvnlrhgkqi.................................
K8YVE9_NANGC/20-254                  ..............................................................................................................................nerdrataskdspviy--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.-T..I..IGHDAIVQCCPRVV.A..SFIGPFARLENS-EVESSSL.LS...GRE...E..A...TWVVEGSVVSRSLLQEGVAVRGHALVRDSLLMEHSSVDTGGKCSHVVLGPDSGVATGECHHSLVGPC-VGFHHQSLLIAALWprgrGNVAYGAq..iGSNH.TGR----AADQECLVGEGIFFGLGVLVKLP.........V..NLshS..PYSLVAaGTSL.DQQRLH-FPFSLI.......A..A..........S.......R..D..G.......A..F........L-.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------rqcledrmgdmetr........................................................
A0A1H6CFG5_9SPHI/42-712              ..............................................................................................................................................YRNLTAEEIQILEM.N.HNES..TD..WND.V...L...V.........T...D.........K...F.F.....P.........K.........QIKRSKFFGL...VRI..GDMEE.VY..LE...YRD..I..RL.PVGIYNSQII.SCDL...GD.C.....VALHQ..........V.....-R.......YIA..H..FI........VGNEVILLNVNEM.....E.........T.S........S..N..........AKFGNGILkagdq...........dssriyLELCNEN.GG.RSVLPFDGM................Q.AADVYLW..............T..R.N..R.Q..DKV..L.QQRFWDIT.HA.GF.N........DIR.G..Y.YS..E..IGDRTVIKNSHTFK.N..VKIGSDAYIKGISKLKNLTV.NS...TSE...A..Y...TQIGEGCELVNGIIGYGCRVFYGVKAVRFILSSYSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVk.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIK-FPFSLI.......S..N..........Dv.....tH..D..R.......L..V........VV.PGYwf.....................myNM..Y..A..L.M.........-...-.RNTNKFISRDK.RS.F...K..N..Q..--YFEYDILAPDTVNELFTGLSE--.....-..IE.RA.V..G..KT........LGIadprgwle....................................................aegkateeiF-VD.NAE.F.......sKR....Q....V...LL......lKP.....RESY...K..LFKKLIRY.NAVC..Q.V.......LEHV....A.P...AvV...Q....EK.INDFI....A.S..GT--.K..R.V.QFENIGGQLVPVPKL.EQLLDDLKKEEVN.S.WAAMHARYHQMSNE...YITDKLHHALAS.LAEV..TE.......RD......A..T.S...W.DAPFWNELLDE.A.LATKKW....ICEEIHNSRSKDYH.NPF...R-----...-LMVYE.SVEEMNEVV.GR.L..EDNSFINQQTAEFENF-----------tskvaa................................................................
A0A239RHX5_9BACT/4-602               ..............................................................................................................................................YRQLTEEEIQVLEN.N.SCWA..ED..WTA.V...N...V.........A...E.........D...F.K.....P.........N.........YMHRVMLYGE...VNI..GAFSR.SV..EV...SKG..F..FK.HAGINNATLR.NVTL...GD.D.....CLIEN..........I.....GN.......YIN..N..YT........IADNVYISNVCTI.....E.........T.T........E..G..........ATFGEGNL......................ISVLNEV.GD.GNVILFKDL................N.SQFAAFM..............V..K.H..A.A..DKP..L.RDAIRRLI.NE.EI.R........RTS.P..E.RG..T..IGSNVKIVNTKEIT.N..TVIADDCEINGASRLSDCTI.LS...SLN...A..S...VYIGTGVICENSIISEGSSIINSVKMQDCFVGEACQISNGFTASQSVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGTLERGCKTASGAYLLMP.........A..HI..G..TFSVCF.GKLM.YHPDTRKLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.Q...G..T..Q..KSIVNFDWLSPFSVGEILKGKKILE.....K..LR.EA.S..G..DN........VST.....................................................................YNYH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......VK--....-.-...-.-...-....KR.LGAIE....P.P..ADTI.G..K.G.DWADLSGLLLPVSEE.EKIVSNIKSGEIE.S.IDEVIGKFENINDH...YREYQWAWTYQL.ILDY..YG.......L-......-..A.E...L.TETDVERIRQD.Y.ITARRM....WIAEIRKDAEKEFS.MG-...------...------.---------.--.-..---------------------------dvepev................................................................
H3H1Y3_PHYRM/2-339                   .........................................................................................................................................sival--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..---KARVRGCSRVE.G..TFVGDFAVVEDS-DVSNSTI.LS...TEH...E..R...SVVRTKSIVRDSIVQWNSTVEALSVVEGAFLCDTSHVERHGVVMSSVLGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..kGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI......nT..P..........G.......H..I..I.......S..S........LS.PAInei..................spgwVL..S..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-TQIEAEIFRPEIVQYMKDARTELA.....A..AE.GN.A..K..MSla....ngEDVytd...............................................................kqvRGLG.KNY.M........RE....S....S...RR.......AG.....IAAY...T..FFIQLYAL.DALL..P.L.......VESG....R.V...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------sadgtvgsvd............................................................
A0A4R3KMI4_9SPHI/42-765              ..............................................................................................................................................YRKLKAHEIEVLVK.N.ENTS..DD..WNM.I...L...V.........T...D.........K...F.N.....A.........G.........YVQGCNFFGK...IRI..GDLEP.YL..LE...YHE..I..QH.PVGLYNSTII.SCDF...GD.N.....VVVDN..........V.....-N.......HLS..H..YQ........VGNECMLMNINEM.....A.........T.S........N..H..........AKFGSGILkegee...........ekvriwLELCNEN.GG.RRILPFEGM................L.AGDAFLW..............T..K.Y..R.D..DQQ..L.MESFKKLV.DE.KN.D........SRR.G..F.YG..T..VGDRTVIKNCKIIK.D..AKIGSDAYIKGANKLKNLTV.HS...LPD...A..G...TQIGEGCELVNGIINQGCRVFYGVKAVRFFMGSHSNLKYGARLINSYLGNNATVSCCEVLNSLIYPGHEQHHNNSFLCASRIe.gqSNMAAGAt..iGSNH.NSR----GNDGEIVARRG---------FWPglcvslkhnS..RF..A..SYCLVNkGNYL.YEMDIP-LPFTFVy.....nD..E..........S.......T..A..K.......L..Y........LM.PAYwf.....................myNI..Y..A..L.A.........-...-.RNAWKYRTRDK.RI.H...K..R..Q..--EIEYDYLAPDTANEMITAMRLLE.....K.wVG.QA.Y..L..EQ........QGKaggtagtqagetdgtkpidttgtkpgetaatq....gsepdedqlrqigkdlllnqeetvrgltikarnVENS.RRE.V........IV....I....-...-Kv.....gQA.....YRWY...A..EMLHHYGV.STLV..H.H.......FSGK....A.A...A.-...-....-D.LLALR....E.D..FRFS.S..R.G.SWVNVGGQLIHEQDL.EQLKDDIKQGRIS.S.WDEIHARYLELGTA...YPADKLNHAWLT.LLEV..NG.......AG......E..E.E...L.L-SLWPSFLER.S.VETMER....LAEGVHTSREKDYR.NPF...R-----...-KMLYE.STSEMEAVI.GK.L..EENDFVKLMQAEAADYRKQADELLQR-n.....................................................................
W0EZ61_9BACT/41-733                  ..............................................................................................................................................YRPLTRQEIAILKS.N.GNRS..DN..WSN.I...L...V.........R...E.........G...I.D.....V.........L.........LIEDCTFFGL...VRI..GKLEP.YF..LE...FSQ..L..RT.PVGLYRSLIV.SCDI...GN.N.....VVINN..........V.....-R.......MLS..H..YI........IDDEAILINVNEM.....S.........C.T........S..H..........SKFGNGIIkdgep...........ediriwLELCNEN.GG.RKVVPFDGM................L.PGDAWLW..............S..K.Y..R.A..NEK..L.LNAFKNFT.DQ.QF.G........RQR.G..T.YG..T..VGKRTIIKNTHIIK.D..AQIGSDAYIKGANKLKNLTI.NS...NET...A..K...SQIGEGCEMVNGIMGAGSRAFYGVKAVRFILAPFSQLKYGARLINSYLGENATISCCEVLNTLLFPAHEQHHNNSFLCASLVm.gqSNIAAGAt..iGSNH.NSR----AADGELQAGRG---------FWPglcvslkhnS..KF..A..SFTMIAkGDYP.AELNVP-MPFCLI.......S..Nd........vH.......K..D..Q.......L..V........VM.PGYwf.....................lyNM..Y..A..I.L.........-...-.RNERKFADRDK.RK.E...K..K..Q..--LLEYDFLAPDTVNEIFTALDLLY.....L.yTG.KA.F..Y..QK........NQMvgcdkeysqkgrell......................................esqapiiaqldifangIEHS.QRP.V........RI....I....K...AL.......EG.....YAVY...K..KMICYYGT.CQLI..H.H.......LNQS....S.D...K.T...L....AA.VKNLF....E.K..AG--.E..R.K.SWLNVGGQLIPEKEV.KILINSIESGAVK.KgWDEVHDFYQQQAKE...YPIEKLLHGLSS.LKEI..KR.......ME......R..P.D...L.DAHLLADLFYE.A.IATREW....IAQSVYESKVKDYD.NPF...R-----...--KMIYdTTKEMEQVV.GK.L..KDNPFINEQAEETAAFKKSTELLIEKI......................................................................
D8E096_PREBR/48-483                  ............................................................................................................................................hi--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..-C........IGNQVTLQNIAVL.....R.........A.S........G..D..........TTFANGLK......................IDVLSEV.GD.LPVAIYDKL................T.SMEAAFE..............V..MeT..N.T..NPD..L.VAKLQAKA.RA.YA.E........AIR.C..D.AC..I..IEDRAIVKNCLELE.D..VHIGKEVEVIGASRLKDVTLcDT...NEG...K..P...IHIGAQVVLEHVIVGTESMIVDGAQMDHCLVGQGCHIGRMYSATSSLFFANCHFENGEACAYFAGPYSVSHHKSTLMIACMT....SFFNAGS....GSNQ.SNHSYKMGPNKYGQLARGSKLGSNSYVYWP.........M..QI..G..PFSTVI.MHHT.GHQDLRELPFSLI.......T..E.........gQ.......D..G..K.......T..H........IV.PGQ.........................AL..R..S..V.G.........T...R.RDINKWPKRDQ.RT.D...TpaC..R..LDRINFSMLNPYTIGYILKGLEVLK.....E..LK.TE.G..K..T-........---.....................................................................-EYK.GCI.I........SH....R....H...IE.......GG.....IMLY...Q..QAITIYRG.QQAQ..-.-.......----....-.-...-.-...-....--.--RHL....L.Q..TTEG.G..T.G.EWQDYGGMLLPKAET.YE-----------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------alargenfedleqyltqwesnw................................................
A0A374VD27_9BACE/3-657               ..............................................................................................................................................YRNLTEDEVLRLKS.Q.SCLA..DD..WEK.V...T...V.........A...E.........G...F.T.....T.........E.........FVHHTRFSGE...VRL..GVFQS.SF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..L..........SKFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIM..............A..L.Y..R.H..RPE..L.IARMKEIT.DF.YS.N........KHA.S..D.VG..S..IGNHVMILNTGSIK.N..VRIGDYCRICGTCRLYNGSI.NS...NEV...A..P...VHIGHGVICDDFIISSGSHVDDGAMLSRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...I..N..K..LDFINYNLLSPYTVQKMFKGRETLI.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IGFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...L.S...D....DE.IRARL....K.P..DTSI.G..S.G.EWVDISGLIAPKSEI.DALIEGIETGVVN.R.LKYINAEFERMHRN...YYTYEWTWAYEK.LEEY..YG.......IN......P..E.N...I.TSEDIIHIVEK.W.KESVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRVE.KELDFEQVR.GD.F..ESNPFVTAVLKHIEVKTELGDELIGRM......................................................................
C5LT92_PERM5/45-555                  .............................................................................................................................................l-RPLTVEEIEGLEA.S.GCSS..ED..WQE.V...M...Vi.......gE...E.........P...L.A.....V.........K.........MIRNCAFQGR...VEI..GVVEG.SK..VTlsdYNR..H..QL.PCGVTNSVLQ.DVVV...EA.G.....TLIKD..........C.....-G.......LVA..S..TV........VRKGAALIRCGVI.....Eg......psQ.S........D..C..........CRYGNGHT......................LPLAEET.GS.RETRQFAEL................S.IEIAAKV..............A..-.-..-.S..DRK..L.AHGYHKAV.ND.YV.A........AVE.A.cG.KG..RtiVDENAVVLSCCSIK.G..SYIGRKARA------VNSKI.QD...SAL...L..E...ENNVENCSLSTAILQKAASVVSFGMVEGSVLCPTVHVERHGKVFDSIIGPCSGVAEGEVTASLIGPFVGF-HHQALLIACFWp..aGRGNVGY....GANVgSNHTG-KAPDQENWPGEGTFFGLASNIKYP.........F..NLvdA..PYSLIA.TGVS.CLPQAIGLPFSLV.......N..E..........S.......T..E..H.......I.sG........LS.PAInevtp..............gwmlsdNM..Y..S..L.F.........-...-.RNEAKFESRQG.NL.P...K..D..G..-VMYQYSVFRPEIMDRVVKARDALK.....A..VD.PK.D..A..RL........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------rdargravytdkqiailgknwmndsarltaiktystflqwyairglwrrlalhadddel...........
A0A5D6XUZ0_9STRA/91-621              ............................................................................................................................................fp---LSAEEVAALER.H.GNSA..ED..WSL.V...R...K.........T...T.........DgepL.D.....A.........S.........RVRSCVFQGR...VVL..GRFGG.TFrhVL...AGG..A..RF.LPGCYRSTIR.ESVV...LD.D.....ALVQD..........T.....-M.......LLD..T..VL........VDVRAAVAGCGVV.....L.........F.EpsvsagnaA..A..........TVFGNGTT......................LHVGVET.GG.RDLRVIADL................P.FALAAAL..............T..D.S..R.D..DAE..L.QRAYDRFV.DD.YL.A........QIA.C..G.FT..I..VAPDARLVRCSRVA.N..SFVGACALLDDAD-VANSTV.LS...SRE...E..P...SRIVTKSLVRNAVLQWRSVVEALSVVTDAFLCDCAHVERHGVVLSSVIGPNTSIAEGEVTASFVGPFVGF-HHQALLIASYWp..qGKGNVGY....GANVgSNHTLK-APDQELFPGEGVFFGLGCSVKFP.........S..NFvrA..PYSVVA.TAVT.TLPQRLAMPFSLI.......N..T..........P.......G..H..V.......I.pS........LS.PAInei..................spgwVL.aH..S..V.F.........T..vL.RNEDKFRTRNQ.ST.R...T..-..-..--AVEPAIFRPEIVAYMAAARAQLR.....A..AA.GS.A..T..IA.......lAETgeavy...........................................................tdaqvPGLG.KNY.M........RE....S....A...RT.......DA.....VAAY...T..RFIQLYAL.DALL..G.R.......VESG....E.V...S.V...E....ST.V----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gsinrnashdla..........................................................
A0A2T7QCA7_9BACT/42-734              ..............................................................................................................................................YRELTAWEIEVLVR.N.RNTS..DN..WNK.I...L...V.........S...D.........A...F.D.....P.........E.........LVKNCKFFGL...VRI..GKLEA.CF..LE...YHN..L..RM.PVGLYNSTII.SCDF...GD.N.....VVVDN..........V.....-N.......YLS..H..YI........IGSEVILVNISEL.....A.........T.T........S..A..........AKFGNGIIkdges...........esiriwLEICNEN.GG.RKVIPFTRM................L.PGDAWLW..............S..K.Y..R.D..DEV..M.LEKFKAFT.QA.EY.D........VQR.G..Y.YG..K..IGDRTIIKNTNIIK.D..VWIGSDAYIKGANKLKNLTV.NS...SAE...A..P...SQIGEGCEMVNGVMGLGCKSFYGVKAIRFIMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPSHEQHHNNSFLCAATVm.gqSNMAAGAt..iGSNH.NSR----SPDGELIAGRG---------FWPglcvslkhnS..KF..A..SFNILAkGDYP.AELNIP-VPFALI.......S..N..........Dm.....aN..D..Q.......L..V........VM.PAYwf.....................myNL..Y..A..I.A.........-...-.RNGWKYNDRDA.RI.E...K..E..Q..--RLEFDALAPDSIHEMVNAVDLLC.....L..YT.GK.A..H..AK........QTGntgkqdswyiktgkkl....................................leandpvidtleilgegFENS.DRK.V........IL....I....K...VQ.......QA.....YTIF...L..DLVTYYTT.GQLI..N.Y.......IQVN....N.I...S.S...F....PS.LKRSV....H.F..T--N.R..I.K.DWLNVGGQLIPVAEV.MKFRKQVHTGKIK.S.WDDVHQFYKIQGEL...YDEYKLAHALAS.WSVI..SG.......IS......G..N.R...F.NAACFKDLLVA.A.VRTKEW....LTKGIYESREKDYT.NPF...R-----...-LMVFD.NKEEMEKVW.GR.L..EDNSFINLQKKELKDFKKTVNRLIT--df....................................................................
A0A0K8QTP7_9BACT/10-664              ..............................................................................................................................................YRNLLDEEIGQLIH.Q.GCSS..TD..WSL.V...Q...V.........S...E.........D...F.L.....P.........D.........RIENSKFSGH...IRL..HGFNG.SV..KL...IGG..I..TF.KTGIYNAWLH.NCEV...GR.D.....ALIHN..........V.....RS.......YIA..N..YH........IGENVIIHNVTTL.....A.........V.D........G..E..........STFGNGVK......................VEAINEG.GG.RDIPMYDYL................S.AHVAYIM..............S..L.Y..R.H..RPK..L.VAALKKMV.LD.YA.E........SVK.S..D.MG..V..IGMGSRILNTTTLL.N..IKTGPGALIDGAKKLKNGSI.NS...NFE...A..P...VNIGEGVIMENFIVSSGSKVADGTLVSNCFIGQGCILDKNYSAFNSLFFANCQGLHGEATSIFAGPYTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHMYKLGPIHQGIMERGSKTTSDSYLLWP.........S..RI..G..AFTLVM.GRHY.KHCDTTDFPFSYL.......I..E..........S.......N..D..E.......S..I........LA.PGV.........................NL..K..S..I.G.........T...I.RDTQKWPGRDT.RT.D...S..H..L..LDFINFNLLSPYTINKMVNGRKKLM.....A..IR.EI.S..G..DQ........AST.....................................................................YSYD.KMK.I........EN....R....A...LV.......RG.....IDLY...T..MAIWKFLG.NSLI..T.R.......IQNG....K.Y...H.S...D....ED.IRKAL....Q.P..GTTI.G..R.G.NWVDISGLICPYEAL.DLILTHIEEGGIS.S.LEEVNSAMAALHKN...YYNYEWTWAVDE.FTEF..FG.......KP......L..S.S...F.TADDVIYVVEK.W.KESVLG....LDRMLYEDARKEFS.MSK...MTGFGM...DGTNGA.REEDFAQVR.GE.F..ESNSTVMVIKQHMEKKEKLGNEIIE--lm....................................................................
A0A386HMX1_9BACT/43-735              ..............................................................................................................................................YRHLSAFEIEALVR.N.RNTS..DN..WNN.L...L...V.........S...D.........Q...F.N.....P.........E.........LVKNCRFYGL...VRI..GKLEP.FF..LS...FSD..L..KV.AVGLYDSTII.SSDI...GD.N.....SVINN..........V.....-H.......YLS..H..YV........IGAEVILTNINEM.....Q.........T.T........D..K..........CKFGNGIIkeged...........essriwLELCNEN.GG.RKILPFNGM................L.PGDAWLW..............S..K.Y..R.D..DEK..L.LDKFQEFT.ES.EF.K........TAR.G..F.YG..K..VGDRTVIKNTNIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GTE...G..R...TQIGEGCELVNGSVGFGSRIFYGVKAVRFVTAAHTQLKYGARLINSYLGSNATISCCEVLNSLIFPGHEQHHNNSFLCAATIm.gqSNIPAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPalcvslkhnS..KF..A..SFTMLAkGDYN.YELDIP-LPFSLIs.....iH..P..........I.......T..N..S.......L..V........IM.PGYwf.....................myNM..Y..A..L.T.........-...-.RNAWKYVDRDQ.RN.E...K..V..Q..--LIEYDFLAPDTINEMFSALKSLE.....I..FT.GK.A..Y..FK........SIQnnksstesiyrkkgkel...................................lndasvnidelsilaegYENS.KRN.V........EI....I....K...VQ.......KA.....YNIF...K..RIIAFYGY.LHLF..N.F.......VQKE....G.I...N.S...V....TK.WQKSF....P.K..KP--.Q..R.G.VWINVGGQLIPEKNV.LQLKEKICNNKVN.S.WDELHAQYALEGEK...YVKEKTMHAIAS.LEEL..LN.......IN......L..S.Q...L.DKKTFIQFIDE.A.IVTKKW....IFEEIKKSREKDYS.NPF...R-----...-KMMYN.SQTEMDNVV.GK.F..SDNSFIIQQEIELKNFIAQTKKI----kan...................................................................
R5KTH3_9BACT/4-596                   ..............................................................................................................................................YRLLTDEEIGILEE.N.GCTA..ED..WTS.V...N...V.........A...D.........D...F.M.....P.........T.........YIRRVRFYGT...VNL..GVFEK.NV..EV...TSG..F..VR.HSGVCNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YV........IGDDCYISNVSII.....E.........T.T........A..E..........ATFGEGNA......................ISVLNEA.GN.GNVMLFSGL................T.SNFAALM..............V..L.H..S.H..DRE..F.TAAVRKMI.RD.DI.D........RRL.S..G.TG..T..IGNGVRIVNTTEIT.N..TNISDNCEVNGASRLTDCTL.AA...EPD...D..S...VYIGSGVICENSIIADGSSILNSAKLFNCYVGEASQITNGFTAESSLFFANTYMANGEACAAFCGPFSASHHKSTLLIGCMT....SFYNAGS....ATNF.SNHAYKMGPIHYGILERGTKTASGSHMLLP.........A..DI..G..AFSVCL.GKLS.GHPDTRSLPFSYI.......I..G..........D.......G..R..D.......T..Y........IV.PGR.........................NI..T..T..V.G.........V...Y.RDIRKWPRRDV.RL.E...S..A..K..KSIVNYDWLSPLTVNEIVKGRQLLA.....D..LR.QN.A..S..QN........TAF.....................................................................YTLN.GNK.L........ST....N....S...LQ.......RG.....IKLY...S..MAIELFIG.EVLM..S.H.......----....D.F...-.-...-....--.----G....D.P..CTAS.G..A.G.EWHDLSGLLLPAAEE.DRLVEKIKYGVVD.S.VKALSGMLAAYNDK...YGDYLWTFTVSL.MKDY..LG.......--......T..D.E...L.TEDDFASMRER.G.NAARET....WLDEIRKDAEKEYD.M--...------...------.---------.--.-..---------------------------gdvdra................................................................
A0A174V4F5_BACUN/3-657               ..............................................................................................................................................YRRLTEDEILRLKS.Q.SCLA..DD..WGK.V...T...V.........A...E.........E...F.S.....T.........E.........FVHHTRFSGE...VCL..GVFHS.EF..ML...PGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..V..........SKFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.IARMKEIT.DF.YS.N........KHA.S..A.VG..S..IGNHVMILNTGSIK.N..VRIGDYCRICGTCRLYNGSI.NS...NEV...A..P...VHIGHGVICDDFIISTGSHVDDGAMLSRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...P..N..K..LDYINYNLLSPYTVQKMFKGRETLQ.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IRFY...E..IAIHKFLG.NSVI..K.R.......LEGI....D.F...R.S...N....EE.IRARL....K.P..DTAI.G..S.G.EWVDISGLIAPKSEI.DALIDGIESGKVN.R.LKSINTEFEKMHSN...YYTYEWTWAYEK.LEEF..YG.......IK......P..E.G...M.TAEDVIHIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRLE.KELDFEQVR.GD.F..ESNPFVMAVLKHIEVKTALGDELIGRM......................................................................
A0A1C3Z7L5_9BACT/42-732              ..............................................................................................................................................YRQLNAQELEILVR.N.DNTS..DN..WNN.I...M...V.........S...E.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...YRN..L..RL.AVGLYNSTIT.SCDF...GD.N.....VVLHN..........V.....-N.......FLS..H..YI........IGNEVILFNINEM.....E.........T.T........D..Y..........AKFGNGIIkeges...........eerrlwMELCNEN.GG.RKILPFDGM................L.PGDAYLW..............T..R.H..R.N..DKQ..L.MEQFRLLT.EK.QF.D........QRR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGSDAYLKGANKLKNLTI.NS...RPD...E..T...SQIGEGCELVNGIIGYGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..SFTLIAkGNYM.HELDIP-FPFSLVm.....nD..E..........H.......D..N..T.......L..K........IM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKYVDRDK.RS.N...K..I..Q..--YIEYDYLAPDAMEEILHVLPLME.....Q..AV.GT.A..W..YT........QEKqalpndalllqkg..........................................qelllhdaaavaklTVYA.G-K.V........EN....SqrktV...LLk....vhRA.....YPLL...R..EMLNLYGI.RNIL..D.Y.......TGKN....H.G...A.T...F....SQ.LHAI-....-.-..AQTA.Q..R.G.SWQNIGGQLMPEASV.EDLKDRIRTGKIE.S.WLQLHDVYKQEGSR...YEKEKLKHAIAC.MLQV..QG.......VS......A..D.G...F.TPAFLQQCLQQ.S.VHTMST....LTENIYLSRKKDYT.NPF...R-----...--KMVYnSPEEMEEVI.GK.L..EDNSFIQQTKADLETYKKTVADLL---kn....................................................................
A0A1M6WMU2_9BACT/33-548              ..............................................................................................................................................YRALTAEEIQVLEK.N.GNRS..ES..WSR.V...F...V.........E...Q.........D...F.D.....A.........N.........RIHRSTFAGE...VYL..PRFFG.TL..LL...PGD..V..SY.PTGIYESLVH.NSIV...-E.N.....ALIYR..........V.....-S.......MLS..N..EL........IRCGAVVHNVGSL.....V.........S.S........G..K..........INYMIGTS......................MNVGNEM.GG.RSILVFPEL................T.TELVDLQ..............L..F.H..K.A..DAE..V.GNAFAEQL.KI.YR.D........EMA.L..P.FG..I..VGKGAVVSNTNIIR.N..SWIGAHARIEGASKIRNSVV.MS...SLE...E..S...THVYDSVILENSNVQMGVKIHTGAEVQGSVLMTRTKVCCKAIVKSSVIAPCCHIEEGEVNSSYMGPMTQMHH-HSLLIAALWpegcGNLGYGAn..vGSNH.TGR----MPDQEVMPGQAMFFGLGVNIKFP.........AnyRE..S..PFTLIA.TGVT.TMPQRLKFPFSLV.......R..P..........G.......D..P..Q.......L..NgvparlneIV.PGW.........................NYacN..A..Y.A.........L...D.RNAYKYSVRGK.GV.V...P..A..T..----FFNIFNPETVRCVYDAYCRLQ.....V.aTI.RD.V..Y..TK........EHI.....................................................................DGLG.ENF.L........RE....R....V...RQ.......QA.....LHTY...S..EYLERYVL.ESII..T.M.......VVN-....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------dvnllaqpvkelrrlittelnkdvvrvv..........................................
A0A4R1B385_9BACT/42-730              ..............................................................................................................................................YRNLTAHEIEVLVR.N.SNTS..DD..WNK.I...Q...V.........S...D.........A...F.N.....P.........D.........LVRNCKFFGL...VRI..GKLEP.LA..LQ...HHN..V..TH.PVGLYNSTII.SCDF...GD.N.....CVVDN..........V.....-K.......YLS..H..YI........IGNEVMLLNIDEL.....H.........T.T........S..K..........AKFGNGVLkeged...........esvrvwLEVCNEN.AG.RKIIPFNGM................L.PGDAWMW..............A..R.Y..R.A..DKD..L.MDRLRDLT.QL.RY.D........AQR.G..Y.YG..K..VGDRTVIKNTSIVK.D..VWVGTDAYIKGANKLKNLTI.NS...APD...A..M...SQIGEGCELVNGVVGYGSRAFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..KF..A..TFTLIAkGDYS.SELHIP-LPFSLVs.....nD..E..........A.......N..N..R.......L..T........VM.PAYwf.....................qyNM..Y..A..L.A.........-...-.RNAFKYVDRDK.RT.R...K..V..Q..--LLEYDYLAPDSVNEIMTAVRLLE.....R..FA.AL.H..A..RN........GDAgdlqeaaleqegrr........................................lfadgslnlkggmraYGFE.NSA.R........PT....L....L...IKa.....gEA.....YRVY...R..DLVAYYAG.IQLV..Q.F.......WPET....A.A...S.S...F....EE.FAPHL....P.V..AP--.S..R.G.PWHNVGGQLMPDTSV.QSLIEGIKKGEIN.S.WSDVHEFYEVNGAL...YPGQKRAHALAS.LFEL..WE.......ID......A..N.Q...F.NADRFRELMQI.T.LRVQEW....MVKGIRAARAKDYE.NPF...R-----...-TMVYE.SKEEMNEVI.GA.L..EENSFILHQEEALTTLREQVA------kmtg..................................................................
A0A6H5K4J9_9PHAE/294-557             ..........................................................................................................................................cidd--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.Y..R.H..YYP..L.LSPLLSRT.-A.LT.A........LNR.C..G.AT..V..IGPGAVVMSCSRVV.D..VFIGANALLESC-AVENATI.LS...TAE...E..P...SRVTCGSSVTSSLLQHGVTVDRGCIVSDSLLMEHSHVDNHGKLTHSVLGPDSGVGAGECLHCLVGPFVGFHH-QSLLIATVWp..lGRGNVGY....GANVgSNH-TSRQADQEIWPGEGVFFGLSTVIKFP.........A..NYseS..PFSVIG.SGVT.CLPQRVAFPFCLIn.....sQ..E..........E.......A..G..L.......P..G........VS.PGL.........................N-..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------hlrpgwvlsesmymvirsedkrn...............................................
X5DE87_9BACT/9-663                   ..............................................................................................................................................YRNLYDEEIGQLVH.Q.GCSS..SD..WSL.I...K...V.........S...H.........D...F.I.....P.........D.........CIENSKFSGS...VRL..NSFAG.SV..KL...IGG..I..NF.KTGIYNAWLH.NCEV...GK.N.....ALIHN..........V.....RS.......YIA..N..YR........IEENVVIHNITTL.....A.........V.D........G..E..........TSFGNGVV......................VEAINEG.GG.REIPIYDYL................S.THVAYMM..............A..L.Y..R.H..RPE..V.VRSLKTMV.DD.YT.Q........YVR.S..E.MG..V..IGADSNILNCNTIL.N..VKTGPATIIDGAKKLHNGSI.NS...NYE...A..P...VKIGEGVIMDNFIVSSGSKITDATLVSKCFIGQGCVLDKHYSAENSLFFANFQGFHGEACSIFAGPYTVTHHKSTLLIAGMY....SFLNAGS....GSNQ.SNHLYKLGPIHQGIMERGAKTTSDSYMLWP.........T..RI..G..AFTLVM.GRHY.KHCDTTDFPFSYL.......I..E..........S.......K..D..E.......S..I........LV.PGI.........................NL..K..S..I.G.........T...I.RDTQKWPKRDK.RT.D...S..N..L..LDLINFNLLSPYTIDKMIKGREKLM.....E..LQ.KS.S..D..EN........TEV.....................................................................YTYD.RMK.I........EK....H....A...LN.......RG.....IQLY...E..MAIWKFLG.NSLI..T.R.......LNGN....E.Y...E.I...A....AD.IQKAL....Q.P..DMKF.G..K.G.YWVDLAGMICPFEAL.DQLLQAIENGSVQ.S.LEEVNSALATIHKN...YYNFEWTWAVDV.LESF..YG.......KS......I..S.E...F.EASDVISIVKK.W.KESVLG....IDRFLYEDARKEFS.MSK...MTGFGV...DGQNGA.RELDFTEVR.GE.F..ENNDTVKEIKEHMKKKERLGSRVIEQM......................................................................
A0A4Q7MAH1_9BACT/42-734              ..............................................................................................................................................YRHLTAYEIEMLVR.N.RNTS..DN..WNN.I...I...V.........S...D.........A...F.N.....P.........E.........LVQDCKFYGL...VRI..GKLEP.YY..LE...FHN..L..RR.PVGLYNSTII.SCDF...GD.N.....VVVDN..........V.....-N.......YIS..H..YI........TGNEVILVNVNEI.....D.........T.T........D..H..........SKFGNGILmeged...........eairvwMEVCNEN.GE.RKIMPFDGM................L.PGDAFLW..............A..R.F..R.D..DNT..L.QQKFKDFT.QQ.QF.D........LKR.G..R.YG..T..IGDRTVIKNCRIIK.D..VKIGTDAYIKGANKIKNVTI.NS...SAD...A..K...TQVGEGCELVNGIIGYGCRAFYGVKAVRFFLAPHSQLKYGARLINSYLGENSTISCCEVLNSLIFPSHEQHHNNSFLCAALLq.gqSNMAAGAt..vGSNH.NSR----SPDGEIIAGRG---------FWPglcvslkhnS..KF..A..TFTILAkGDFP.VELNIT-IPFTLV.......S..N..........Dv.....tH..N..K.......L..V........VM.PAYwf.....................lhNM..Y..A..L.A.........-...-.RNAWKYGDRDK.RI.N...K..T..Q..--LLEFDYLAPDSVNEILDAITLMQ.....Q..AT.GK.A..Y..LK........STKgnkkftaeqqieegkr.....................................lletkdplvndleilvDGFE.NSS.R........PA....Q....L...IKv.....tAA.....YHIF...K..DLVTFYAV.QQLI..A.N.......SGKQ....F.K...Q.L...E....EQ.INSI-....-.-..PAKP.V..L.T.SWMNIGGQLIQRTAI.NKLVTQIHQGKVK.S.WEQVHAFYKDQADK...YPAEKFQHAMAA.LQTV..HG.......IH......L..K.K...A.KPEQVQQLLQQ.A.LAVKTW....MVEGIYESRAKDYK.NPF...R-----...-KMVYE.TNAEMNKVL.GK.L..EDNSFIKQERASLDQYRKTIAAL----srrm..................................................................
R5IQU5_9BACT/5-659                   ..............................................................................................................................................FRKLTIKEIDILKN.Q.QCMS..DD..WSS.I...D...V.........A...K.........D...F.N.....P.........E.........HIFHTRFSGK...IKM..GVFEK.SF..TL...PGG..F..KK.HSGLRHVSLH.NCTL...GN.N.....VLIEN..........V.....SN.......YIA..N..YS........IGNDTFIQNVNVI.....L.........V.D........G..K..........STFGNGTE......................VSVLNET.GG.REVPIYNKM................S.AHLAYII..............A..M.Y..R.H..RPI..L.IEKLKKMI.DD.YA.S........EVS.S..E.TG..Y..IGENVSIINTGTIK.N..VCIGDCCIINGTSKLENGTV.NS...NST...D..P...VTIGCNVMADDFIISSGSHISDGVVMLRCFIGQGCSLSHLFSAHDSLFFSNCQGENGEACAIFAGPYTVSMHKSSLLIAGMF....SFLNAGS....GSNQ.SNHMYKLGPIHQGVVERGSKTTSDSYILWP.........A..KI..G..AFSLVM.GRHV.RHPDTSALPFSYL.......I..E..........K.......G..S..E.......T..Y........IV.PGV.........................NL..R..S..V.G.........T...I.RDALKWPKRDN.RK.D...P..E..K..LDCINFNLLSPYTIQKMLTAIDVLR.....S..LQ.KS.S..G..ET........SEV.....................................................................YSYQ.SAC.I........KN....S....S...LV.......KG.....ITLY...S..KAINKFLG.NSII..K.R.......LEKT....H.F...N.S...N....QE.IRERL....Q.P..TIEG.G..S.G.EWLDLSGLIAPKAEI.DKLISGIETGIIT.S.LETIHSTFAELHKN...YYDLEWTWAYEV.MQKW..YG.......KS......I..S.K...I.TAEDITEIVNI.W.KDAVVS....LDEMLYADAKKEFS.MTA...KTGFGV...DGNSQQ.KNTDFEQVR.GV.F..DSNPFVQTVNKHIEDKTNLGNELIGRI......................................................................
A0A1H0HZN4_9BACT/4-604               ..............................................................................................................................................YRQLTQEEIQVLEN.N.VCWA..ED..WNR.V...M...V.........D...E.........D...F.R.....P.........Y.........NFHRVIFYGD...IRL..GKFEK.KI..EV...AQG..F..YK.HSGINDATLR.NVTV...GD.D.....CLIEK..........V.....GN.......FIN..N..YT........IGDDCYISNISTL.....E.........T.R........E..G..........ASYGAGST......................ISVLNEM.GD.GNIVLFREL................N.SQLAAFM..............V..K.H..N.R..DKA..L.VNRLRQLI.DD.EV.R........IST.P..E.RG..T..IGNSVKIINTKDVI.N..TVIKGDCEISGAARLNECTI.LS...SED...A..P...VFIGTGVICENSIICDGCSINNSVKMQDCFVGEACQITNGFTAEASLFFANSFMANGEACAAFCGPFSASHHKSSLLIGGQF....SFYNAGS....NTNF.SNHAYKMGPLHYGTLERGTKTASGSYVLMP.........A..TI..G..AFSVCF.GKLM.HHPDTRNLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDK.RS.K...Q..S..K..KSIINFDWLSPFTVGEIIQGIEILK.....A..LR.NA.S..G..DN........VTT.....................................................................YNFH.EYV.I........NA....S....S...LM.......KG.....LKYY...D..IALRIYMG.A-VL..K.R.......AQKE....G.F...F.G...-....--.-----....Y.P..KSEV.G..K.G.AWSDLSGLLLPESEE.QRLIDDIKEGGIE.N.IQQVLTRFEDINNS...YSDYRWAWSYQL.ILDY..YH.......LT......-..-.E...I.DEAACERIRED.Y.VKARRA....WIAEIRKDAEKEFL.M--...------...------.---------.--.-..---------------------------gdveqevldd............................................................
A0A196SPR9_BLAHN/31-467              .............................................................................................................................................t-RKLTNEETEHLKQ.H.GNHS..SDasWSN.V...S...Vm.......iT...E.........E...E.G.....E.........L.........FYIDCFFIGN...NVI..SFQKG.EV..RF...SDD..L..CL.PACVRTTTFK.NCVI...FP.N.....CFFSN..........N.....-T.......LAE..N..CV........FLSGSVCMSNGRL.....T.........C.K........P..S..........ASFGNGQL......................CNVGNET.GG.YSIKLDGDL................-.-------..............-..F.Y..T.D..M--..-.RQLLEEGT.QP.VF.E........PIR.E..D.RC..V..IGPSACIEYCSLLD.S..VFIGEGCHII-ASMLVDCTV.LG...SRA...N..R...TLVSNG-NATSSILQWGVHFETGSNCVCSLLCEHSFTDCNAKIINSVIAPNTGVSSGECNSSLVGPFIGFHHNSVLISAIWY...kGKGNIGY....GANIgSNHTGRL-PDQELIPGEGLFFGLGCNIKYP.........C..NFmnA..PYSLIA.SGIT.TLPQKVEMPFSLInk...psT..-..........-.......-..N..YegvspayN..E........IL.PGW.........................AL..Y..SnyY.M.........L...I.RNENKFSKRNK.SK.R...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------cafemhilrkdiiellvkarnyllmrdklskea.....................................
G8QY50_SPHPG/44-729                  ..............................................................................................................................................WRQLKEEEILVLKQ.N.LNSC..QN..WSD.L...L...V.........T...D.........P...F.D.....P.........S.........LIKNSEFFGL...VRL..GKMEK.KV..VS...FHD..F..SV.PVGISNSRII.SCDI...GD.G.....CAVFD..........C.....-S.......YLS..H..YI........IECNVILYRIGEM.....L.........A.T........N..H..........AKFGNGIVkeged...........psvrvtIDIMNEA.GG.RTVYPFSDM................R.CSDAWIW..............G..T.Y..R.D..DSA..L.MERFQAMT.DA.EY.D........KKR.G..W.YG..F..VGQQSVIKSCDTIK.D..VWIGEGSYIKGANKLKNLTL.RS...TLA...E..P...VQLGEGVELVNGIIGAGSRVFYGCKAIRFIMGDNCNLKYGARLIHSILGDNSTVSCCEMLSNLVFPGHEQHHNNSFLIASLIk.gqSNMAAGAn..iGSNH.NSR----GADGELVAGRGFWPALSSTLKYD.........C..KF..A..SYVLIAkGNYP.YELNIP-LPFSLLs.....aN..N..........K.......E..D..R.......R..V........IM.PAYww.....................myNL..Y..A..L.E.........-...-.RNSYKYRKRDK.RK.V...I..R..Q..--HIETDYLAPDTSMEILEARRLI-.....Q..IW.TA.E..S..WN........RQVgdallytpaql..............................................aeqgrlllqtqgNMVS.SIR.V........TA....D....S...LE.......NG.....SEPM...EilKPVEAYRSyTDML..L.F.......YGTIa.vsNwC...H.Q...T....HC.TVSDF....Q.M..EAGE.L..L.E.PWLNLGGQLVPERKV.EALKTQVREGAIT.S.WDAVHQAYETWFCD...YARDKALNGLGV.LKQV..LG.......LT......L..L.D...-.-AETWPLLVEK.V.VKTRSY....IEEQVFKTKEKDFN.NKF...R-----...-ESTYR.NHAERDAVL.GC.L..DDNPFVMESKQISQQ------------iieevrsvv.............................................................
A0A1Y4C8V5_9BACT/3-618               ..............................................................................................................................................YRKLSEEEKASLQQ.G.GNFC..TD..WDG.L...Y...V.........K...E.........G...F.D.....P.........A.........YVRNCRFSGT...VYL..GNFKS.QH..EL...PGG..F..TV.HSGIYNAALN.DVTV...GD.D.....VLIYN..........V.....SG.......YIS..R..YD........IGDRVIIFDCGNI.....Y.........T.R........E..G..........SVFGCGTE......................VSVLDET.GG.KTVRIFPGM................S.SSYAWLA..............V..F.E..R.N..-AA..F.QNALDSMV.SS.IT.A........SVK.S..D.RG..R..IGDDTLLASAMTVD.S..VDIADNVTVDGAAKLRNGMI.ES...G--...-..-...CTIGYGVIMEHFILSKLSKVKGGSKVMSSFVGEAAIIDSHYCAKDSLIFSNCHFENGEICAAFAGPHTVAHHKSILLIGGMY....SFFNAGS....GANH.SNHLYQLGPRHYGILERGCKMASDSYLMLP.........A..HV..G..EYSLII.GRHH.RHRDSSRFPFSYL.......L..E..........R.......R..G..C.......T..Y........CM.PGA.........................VL..S..G..V.G.........L...F.RDVSKWPKRDR.RP.G...R..K..G..YDKVVYDLYLPSLCDAMINAKAVLE.....R..AL.AD.M..P..QV........DGIridv............................................................mdkgdFVID.GLY.M........TY....D....A...VV.......NG.....IKYY...S..TAIAIALG.DAFL..Y.S.......----....-.-...R.S...H....DA.VSRES....I.S..GESR.D..Y.D.KWLDLSGLPVPEDAV.RNIVEEVVSGKLS.D.VSAIDRELTRLYEN...YPAYKNAWFKRR.MF-Y..MN.......LS......P..E.E...-.-------IIEN.R.NRAVDE....MNRMIKGSATRDYL.LSH...M-----...------.---------.--.-..---------------------------ldkddvskgnaeeyegyllsys................................................
A0A0W8C2Q3_PHYNI/38-555              .............................................................................................................................................f-YSLSDGEIRALEA.N.GNCA..ES..WNN.V...YktyA.........H...T.........P...L.Q.....T.........S.........RIRQCSFHGK...VVL..GRFST.FN..HN...VDG..I..PF.PCGVYNSALS.NVVV...LD.D.....SLVRD..........T.....-L.......VLR..D..VL........VDTQASVIKCGSV.....T.........GpE........E..D..........AVSANGNL......................LHVGVET.GG.RDLRVVADL................P.FALGAAV..............A..T.R..R.G..DHD..F.LKTYETFV.DN.YV.A........ALK.A..P.MA..I..VAKNARVRGCSRVQ.G..TFVGGYAVVEDSD-VVNSTL.LS...TQD...E..P...SVIRAKSIVRDSIVQWNSTVEALSVVEGSFLCDTSHVERHGVVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......G..H..S.......I.pS........LS.PAInei..................spgwVL..A..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEAAILRPEIIQYMKNARAELI.....A..AE.GK.A..K..INl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......AG.....ITAY...T..FFIKLYAL.DELL..Q.L.......VESG....H.V...S.A...D....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtvgsvdsshy...........................................................
A0A0E9N8K4_9BACT/42-729              ..............................................................................................................................................YRHLTAYEIEVLVR.N.RNQS..DD..WNK.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.YC..LE...FNN..L..RM.PVGLYNSTVI.SCDF...GD.N.....VVVDN..........V.....-N.......YLA..H..YI........IGNEVMLVNINEL.....A.........T.T........N..H..........AKFGNGILkedee...........ekvriwLELCNEN.GG.RSILPFDGM................L.PGDAYLW..............S..R.N..R.Q..DSK..L.QEKFIEFT.TN.RF.D........QLR.G..Y.YG..M..IGDRTVVKNCSILK.D..VRIGSDAYIKGANKIKNVTI.RS...TPE...A..R...TQVGEGCELVNGIIGIGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----SADGELIAGRG---------FWPglcvslkhnS..RF..A..SFCILAkGDYP.AELNIQ-FPFALV.......S..Ns........lS.......N..E..R.......L..Q........VM.PAYwf.....................qyNM..Y..A..L.A.........-...-.RNSWKYVDRDS.RI.D...K..T..Q..--LIEFDYLAPDTAQEMAAAIALLE.....V..AT.GK.A..W..FL........REGrqfsekqarekgrvllv...................................egddaiagldilvdnaeNSQR.--P.V........QI....I....K...AA.......MG.....YQWY...R..RLLTEYAA.REIV..A.F.......HERK....G.G...K.L...D....KN.IKAL-....P.-..-AVE.K..P.G.AWENIGGQLLQAVQV.KYCLQAIKKGTIN.S.WDDVHQFYRQEADS...YPDRKLAHAISL.YQQV..FR.......ES......L..S.A...-.NNKLVKQLLKD.S.VGFHHE....LSARIRETRQKDYQ.NPF...R-----...-QMVYQ.NEAEMDAVV.GK.L..ENNSFILSEQQAAKRYARKITAL----lq....................................................................
A0A2T0WXK9_9BACT/4-658               ..............................................................................................................................................YRNLQPEEITKLEA.Q.GCYC..AN..WSD.I...L...V.........R...D.........G...F.N.....P.........S.........FIRHTNFSGK...NRL..GTFNR.EF..NF...PGG..V..VK.HAGISYATIH.NTNI...GN.N.....VYISQ..........V.....RN.......QIA..N..YN........IGNNVVIENVDAL.....T.........T.E........G..E..........STFGNGQK......................VAVLNEA.GG.REVPIFNEL................S.AHTAYLM..............A..F.Y..R.H..RPA..L.IEKLTGMV.EQ.YC.H........NIK.S..D.RG..T..VAENAKIINSRTIL.N..VNIGPGATVEGIYRLVNGTI.NS...SME...H..P...SYFGPGVIAEDFIATSGAEVTDATLISKCFIGQGCSLGKHYSAENSVFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYY....SFLNAGS....GSNQ.SNHMYKLGPVHQGVVERGSKTTSDSYLLWP.........A..KI..G..PFSLVM.GRHY.RNPDTSNFPFSYL.......I..E..........N.......H..D..E.......S..Y........LA.PGV.........................NL..R..S..V.G.........T...M.RDARKWPGRDK.RK.D...S..H..Q..LDFITFNLLSPYSVEKMIKGKHTLQ.....T..LK.KT.S..G..IT........SEY.....................................................................FMYN.SVK.I........ED....K....A...LD.......RG.....INMY...N..IGILKFLG.NGLL..K.K.......LEKG....D.F...Q.N...I....KE.IQDTL....K.P..DTEE.G..S.G.DWVDMAGLVVPKEEV.ILLIEKIESGVLN.A.FDDLQAIYKKWHQN...YYSWVWNWSVKI.FREE..MG.......ID......L..K.N...I.EKEALLDFINQ.W.KNAVVS....LDEMMLTDARKEFT.LKA...QTGFGM...DGEDDV.RHTDFEQVR.GA.F..EKHPAVRDIFDHIEKKQQLATQIREK-i.....................................................................
A0A4Y8L8J1_9BACT/3-657               ..............................................................................................................................................YRKLTTPEIEKLQN.Q.ACTA..CN..WET.V...S...V.........H...E.........N...F.T.....P.........D.........YIHQVNFSGD...IRI..GYFES.DF..VF...PGG..I..KR.HSGLRNVSLH.NCSL...GN.N.....VLIEN..........V.....QN.......YIA..N..YR........IGDNTIIQNLELM.....Y.........V.E........G..K..........SSFGNGVQ......................ASVLNET.GG.REVGINDKL................S.AHFAYIQ..............S..F.Y..R.H..RPI..L.VQKMQEIV.QR.YT.D........EVS.S..E.TG..T..IGNNVKIVNTGTIK.N..VKIGDNAVIEGARILENGSI.NS...NAF...D..P...IHIGYNVMAKDFIISSGSRVEDGTMLARCFIGQSCELGHTYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLISGMY....SFMNAGS....GSNQ.SNHMYKLGPIHQGVMERGGKTTSDSYILWP.........A..RI..G..AFSLVM.GRHY.RNSDTSKMPFSYL.......I..E..........S.......N..D..E.......T..V........LV.PGI.........................NL..R..S..V.G.........T...I.RDAQKFPKRDK.RK.D...P..D..K..LDHLNFNLLSPYTVQKMFQGIDVLK.....G..LQ.ET.C..G..ES........SDA.....................................................................YTYQ.SCR.I........NG....S....S...LK.......RG.....IKFY...N..IAITKFLG.NSII..S.R.......LKDC....P.C...R.N...N....EE.IREAL....N.P..KTTD.G..L.F.QWRDLAGLLAPSTKI.DDLIDDIEAGKLN.T.LEDVNQVFAGLHAN...YYELEWTWAWDK.IQQY..FE.......LS......L..E.T...I.TAKDIIEIVEK.W.KEAVVS....LDNMIYDDARKEFS.LPT...RISFGL...DGNKRD.QKIDFERVR.GV.F..EKNAFVEAVLEHIKVKTQLGNDTIERL......................................................................
A0A3L8A0P8_9BACT/3-651               ..............................................................................................................................................YRALTPNEISVMKQ.N.GCNS..TD..WND.I...K...V.........K...D.........G...F.D.....C.........C.........NYVRVNFSGE...IRL..GLTDE.TV..IG...TAG..I..IV.QSGIFDASLH.NCTV...GD.N.....VHIAK..........V.....WE.......RII..N..YD........ILDGAYITNIGSI.....I.........C.T........G..S..........RAFGNGTE......................VNVLNEQ.GG.RSVLIFEEL................T.AQMAYLM..............T..F.Y..R.H..DKE..F.ITSMDKMI.RD.YA.A........KKK.S..A.VG..K..IGKMAKITNLGSAT.D..VVFDDESYTNSCSLLWDGTV.GK...R--...-..-...AFVGPNVVAEHFVFASEACVDKGAIVKNVFVGQKAELTNGFLANNSLFFANCIMEAGEAVSVFAGPHTVSMHRSTLLIGGMF....SFFNAGS....GTNQ.SNHLYRIGPVHQGIMERGCKTGSGSYIMWP.........A..RI..G..SFSLLT.GKHY.KHPDTSELPYSYV.......V..E..........K.......N..G..K.......T..V........VL.PGA.........................NL..K..K..F.G.........T...I.RDILKWKKRDH.RS.N...D.lP..R..LDIINYDPLTPLTTRKMYQGIHFLN.....L..-C.E-.-..-..TD........PDY.....................................................................PSAH.NFV.I........EH....K....S...IR.......HG.....RELY...A..LGVDFFMG.EEVM..K.K.......LAQI....N.V...T.D..cP....DS.LGYLL....I.P..ESNE.G..V.G.RWVDAAGLIAPATVI.NELCSSVAKGSIS.S.PEELAKSLQAIHNK...YSDYKWEYVADN.FKSC..YG.......IT......L..D.S...L.TKGAAISILHR.W.TESVDS....FDRERNTDAHKDFN.ENS...MVSFGI...DLDPQS.RQVDFNEVR.GL.P..EKNDQMIAVHNHYASLIQEAYAVICR-l.....................................................................
A0A662X748_9STRA/167-568             ...........................................................................................................................................ffp---LSGPEIAALGA.N.GNTS..EH..WEL.V...L...K.........T...S.........EhepL.R.....T.........N.........RIRGCSFHER...VVL..GRFGG.DA..HD...VDG..V..PF.APGVYNSALS.NVVV...LD.D.....ALVLD..........T.....-L.......VLR..N..VV........LDERACVIKCGSV.....T.........C.S........A..Sa........pATCGNGNV......................LHVGVET.GG.RDLCVVADMpf............acE.APESVGE..............A..E.V..R.G..DSE..F.LKKYQAAV.DA.YV.V........AIQ.A..P.MA..I..VARNARVRGCSRVE.G..SFVGEHALLEDCD-VANSTI.LS...TAE...E..P...SVVQTKSIVRDSIVQWNSTVEALSVVENAFLCDASHVERHGVVMNSVIGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASVWp..qGKGNVGY....GANVgSNHTLK-APDQELFPGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVTMPFSLI......nT..P..........G.......H..V..V.......S..S........LS.PAI.........................NE..I..S..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------pgslyel...............................................................
A0A4Q1CF75_9BACT/42-708              ..............................................................................................................................................YRKLSALEIEVLVR.N.RNTS..DN..WNN.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.YY..LE...FHS..V..KL.QVGLYNSTII.SCDF...GD.N.....VVIDN..........V.....-H.......YLS..H..YI........IGNEVIITNVHEM.....G.........T.T........N..Y..........AKFGNGILkqgee...........ekiriwLEVCNEN.AG.RKIIPFNGM................L.PGDAWLW..............S..R.N..R.D..NEQ..L.QEKLKEFT.EN.KF.D........KLR.G..Y.YG..K..VGDRTVIKSCDIIK.D..VWIGSDAYLKGANKLKNLTI.NS...SPQ...A..S...SQIGEGCELVNGIIGEGCRIFYGVKAVRFYMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAATVm.gqSNIAAGAt..lGSNH.NSR----SADGEMIAGRG---------FWPglcvsikhnS..RF..A..SYTLLAkGDYP.AELNIP-FPFSLV......sN..D.........tA.......N..D..Q.......L..V........VM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNAWKYIDRDK.RT.D...K..T..Q..--HLEYDFFAPDSMNEVMHALQLME.....Q..YA.GK.K..A..LT........ENIdtv..............................................................eipaGIFE.NSK.R........KI....V....V...LKt.....sKS.....YHAF...K..ELIIYYAV.EQLL..Q.F.......AATV....N.Y...K.T...A....DE.LFSQL....P.K..K--Q.K..R.S.EWVNVGGQLIPVAEL.NQLKQKIVAGKIK.S.WDAVHAFYAAQAKQ...YPQQKLQHALSC.LFEL..TG.......T-......-..T.K...L.TKETYSSYLQS.Y.LATKIW....MVEGIASSREKDYS.SLF...R-----...-KMMYE.TEAELEAVT.GK.L..KENSFILQQQEELKKTKAVVQKMIK--ls....................................................................
A0A174WGH3_9BACE/18-672              ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGN.V...S...V.........A...E.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFDA.EF..TL...PGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNDTFIENVDII.....L.........V.D........R..L..........TTFGNGVE......................ATVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ISRMKAIT.DY.YS.N........KHA.S..T.VG..S..IGDHVMILNTGSIR.N..VRIGDYCHICGTCRLTNGSI.NS...NVT...A..P...VHIGHGVICDDFIISSGSDVDDGTMLSRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LK.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAINKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....DE.IRQRL....K.P..DTEI.G..V.G.EWVDISGLIAPKSEI.DRLLDGIENGSIN.R.LKSINASFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......LN......P..E.T...V.TAQDVVTIVKA.W.QKAVVG....LDKMVYEDAKKEFS.LSS...MTGFGV...DGSRDD.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEDKTALGNELIKRI......................................................................
W4P8A2_9BACE/4-616                   ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGK.V...L...V.........A...N.........G...F.N.....G.........E.........YVHHTRFSGE...VKL..GVFDA.DF..TL...PGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNDTFIENVDII.....L.........V.D........G..V..........STFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKAIT.DY.YS.N........KHA.S..T.VG..S..IGNHVMIVNAGSIK.N..VRIGDYCHICGTSRLSNGSI.NS...NVT...A..P...VHLGHGVICDDFIISSGSDVDDGTMLTRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDN.RK.D...P..N..C..LDHINYNLLSPYTIQKMFKGRAILK.....E..LK.RV.S..G..ET........SEI.....................................................................YSFQ.SAK.I........KN....S....S...LN.......NG.....IRLY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRRRL....K.P..DTEI.G..T.G.EWVDISGLIAPKSEI.DRLLDGIENGSVN.R.LKSINSSFAEMHEN...YYTYEWTWAYHK.IREF..YG.......LD......P..D.K...I.TAEDIIAIVKA.W.KEAVVG....LDRMVYDDARKEFS.LSS...MTGFGL...------.---------.--.-..---------------------------mep...................................................................
A0A0C1KPA7_9BACT/42-731              ..............................................................................................................................................YRHLNAYEIEVLVR.N.RNQS..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.YC..LE...FKN..L..RM.PVGLYNSTIT.SSDF...GD.N.....VVVDN..........V.....-N.......YLS..H..YI........IGNEVMLVNINEL.....A.........T.T........S..H..........AKFGNGILkdged...........ektriwLEVCNEN.GG.RSILPFDGM................L.PGDAYLW..............S..R.H..R.Q..DEV..L.QKQFVAFT.SK.RY.D........SLR.G..Y.YG..M..VGDRTVIKNSRIIK.D..TMIGTDAYIKGANKIKNITL.NS...TPE...A..R...TQVGEGCELVNGIIGVGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----AADGELIAGRG---------FWPglcvslkhnS..KF..A..AFTIIAkGDFP.AELNIE-LPFSLV.......S..Nd........vS.......N..D..R.......L..L........VI.PGYwf.....................qyNL..Y..A..L.A.........-...-.RNSWKYVARDQ.RT.D...K..T..Q..--EIEYDFLAPDTANDIWKALGILE.....S..IT.GI.A..W..FR........KNGksglessmrkkgkallt...................................erseelddleiilpnaeNSTR.QVI.V........KK....A....A...M-.......-A.....YQWY...K..AFLDFYAA.REII..G.A.......FKAN....P.L...S.T...F....NR.MVAKL....P.A..A--G.K..I.N.EWENIGGQLIPVEIV.NQCLQQIRKGAID.S.WGSLHDFYKKEGVN...YPAKKLAHAISL.YKQM..HG.......VE......L..N.S...-.NPNEVRALLQH.S.ILFRKQ....VSDQIHATRAKDYK.NPF...R-----...-QMVYD.NKEELEAVI.GK.L..EENSFILEDRLHLNSYRKTVNNLLKK-......................................................................
Q7MTP4_PORGI/8-662                   ..............................................................................................................................................YRHLTEEEISVLEG.N.YCQC..AD..WTM.V...E...V.........A...D.........G...F.D.....A.........N.........RCLHVMFSGQ...IRI..GSTRG.SH..LL...PGG..L..HV.PTGINIARLH.NCIV...GD.E.....VVIFH..........V.....NS.......YLA..N..YR........IGDYTRIENIDTI.....A.........V.T........E..S..........TSFGNGVE......................VTVLNET.GG.REVTITDNL................T.AQTAYLM..............A..M.Y..R.H..DKV..L.TESLAAMA.RA.YA.E........SRR.S..D.MG..A..IGSHVVIHGCNTIE.N..VCIGDYTEITGASHLCNGSI.NS...KKE...A..P...VSVGYNVVCRDFILCSGSSVTDGATVSHCFVGQGTHLGHLFSAHDSLFFANCQGENGEACAVFAGPYTVSMHKSSLLIAGLY....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYILWP.........S..RI..G..PFTLVM.GRHV.HHIDSSAFPFSYI.......I..E..........D.......R..N..E.......S..Y........LV.PGI.........................NL..R..S..V.G.........T...I.RDAKKWPARDK.RK.D...P..D..L..LDNINFNLLSPFTAGKMMRGSRKLK.....K..LR.KI.L..G..SE........GQT.....................................................................YVYH.DMR.I........RS....S....A...LD.......KG.....LMFY...E..MGLNKFFG.NSII..K.R.......LEDC....P.C...R.T...D....EE.VLSAL....K.P..THNE.G..D.G.SWVDICGMIAPQQQI.HRLASLIKEGKIK.S.LAEVNERMKEIHSR...YYDYEWCWAYNA.LLEW..YE.......LN......P..E.D...L.TRSKVAELVHT.W.MRSVIR....LDEMLYEDAKKEFQ.MHS...QVGFGI...DLVGEM.KHRDFDEVR.GD.F..ESNPFIVEVVEHIRKKRALGEEMLSRL......................................................................
F4KKJ2_PORAD/1-658                   .............................................................................................................................................m-RKLNTKEIKQLTE.Q.GCQA..QD..WSL.I...R...V.........H...R.........Y...F.D.....A.........S.........RCQQVHFIGK...CEI..GDNRG.GRpsEE...EPS..Y..VE.PYRLAHAKLI.NCTI...GD.R.....VIIDG..........V.....RD.......CIS..H..YD........IGDDVVIHDIATL.....K.........V.M........G..E..........TSFGNGTL......................VEVLNET.GG.REVPICDIL................T.AQTAYML..............A..M.Y..R.H..DKE..L.QAALSTLV.EK.YT.A........SVR.S..D.RG..T..IGESSQIKHCGLMT.N..IKVGPHSSIIGASVLENGSV.NS...TVL...S..P...TRIGYGVICRDFVFSAGCVVADGSNVSRCFIGQGCSVTHLFSAHDSLFFANCQCENGEACAVFAGPFTVTMHKSSLLIAGYY....SFLNAGS....GSNQ.SNHLYKLGPIHQGVVERGSKTTSDSYVLWP.........S..RI..G..AFSLIM.GRHV.DHIDSSDFPFSYI.......I..E..........N.......D..N..Q.......T..Y........LV.PGT.........................NL..R..S..V.G.........T...I.RDTKKWPKRDK.RH.P...E..E..K..LDCINFNLLSPYTVGKMYKGWHKLK.....A..LE.TH.L..G..SS........NAT.....................................................................YIYH.DMH.I........RH....S....S...LV.......KG.....CRYY...E..MGIVKFLG.NSLI..Q.R.......IQTQ....A.P...K.S...K....RE.LVTCL....S.P..TSNE.G..L.S.DWLDLAGMIAPRRLI.RSLITQIKEGQIK.T.LQEVNVAIRSIHSR...YYEIEWHWAYDL.LLRW..YD.......IS......A..K.D...L.TVERVIQIVKE.W.QETVIA....LDECLLKDAHKEFE.MLT...QVGFGI...DLNGEHnRRIDFEQVR.GS.Y..EDNAFVAEVHDHIRRKKLLGETILAQI......................................................................
A0A1H3CIN6_9BACE/21-675              ..............................................................................................................................................YRKLTEDEVLQLKS.Q.SCLA..DD..WGN.V...S...V.........A...E.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFDA.EF..TL...PGG..I..RK.HSGLRHVTLH.NVVV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNDTFIENVDII.....L.........V.D........G..L..........STFGNGVE......................ATVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKAIA.DY.YS.N........KHA.S..A.TG..S..IGDHVMILNTGSIK.N..VRIGDYCHICGTCRLSNGSV.NS...NVT...A..P...VHIGHGVICDDFIISSGSEVDDGTMLTRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....D..LK.RV.S..G..ET........SEI.....................................................................YSFQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..T.G.EWVDMSGLIAPKSEI.DRLLDGIENGSVN.R.LKSINASFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......LN......P..D.E...I.TAQDIICIVKT.W.KEAVVG....LDKMVYDDARKEFS.LSS...MTGFGA...DGSHDE.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEDKTALGNELIKRI......................................................................
W2Q3U7_PHYPN/38-555                  .............................................................................................................................................f-YSLSDGEIRALEA.N.GNCA..ES..WNN.V...YktyA.........H...T.........P...L.Q.....T.........S.........RIRQCSFHGK...VVL..GRFST.FN..HN...VDG..I..PF.PCGVYNSALS.NVVV...LD.D.....SLVRD..........T.....-L.......VLR..D..VL........VDTQASVIKCGSV.....T.........GpE........E..D..........AVSANGNL......................LHVGVET.GG.RNLRVVADL................P.FALGAAV..............A..T.R..R.G..DPD..F.LKTYETFV.DN.YV.A........ALK.A..P.MA..I..VAKNARVRGCSRVQ.G..TFVGGYAVVEDSD-VVNSTL.LS...TQD...E..P...SVIRAKSIVRDSIVQWNSTVEALSVVEGSFLCDTSHVERHGVVMSSVIGPNTSIAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNVGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......G..H..S.......I.pS........LS.PAInei..................spgwVL..A..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEAAILRPEIIQYMKNARAELI.....A..AE.GK.A..K..INl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......AG.....ITVY...T..FFIKLYAL.DELL..Q.L.......VESG....H.V...S.A...D....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gtvgsvdsshy...........................................................
D9SBE7_FIBSS/50-584                  ..............................................................................................................................................YRPMTAFEIQILEK.N.GNNC..DD..WSK.V...L...V.........E...P.........D...F.D.....P.........N.........RIFRSSFMGD...VRL..PKFFG.TL..LL...PGD..I..SV.ATGIYDCMVH.NCII...-E.N.....ALIYK..........V.....-S.......TLS..N..VL........VRSSAVVQNVGTL.....V.........S.S........G..K..........INYMVGSS......................INVGNEM.GG.REVLVFPEL................T.TELVDLQ..............L..F.H..K.A..EQS..V.QDSFTEML.ST.YR.S........ELA.L..P.FG..I..VGKGAVVSNTNIIR.N..SWIGAHSRIEGAAKIRNSII.MS...SLE...E..S...SHVYDSVILENTNVQMGVKVHTGAEVQSSVLMSRCKVGCKAIVKSSIIAPCCHIEEGEVNSSYMGPMTQMHH-HSLLIAALWpegcGNLGYGAn..vGSNH.TGR----MPDQEVMPGQGMFFGLGVNIKFP.........S..NFreS..PFTLIA.SGLT.TLPQRLKFPFSLIhagdpqlV..G..........V.......A..P..R......lN..E........IV.PGW.........................NYakN..T..Y.A.........L...D.RNAYKYAIRGK.GI.V...P..S..T..----FYSIYNPETARLVFDAYNRLQ.....V.sKV.KD.V..Y..TK........SDI.....................................................................DGLG.ENF.L........RE....R....V...RQ.......NA.....IKTY...G..EYLERYVL.DLML..T.L.......VEGDe.slS.K...Q.S...P....RE.LRKLL....G.D..TNK-.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------eiarvvtlpetmddlikryrqldkew............................................
A0A5C1QGW6_9SPIO/40-712              ..............................................................................................................................................YRNLTNNEIELLEM.Q.KNKC..YD..WSK.I...L...V.........T...D.........T...F.E.....P.........L.........QIKHCYFMGT...VRI..DDMEP.IS..LE...FND..V..IL.PVGLYNSQVM.SCDI...GK.N.....CSIHN..........V.....-S.......YLS..R..VL........IGENVMLKDIDEL.....S.........T.S........D..H..........AKFGNGIVkdged...........psgrieLEIANEA.GG.REILPFSKM................L.TVDAYLW..............Y..K.Y..R.D..NKN..L.MESFKLFV.ET.EY.P........SDR.G..Y.YG..F..IGDRTVIKNSRILK.D..VTIGSDAYIKGANKLKNLTI.KS...SPN...H..K...TQIGEGCTLVNGIINEGCKVFYGATAVRFQLMSHSSLKYGARLINSVLGENSTISCCEVLNSFIYPGHEQHHNSSFLIASVLk.gqTNIASGAt..iGSNH.NSR----ANDGELVAGRGFWPGLNCSLKHD.........S..KF..A..TFNIVVkGNYT.KEINNP-LPFSLI......sL..N..........K.......N..D..K.......V..E........VF.PGYwf.....................lhNM..Y..A..L.K.........-...-.RNSWKYGVRDQ.RE.K...N..F..P..--RLDFDFLAPDTVSEMLEGREFLE.....K..CA.EY.S..Y..RK........ISTdihtgedll...................................................neyddfgnfTIYS.-TT.I........EN....KnhgvL...IHk....paVA.....YKEY...Y..KMITLYSV.DTIL..K.F.......FKDG....-.-...-.-...-....GD.IS-QL....-.-..NGLV.N..P.D.KWINCGGQFIPDDRV.KSIIDDIVDKKIT.S.WDELHSRYKMVSKL...YDRDKAGHAFYV.LQKL..NK.......VD......-..-.R...L.NWQQWLDAVDT.A.IKARIE....IKERVYSSREKDFN.CSF...R-KITF...D-----.SKEEKEAVI.GK.L..DDNSFFKIEEEECA-------------sfiemtksvdl...........................................................
A0A1M6M0L0_9BACT/10-664              ..............................................................................................................................................YRPINNDEIGQLIY.Q.GCSS..PD..WNL.V...K...V.........S...P.........D...F.S.....P.........D.........NIENTKFTGY...IRL..NSFMK.SV..NL...VGG..I..TF.HTGIYNAWLH.NCEV...GK.D.....ALIHN..........V.....RS.......YIA..N..YY........IGEGVVIHNVTTI.....A.........V.D........G..E..........SAFGNGVE......................VEAINES.GG.RAIPIYDFL................S.THIAYML..............T..L.Y..R.H..RPT..V.VANLKKMV.GN.YV.E........NIK.S..S.VG..T..IGAHSKILNCNTVL.N..VKIGPQTSIDGGKKLQNGSI.NS...TRE...A..P...VVIGEGVIMEDFIVCSGSRITDATLISKCFVGQGCILDKHYSAVNSLFFANCQGFHGEASSVFAGPYTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHLYKLGPIHQGIMERGAKTTSDSYLLWP.........S..RI..G..AFSLVM.GRHY.KHCDTADFPFSYL.......I..E..........S.......N..D..E.......S..I........LV.PGI.........................NL..K..S..I.G.........T...V.RDTQKWPRRDN.RK.D...S..N..L..LDLINFNLLSPYTIHKMLKGRQKLM.....D..IQ.KY.S..G..EF........ASE.....................................................................YSYD.KMK.I........EK....R....A...LE.......RG.....IKLY...E..MAIWKFLG.NSLI..S.R.......LRGK....N.Y...R.S...N....DE.IRETL....N.P..DTPV.G..K.G.FWVDLSGLICPFEAL.DRLLKSVENSETT.T.LEEVNAALFALHKN...YYNYEWTWAADV.LGAF..YD.......KP......I..N.E...F.TAADVITVVEK.W.KESVLG....IDRLLYEDAKKEFS.LTK...MTGFGV...DGQNGA.RELDFAEVR.GE.F..EKNETVNAIRQHMKTKEMLGDELITRM......................................................................
A0A1M5C8P4_9BACT/3-657               ..............................................................................................................................................YRKLTVSEIEKLQA.Q.ACTS..QN..WDI.I...T...V.........H...P.........N...F.D.....T.........Q.........YIHQVNFSGD...IRL..GYFES.EF..DL...PGG..L..KK.HSGLKNVCLH.NCTI...GN.N.....VLINN..........V.....HN.......YIA..N..YE........IDDDTFIENLELM.....Y.........V.E........G..R..........TSFGNGVQ......................ASVLNET.GG.REVSINDKL................S.AHFAYIH..............S..F.Y..R.H..RPL..L.VQKMEEIV.QR.YV.N........EVT.S..D.IG..T..IGKNVRITNTGTIK.N..VRIGDCAVIEGSRIIENGSI.NS...NEY...D..P...VHVGYNVMIKDFIICSGSRIEDGTMLARCFIGQACELGHTYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLISGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGVMERGGKTTSDSYILWP.........A..RI..G..AFSLVM.GRHY.RNSDTSKMPFSYL.......I..E..........N.......N..D..E.......T..V........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKFPKRDK.RK.D...P..N..Q..LDQINFNLLSPYTVQKMFQGIEALK.....A..LQ.ET.G..G..ES........SQT.....................................................................YTYQ.SCR.I........NG....T....S...LK.......RG.....IKYY...N..IAITKFLG.NSII..S.R.......LKNC....A.C...K.S...N....EE.IREAL....N.P..TTTD.G..L.F.QWRDLAGLLAPSTKI.DDLIDDIEAGKLT.Q.MEEVNKVFAELHKN...YYELEWTWAWDK.IQTY..FE.......VS......L..E.T...I.TAKDIIDIVEK.W.KDAVIS....LDKMIYDDAKKEFS.LPT...RISFGL...DGNKRD.QKIDFERVR.GV.F..EKNAFVEAVLEHIKVKTQLGDNTIKKL......................................................................
A0A396M6F7_9BACT/484-616             .........................................................................................................................................ppdps--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..M.R.EWIDLAGMIAPKSRI.EALLDRVDAGAVA.D.TDAFVGELESIDRD...YGSNERRWALYA.LAVF..LD.......KS......E..D.R...I.TPDDIASLVEQ.G.ARDRAA....LAAAIAQDAGRDFA.PAM...SVGYGI...DD-GER.RAEDFRAVR.GE.-..---------------------------pk....................................................................
A0A4Y1WT27_9BACT/443-573             .........................................................................................................................................gdgyd--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.G..R.G.AWIDAAGLYLARSCM.EELLDAIEQDAVT.T.PEALTERLQAFAEH...YDDYARSWALDI.LARR..LG.......HT......P..D.A...-.--AEIERAVVE.G.KAAQQE....LQRLAEADRAFDCS.FDM...AVGYGL...DAATDDeRRADFRAVR.G-.-..---------------------------l.....................................................................
A0A2S5A156_9SPHI/41-728              ..............................................................................................................................................YRQLRRDEIQLLQA.N.NNLS..DE..WTN.I...W...V.........T...D.........K...F.N.....P.........S.........YVRNCNFYGL...IRI..GDLEE.YF..LE...YHD..M..RY.PVGLYNSTIV.SCDL...GN.N.....VSLNN..........V.....-N.......YVS..H..YI........IGNESILFNVNEL.....Q.........V.S........N..H..........SKFGNGIIkeged...........esiriwLEVCNEN.GG.RKILPFDGM................L.TSDAFLW..............S..K.Y..R.D..DEE..L.MQKFIELT.QH.QF.P........LVR.G..Y.YG..T..IGEQCVIKNCQIIK.D..VKVGDGAYIKGANKLKNLTI.NS...NFE...S..C...TQIGEGVELVNGIIGYGCKIFYGVKAVRFSLGNNSSLKYGARLINSILGENSTISCCEVLNCLIYPGHEQHHNNSFLIAATVl.gqSNIAAGAt..iGSNH.NSR----ANDGEIVAGRG---------FWPglcvslkhnS..KF..A..SFTLLAkGSYP.AELNII-LPFSLVs.....vN..E..........R.......D..H..V.......L..Q........II.PAYww.....................myNM..Y..A..L.A.........-...-.RNSWKYLARDA.RI.V...K..Y..Q..--EFEFDYLAPDTIEEIFNAMEQLE.....I..WT.GA.D..Q..TR........KKElnglagkplkeigrs......................................vitnhskklnqieilgGIIE.ANS.R........KS....I....I...LKp.....gEA.....YDSY...R..EMIHYFAI.KTLI..Q.Y.......ARTH....K.L...S.T...L....QQ.ITARL....G.E..TK--.-..R.C.KWINLGGQLVAEHDL.VELKNKIKDGSLS.S.WNKIHDHYNYLQRF...YEQRKAEYAFAA.LKEL..HQ.......VQ......S..L.Y...-.EIENLWNNWLD.WaIEIAAK....VKDRTFDSRNKDYI.SEF...R-----...-KLPYD.NDKEMEMVV.GS.I..NDNEFIKTVQNNY--------------lkfleqvaqy............................................................
A0A370AU59_9SPIO/42-716              ..............................................................................................................................................YRQLSAHEIEVLVK.N.ENSA..DN..WND.I...Y...V.........T...D.........K...F.N.....P.........K.........LVKHNEFHGL...IRI..GNLEN.YS..LE...FHD..I..PF.PVGIYNSQII.SCDM...GS.N.....VSINN..........V.....-N.......ILS..H..FI........IDDEVILQNINEL.....V.........T.T........N..Y..........AKFGNGIIkegee...........edvriwVEVSNEN.GG.RRIIPFDGM................T.AGDAWLW..............S..R.N..R.D..REQ..L.MEKLKAMT.QS.RF.D........VRR.G..Y.YG..R..IGTRSVLKHCRILK.D..VTIGSDAYIKGSNKLKNITI.NS...SPA...A..P...SQVGEGVELVNGIVGYGCHIFYGAKAVRFVMDDHTNLKYGARLINSFLGNNSTISCCEVLNALIYPGHEQHHNSSFLCASTIl.gqSNMASGAt..iGSNH.NSR----GNDGEIVAGRGFWPGLSTSLKHN.........C..QF..S..SFNLLVkGAYP.AEINNP-LPFSLVs.....nD..E..........A.......H..D..C.......L..N........II.PGYwf.....................ryNM..Y..A..L.A.........-...-.RNSWKYGARDK.RI.K...K..N..H..--MIIFDYLAPDTSNEIFTAMDLLR.....Q.yME.KT.P..E..YQ........KQNkhss............................................................thdfmCSED.IPN.L........KM....N....D...LE.......NGkrdvfILKP...C..SAYREYRD.MLIY..Y.S.......VKTI....-.V...E.S...G....IE.AGTLL....K.Q..IINC.G..E.RtKWENVGGQLIRKSKI.KKFLKNIETDRIS.S.WDEIHEYYKYEADK...YQRDMGDHAVAS.LKDL..LI.......IE......G..M.E...E.NSDSLINYFRR.S.VEISSR....LTQRCYESRAKDYS.NSF...R-----...--NMTFsSDSERDAVI.GP.L..EENSFIKKTKEDAAELEKKIS------aflr..................................................................
A0A6I6JJI1_9BACT/10-664              ..............................................................................................................................................YRSLYDEEIGQLVH.Q.GCSS..TD..WSL.V...R...V.........S...N.........D...F.I.....P.........D.........NVENCKLTGH...IRL..NSFSQ.TV..EL...IGG..I..TF.KAGIYNAWLH.NCEV...GK.N.....ALIHN..........V.....RS.......YIA..N..YN........IGEGVIIHNVTTV.....A.........V.D........G..E..........TTFGNGIR......................VETINEG.GG.REIPIYDHL................S.THVAYMM..............A..L.Y..R.H..RPK..L.VEALVQMV.DE.YS.G........YVK.N..D.VG..V..IGAHSRIINCNTIL.N..VKMGPATVVDGGKKLKNGSI.NS...NFE...A..P...VEIGEGVIMEDFIVCSGSRVTDATLVAKCFIGQGCILDKHYSAVNSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGMY....SFLNAGS....GSNQ.SNHLYKLGPIHQGIMERGAKTTSDSYVLWP.........S..RI..G..AFSLVM.GRHY.KHSDTTDFPFSYL.......I..E..........S.......K..D..E.......S..I........LV.PAI.........................NL..K..S..I.G.........T...I.RDSQKWPKRDN.RK.D...S..N..L..LDLINFNLLSPYTIQKMMNGRKKLK.....A..IR.KT.S..G..EF........ASE.....................................................................YSYE.KMK.I........EK....K....A...LD.......RG.....IDLY...E..MAIWKFLG.NSLI..T.R.......LQGK....E.Y...Q.N...N....DE.IRETM....K.K..DTAL.G..V.G.LWVDLSGLICPYEAL.NNLLKSIEDKVIT.S.LEEVNSALTALHKN...YYNYEWTWAHDV.LGRY..YC.......RK......P..E.D...F.TAEDVIDIVEK.W.KGSVLG....IDRLLYEDAQKEFS.LTK...MTGFGV...DGQNGD.REMDFTQVR.GE.F..EENVTVKAIKVHMETKERLGEELISRM......................................................................
A0A1I5K1T3_9BACT/4-611               ..............................................................................................................................................YRQLTQEEIEVLER.N.SCWA..ED..WDR.V...M...V.........A...D.........T...F.K.....P.........Y.........GFHRVVFYGD...IRL..GSFDK.QV..EV...TKG..F..TK.HAGINDATLR.NVTV...GN.D.....CLIEK..........I.....GN.......FIN..N..YT........IGDDCYISNICTL.....E.........T.T........E..G..........ATYGEGHV......................VSVLNEM.GD.GNVILFHDL................N.SQLAALM..............V..K.H..F.R..DKS..L.RDNITRLV.NE.EI.R........FTL.P..E.RG..T..IGNGVKIINTKEIT.N..TVIKDDCEVNGAARLSDCTI.MS...SKD...A..S...VYIGTGVICENSIISNGCSITNSVKMQDCFVGEACQITNGFTAEASVFFANSFMANGEACAAFCGPFSASHHKSSLLIGGEY....SFYNAGS....NTNF.SNHAYKMGPMHYGVLERGSKTASGAYVLMP.........A..KI..G..AFSVCF.GKLM.NHPDMRCLPFAYL.......M..A..........Y.......G..E..T.......M..Y........IV.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDR.RA.P...S..S..R..KSIINFDWLSPFTVGEIVQGKKILE.....A..LR.LA.G..G..DN........VSS.....................................................................YNYH.EYI.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.A.......VKGG....F.L...G.-...-....--.-----....K.P..ASTI.G..E.G.DWNDLSGLLLPASEE.QRLIDDIKSGNIE.S.IKDILNRFREIDSH...YREYQWTWTYRM.ILDY..YG.......L-......-..E.E...L.TEPAMQRIRED.Y.VRARRA....WIAEIRKDAEKEFA.MG-...------...------.---------.--.-..---------------------------dveqdvfddfiskldh......................................................
A0A2V3PLW3_9BACT/3-657               ..............................................................................................................................................YRKLTESEIVELQN.Q.GCVA..SN..WDS.I...S...V.........H...R.........Q...F.N.....T.........A.........YIRHVNFSGD...IKL..GIYEK.EF..TL...PGG..I..KK.HSGIKNVTLH.NCEI...GN.N.....TFISD..........V.....NN.......YIA..N..YK........IGDNVFIHNLELM.....Y.........V.D........H..E..........SSFGNGIE......................VTVLNET.GG.REVIIHDKL................S.ASFAYIM..............S..F.Y..R.H..RPA..L.IHKMQEIV.KL.YT.Q........QNT.S..N.IG..T..VGNNVKIINTGTIK.N..VRIRDYATIESTCHLENGTI.NS...NEY...D..P...VHIGYNVMAKDFIISSGSHVEDGTMLTRCFIGQACQLGHTYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLISGMY....SFMNAGS....GSNQ.SNHMYKLGPIHQGVMERGGKTASDSYILWP.........A..KI..G..AFSLVM.GRHY.RNSDTSKMPFSYL.......I..E..........H.......D..D..E.......T..V........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKFPKRDK.RK.D...P..H..K..MDQINFNLLSPYTVQKMFQGIEVLN.....E..LL.ST.C..G..EA........SVH.....................................................................YTYR.GCR.I........KG....S....S...LR.......SG.....LKYY...D..IAITKFLG.NSII..S.R.......LSNC....P.C...T.S...D....EE.IREYL....K.P..DSSA.G..L.D.KWRDLAGLLAPSTEI.DKLIEDIESGRLT.C.IEDINAVFEKLHKD...YYSLEWTWAWDK.IQEY..FN.......LS......P..D.T...I.TAKDIITIVEK.W.KEAVVK....LDWMIYEDARKEFS.LPT...HTSFGM...DGNKKD.QKIDFEQVR.GI.F..EKNAFVEAVLEHIKVKSKLGEDTIERL......................................................................
A0A1A9HZ91_9BACT/41-733              ..............................................................................................................................................YRSLTRQEIAILKS.N.GNRS..DN..WAQ.V...L...V.........R...E.........G...I.D.....I.........L.........LIEECTFFGL...VRI..GKLEP.YF..LE...FSQ..L..RT.PVGLYRSLIV.SCDI...GD.N.....VSINN..........V.....-R.......MLS..H..YI........IEDEAILINVNEM.....S.........C.T........S..H..........SKFGNGIVkdgep...........eevriwLELCNEN.GG.RKVIPFDGM................L.PGDAWLW..............S..K.N..R.A..NKK..L.QEAFKAFT.DQ.KF.G........TYR.G..T.YG..T..VGKRSVIKNTHIIK.D..VKIGSDAYIKGANKLKNLTI.NS...NEN...A..K...SQIGEGCELVNGIMGAGSRAFYGVKAVRFILAPFSQLKYGARLINSYLGENATISCCEVLNTLLFPAHEQHHNNSFLCASLVm.gqSNIAAGAt..iGSNH.NSR----AADGELQAGRG---------FWPglcvslkhnS..KF..A..SFTMIAkGDYP.AELNIP-MPFCLI.......S..Nd........vH.......N..D..Q.......L..L........IM.PGYwf.....................myNM..Y..A..I.L.........-...-.RNERKFADRDR.RK.E...K..E..Q..--LLEYDFLAPDTVNEIFTALRLLC.....L..YT.GK.A.fY..QA........SKMigsdkdfeqkgkell......................................dkqapvvsqleiiaagMENA.HRP.V........LL....I....K...VQ.......QG.....YQLY...K..KMVAYYGS.CLLI..N.H.......LQQS....G.D...I.N...I....AA.VQQLF....E.Q..--AG.K..R.K.KWSNVGGQLIQDAAV.EQLIDIITSGNATgG.WHTVHEFYRQEAAK...YPLQKLLHGLSA.LMEI..KE.......FR......P..T.D...V.NKQLLKILMHD.A.IEMKES....IAQSVYTSKIKDYE.NPF...R-----...--KMVYsSTEEMEQVI.GK.L..KDNQFINEQLAETEAFKKEVGQLIH--sl....................................................................
A0A1T5K497_9BACT/3-660               ..............................................................................................................................................YRCLSAAETAALEK.N.GCRC..ED..WTK.V...R...A.........Aw.gK.........D...S.Y.....T.........D.........YISETEFSGD...INL..GRFDK.TI..TL...PGG..L..ER.HSRISKACLH.NVTI...GD.N.....CIVNN..........I.....GE.......YLA..N..YS........IGDNCIIENVDLL.....T.........V.D........G..R..........CTFGNGVE......................VSVLNET.GG.REVAISDKL................S.AHTAYVM..............A..M.Y..R.H..RST..L.HDRLEEIT.RN.YA.E........KHA.S..E.IG..T..IGNDVTIRNCGSII.G..VRIGDCARLEGVRKLSNGSI.NS...NAS...D..P...VHVGSGVIASDFIISSGAHVEDNAMLDRCFVGQACRLGHGYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........S..RV..G..AFSLVM.GRHV.TNSDTSNLPFSYL.......I..E..........K.......N..N..T.......T..F........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDA.RK.D...P..C..K..LDFINYNLLSPYTIQKMFKGLKTLR.....N..LV.YA.S..G..EL........TDV.....................................................................YSFH.STK.I........AN....K....A...LR.......KG.....IGFY...E..TGIKKFLG.NSLI..K.R.......LENL...pA.G...A.S...D....AE.IQAML....K.P..DTEI.G..H.G.YWVDISGLIAPKSEI.DNLLDRIENNEIN.T.LKDINAEFGKIHSN...YYTYEWTWAYDK.IQEF..FG.......ID......P..A.K...M.TAEQATMIVEQ.W.KESVIG....LDRMVYEDAKKEFS.LAS...MTGFGV...DGHKEE.KEQDFEQVR.GD.F..ESNTFVTAVLDHIQKKTALGDDLISRL......................................................................
A0A4V5MKB4_9SPHI/42-725              ..............................................................................................................................................YRYLTAAEIDILHH.N.GNYS..PN..WSD.V...R...V.........T...E.........Q...F.I.....P.........E.........QIQNSKFYGL...VRI..GNMSP.SF..VE...FRD..L..KL.PVGIYNSQII.SSDI...GN.D.....VAIHH..........V.....-R.......YLS..H..FI........LGNEVILSSVNEM.....E.........T.S........P..T..........AKFGNGIVkdgeq...........esqrivLELCNEN.GG.RSVVPFEGM................Q.AADAYLC..............T..R.F..R.G..DDV..L.QRRFLEIT.EN.QF.S........KKR.G..F.YS..T..IGNRTVIKNSNIIK.D..VKIGSHAYIKGVNKLKNLTI.NS...IEG...A..Y...TQIGEGCELVNGIIGYGCRVFYGVKAVRFILSSFSQLKYGARLINSFLGDNSTISCCEVLNSLLFPAHEQHHNNSFLCASLVk.gqSNMAAGAt..vGSNH.NSR----GADGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIR-MPFSLV......sH..D.........vA.......N..D..Q.......V..V........II.PGYwf.....................lyNM..Y..A..L.M.........-...-.RNTSKFLNRDK.RQ.L...K..N..Q..--YLEYDILAPDTVNEMFSALKELE.....Y.aVG.KS.L..V..QE........S-Tgrdqdfekkgkeql........................................tdpavhlqheirldnAEAS.KRK.V........LV....T....K...AK.......ES.....YLVY...K..RMIAYYAG.TMLV..E.Y.......LSEN....S.I...E.Q...L....KD.LLANL....-.-..-SDM.K..R.G.EFVNLGSQLVLKKDL.DLLLEDIKSGQYN.S.WEEIHDYYHKLSAN...YPLEKLKHAIAS.YTEL..EN.......LS......A..D.K...W.DRGFINTLIQT.T.LETKRW....INEEIFKSRSKDYE.NQF...R-----...--KMVYdSQEEMEKVV.GK.L..KDNAFINQQADEL--------------tllefqigqi............................................................
A0A1I6VZN9_9SPHI/41-720              ..............................................................................................................................................FRQLTSEEIAILTE.N.NNVS..SN..WDD.V...W...V.........T...D.........R...F.I.....P.........Q.........QIQYSKFYGF...VRI..GDMDD.VY..LE...YRD..L..RL.SCGIYHSCIV.SCDL...GN.T.....VAIHH..........V.....-R.......YMA..H..FI........IGDDVMLTNINEM.....E.........T.N........S..A..........AKFGNGMRkrgev...........eerrirLELCNEN.GG.RAVLPFDGM................Q.AADAYLW..............S..R.H..R.H..DTL..L.QKRFEEIT.EN.QF.S........DAH.G..F.YS..Y..IGDRCVIKNSHTIK.D..VKIGTDAYIKGVNKLKNLTI.NS...CED...A..Y...TQIGEGCELVNGIIGYGCRVFYGVKAVRFVLSSFSQLKYGARLINSFLGDNSTISCCEVLNSLLFPAHEQHHNNSFLCASLVk.gqSNMAAGAt..vGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HALDIR-LPFSLV.......S..N..........Ev.....sT..N..N.......L..L........VM.PAYwf.....................mhNM..Y..A..L.M.........-...-.RNETKFEARDK.RK.F...K..N..Q..--YIEYAILAPDTVNEIFEALTEIE.....V.aVG.RA.F..G..AH........LSMeeqrqigrrm................................................lesaesfggreITLQ.GVE.A........SK....R....K...VIlv..kprES.....YQVY...K..RIIRYYAA.SQLL..Q.H.......FEQD....G.Y...-.-...-....EQ.VLTNC....K.E..--AT.H..R.K.AYENIGGQLVPKEEL.EVVLQQIRQGEIT.S.WDEVHQQYQVWSDN...YLNDKLIHAIAS.LVEL..IG.......MS......V..E.E...W.TPTFLRDLFEE.A.KSTREW....ICAEIHRSRAKDYD.DPF...K-----...-LMVYE.SMEEMEEVV.GK.L..AENDFINKEQEATTT------------fvnrierl..............................................................
H1XPF7_9BACT/41-722                  ..............................................................................................................................................FRNLTSREIEILVK.H.NNSA..ES..WDR.V...L...V.........T...D.........H...F.N.....P.........N.........LVKNCEFWGL...VRI..GDLQS.GY..LA...YHK..L..RL.PVGLYNSTII.SCDL...GD.N.....VVVRN..........V.....-R.......YLS..H..YI........IGHHTILFNLDEM.....I.........T.V........D..N..........AKFGNGIVkeget...........edvriwIELANEN.GN.RAILPFVGI................L.PADAYIW..............S..R.N..R.A..DRK..F.QQKLKELT.DK.LG.D........TRR.G..Y.YG..E..VGDHCVIKNSRIIK.N..VNFGSYCYVKGANKLKNLTI.QS...SAD...E..P...SQIGEGVELVNGIIGYGNRIFYGVKAVRFITGRNVQLKYGARLLNSFLGDNSTISCCEVLNNLIFPFHEQHHNNSFLIAATVq.gqANIAAGAt..iGSNH.NSR----APDGEIIAERGFWPGLCSNFKHN.........S..YF..A..PFALVAkGTYY.SELNIK-LPFALVs.....pA..D..........K.......A..N..E.......I..N........IY.PGYwf.....................khNM..Y..A..L.A.........-...-.RNSWKFKNRDK.RV.I...K..E..Q..--HIETDYLAPDTVESMISGIEILR.....Q.gIC.QA.A..G..KE........FSIaeiieqqnsi.................................................dgklqvvlndFVYH.G--.-........KA....R....V...LKp.....aQG.....LHLY...Y..QMIAYYGG.LALY..E.F.......LKTQ....S.F...K.S...E....KE.LAAAL....Q.E..RLTE.H..H.R.KWVNLGGQLVPAAEV.QKLIDDIKSGLLD.S.WQKIHERYDRLWEA...YPRQKWSHAVYS.LLDL..YE.......IT......P..H.D...L.TFERLRKILKH.V.KEIAGQ....LLKNAFKSREKDYT.NPY...R-----...--KMTYeNEQEMEAVL.GK.I..EDNSFLVEFENEVKEMQQQIDGILAKL......................................................................
A0A399D8B6_9BACT/10-664              ..............................................................................................................................................YRPLSDEEIGQLVY.Q.GCSS..PD..WNL.V...K...V.........S...P.........D...F.T.....P.........D.........NIENSKFTGH...IRL..NSFNR.TV..NL...VGG..I..TF.HTGIYNAWLH.NCEV...GK.D.....ALIHN..........V.....RS.......YIA..N..YK........IEEQVIIHNVTTI.....A.........V.D........G..E..........TSFGNGVN......................VEAINED.GG.RAVPIYDFL................S.THVAYIM..............A..L.Y..R.H..RPG..V.VLALKNMV.ES.YT.E........SVK.S..S.TG..V..VGAYSKILNCNTVL.N..VKVGPATTIDGGKKLKNGSI.NS...TLE...A..P...VMIGEGVIMDDFIVCSGTRITDATLLSKCFVGQGCILDKHYSAFNSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGILERGAKTTSDSYLLWP.........S..HI..G..AFSLVM.GRHY.KHCDTADFPFSYL.......I..E..........S.......K..D..E.......S..I........LV.PAI.........................NL..K..S..I.G.........T...V.RDTQKWPRRDN.RK.D...S..N..L..LDLINFNLLSPYTIQKMVNGLKKLQ.....A..IR.KS.S..G..EF........ARE.....................................................................YSYD.KMK.I........EK....R....A...LE.......RG.....IVLY...E..MAVWKFLG.NSLI..T.R.......LQGT....E.Y...A.S...N....KE.IRKTL....Q.P..DTTL.G..K.G.YWVDLSGLLCPFEAL.DKLLRSVEDGETT.T.LEEVNAALIALHKN...YYNYEWTWAVDV.LQKF..CN.......KK......L..D.E...F.TAEDVIDVVEK.W.KKSVLE....IDRLLYEDAKKEFS.LTK...MTGFGV...DGQNGA.RELDFAEVR.GD.F..EKNETVKAIHVHMQNKENLGNELIGRM......................................................................
A0A1Z5KA40_FISSO/43-545              .............................................................................................................................................m-RGLFSDEIDALQQ.Q.SCSC..ED..WSQ.V...R..lV.........T...P.........T...A.T.....IneshaiglsN.........VIQETRFADTailVFV..DEEED.ST..EN...PTW..I..KKlPPGLHSNLLI.SNSI...IDlR.....AKVYR..........-.....NT.......SIC..N..TY........IGPFATIINCGTI.....D.........W.S........S..N..........DHLGLMTI......................TVGAERG.GG.RPITVHPEV................D.-------..............-..-.-..-.-..MPH..V.VQQMKASAlHK.TH.P........SGM.I..H.MN..I..VDQHALVRDTPTLE.S..IYLHPHASIQGATSISNAIL.LP...H--...-..-...SKIASGSTVQNVMLQWNACIVEHSSVSDTLLMEEAQAGPHSLVVSTILGPDVHVSAGEVHASIVGPNTNAHHQ-SLLIGCLWp..lGRGNVGY....GANVgSNHTGRL-PDQECTAGEGVFWGLSTVIKFP.........V..DLssA..PYTLVAaGT-T.LPPQRVTMPFSLI.......V..A..........S.......G..E..G.......N..D........IL.PGW.........................LL..R..SspY.T.........L...A.RNEAKYATR--.RK.A...Q..R..H..LDYTGWKILRAETASLCWHARQALL.....S..PA.SS.V..SiySE........TEI.....................................................................PGLG.ANR.L........SE....R....G...RL.......AG.....VEAY...T..NCIQMFAL.RGLW..Q.F.......IVDN....G.L...Q.R...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ngtillqselassi........................................................
D3ILB9_9BACT/3-593                   ..............................................................................................................................................YRLLTDEEITLLED.H.GCQA..EN..WEA.I...M...V.........A...E.........D...F.K.....P.........T.........YVHDVTFYGD...IKL..GVFEK.NI..EV...SRG..F..LK.HSGLRNATLR.NVCI...GD.N.....SLVEN..........I.....GN.......YIN..N..YT........IGEECYISNVSTM.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GE.GNVTLFDGL................N.SQLAAFM..............V..K.H..N.A..DRE..L.RERLRQMI.AE.EL.E........RAL.P..D.RG..T..IGFGVKIVNTREVV.N..TIVQDNCEVNGAARLFDCSL.LS...AAG...S..G...VYVGSGVICENSIVADGSSITNDCNLQDCYVGEACQLTNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGAMF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGTKTASGAYILMP.........A..NI..G..AFSVCF.GKLM.HHPDTRNIPFSYL.......I..A..........Y.......G..D..I.......M..Y........LV.PGR.........................NL..N..T..V.G.........L...Y.RDVRKWPKRDI.RP.R...S..G..Q..KSIVNFTWLSPFTVNEMLQGKHILE.....K..LR.EA.Q..G..EN........VAE.....................................................................YNFR.GYV.I........TN....N....S...LN.......IG.....LRNY...D..MAIKMFLA.RCVR..K.Y.......----....G.-...-.-...-....--.---PT....E.P..ASTT.G..W.K.QWSDLSGLLLPESEE.LRLIEEIKNREIT.D.IQRVTERFGEIGER...YEQYEWAFAYRL.INEY..YG.......IA......Q..P.R...-.-HADWQDIIDQ.G.REAKRQ....WIATIREDALKEYK.L--...------...------.---------.--.-..---------------------------gdve..................................................................
A0A1F1DUM3_9PORP/1-653               .............................................................................................................................................m-RHLTEEEITLLEEnR.RCQA..DD..WSR.I...E...V.........S...E.........T...F.A.....P.........S.........QLTEVTFVGH...CTL..GDLSG.TH..ID...RYG..I..KR.SNGICHALLK.DTTI...GD.G.....AYIAN..........V.....RD.......CIS..D..YD........IGADVTISNVNAI.....Y.........M.S........G..A..........STFGNGVS......................VPVLNET.GG.IEVPLSRKL................T.AQIAYLL..............V..T.T..P.D..SDP..V.HQELVRLI.SA.DV.E........ECR.S..E.RG..T..IGDNVRIVNTGTVT.D..GYIGDGSIIDGASILSDFSL.CS...RPG...Y..P...AVVGNGVIGKHFIAAAGASMVDNCTLHMVFVGQSAKVGNLFSANESLVFSNCTLENGEAAAIVAGPFTVSMHKSSLLIAGLF....SFLNAGS....GSNQ.SNHLYKTGPIHHGVVERGSKTSSDSYILWP.........S..RI..G..PFSLIM.GRHT.DHVDTSAFPFSYV.......I..E..........N.......H..N..E.......T..Y........LV.PGR.........................AL..L..T..I.G.........T...M.RDAKKWPSRDH.RP.G...D..C..K..LDCVNYNLLSPYTVGKMEQGYRKLQ.....E..LL.DF.V..G..QH........DET.....................................................................YIYH.NLH.L........KS....S....S...LH.......HG.....LRIY...R..LGIDKFIG.NSLI..T.R.......IRDKvesrE.I...A.T...I....ED.LNRLL....R.P..DHDE.G..V.G.PWTDLCGMIAPERGV.RRLADGLRETAYA.T.IDDFSSQVRSLHER...YYELEWDWSYDL.IYRW..YG.......LD......K.sE.S...L.TAEVVHEILDR.W.IDAVLT....IDRSLIQDAAKEHA.IDR...RISS--...---SAT.TQLDA---A.DE.L..DQDVYVQCVREHMERKQSLYDSVVRQL......................................................................
D8I9Y1_BRAP9/23-668                  ..............................................................................................................................................FRKLKENEIDFLKS.Q.GCIS..QS..WDK.I...L...I.........K...-.........N...V.D.....L.........T.........RIKDVTFHGK...IKI..NELNG.NV..KY...YNK..L..KV.PASINRATLI.DVFI...NG.N.....VYINN..........I.....GR.......FIA..N..YK........IQNGVIIENAGAI.....Y.........M.E........G..E..........SSFGNGVE......................TSPIMEG.DG.RSVKIFYRL................N.SHIAYIV..............A..M.Y..R.H..KKL..M.RDNINKII.DD.YA.K........SKT.K..K.FG..K..IKKHAQIINARIIK.N..SLIDPYATIENTDEINNTTI.IS...TKE...C..P...SYIGTSVILKDSIVLKGAHIVDGTVIKKAFIGEGVKLGRQFSCEDSLLFANCEGEHGEMFSIFAGPYTVTHHKATLLIASHF....SFFNAGS....ATNQ.SNHMYKLGPYHHGFMERGCKTGSNSYILWP.........S..HI..G..AFSTVI.GSHY.DNVDTSDFPFSYI.......T..E..........H.......G.yH..Q.......T..R........LI.PAL.........................NL..F..G..V.G.........L...S.RDENKWRDRDR.RV.G...D..K..K..-DLIIFDVFSPYTVSKMIKAEEILN.....N..IK.KEiI..N..DE........VEY.....................................................................IKYK.NMI.I........KT....S....S...LN.......KY.....SNRY...S..IAIDLYLH.NKLL..E.Y.......IKES....-.-...-.-...-....DN.LNDIF....-.N..DTNK.F..Y.E.TWVDVGGLICAKEKL.DDVILNIENNNIN.N.VQDLVKSFEELYNN...YSTDEKSWVINM.IKKR..YN.......IN......-..-.T...I.NIDVIIKMLKE.H.LSLLTT....SYEIFYRDVKKEYD.LAK...MVSCGI...DD-KTV.MEEDFKAIR.GT.A..KDNAFVIKYKNDVETKIEDINKLIKKL......................................................................
E4T878_PALPW/4-655                   ..............................................................................................................................................YRPLLDKEIATLTV.Y.GCSA..EN..WKE.V...Q...V.........T...E.........E...F.S.....P.........S.........YFYNVHFSGT...VFL..GNYTE.VF..EL...AGG..I..KK.HAGIYNCHLH.NCTI...GN.N.....VFIDK..........I.....NN.......YIA..N..YE........IGDGTYIENVNLI.....L.........T.E........G..E..........SSFGNGIK......................IPVMIEA.GG.REIPVFDQL................S.APLAYMM..............A..F.Y..R.H..DKE..A.VNNLEHQI.SD.YA.N........SQK.S..D.KG..R..IGKNVRIMNSDVIR.N..VRIDDFATIEGTLRLENGTI.SS...NKQ...A..P...VYIGQGVQCKNFIICSGTNITESALISNCFVGQACIIDKQFSAIDSVFFANCQGLHGEAVSIFAGPYTVTHHKSTLMLTALY....SFMNAGS....GTNF.SNHMYKLGPVHQGITERGVKTSSGSYIMWP.........A..KI..G..AFTVVL.GRHK.GNPDISELPFSYL.......L..E..........N.......E..G..E.......S..N........LL.PAI.........................NL..H..S..A.G.........T...K.RDVQKWQKRDI.RT.D...E..I..K..LDPINFDFLSPYTLSKALKGINILN.....G..LL.EN.M..E..AG........ASF.....................................................................VWYQ.NCK.I........KR....S....S...IK.......KG.....IELY...E..MAINQFIG.DKII..E.K.......LSQL....E.I...F.S...K....DN.LHKLL....S.T..KTDT.G..I.G.EWSDMAGLIAPKSEI.NRLLKDISDKKL-.S.LDEIQNRINELHAN...YAAYSFVWVKSI.LEKQ..VG.......KP......I..H.E...-.-KEVIISSIEN.W.KKAVQT....FEDMILRDAKKEFN.SIS...KTGFGL...DGDDSD.KQLDFENVR.GN.F..EENAFVIETTNRLKTDIELANKILAKL......................................................................
A0A374W9W8_9BACE/4-658               ..............................................................................................................................................YRSLTEDEIFKLKS.Q.SCLA..DD..WSN.V...L...V.........D...V.........E...F.T.....T.........E.........YVYHTRFSGN...VRL..GVFNG.EF..VL...PGG..I..KK.HAGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YT........IGNDAFIENVDVI.....L.........V.D........G..V..........SKFGNGVE......................ASVLNET.GG.REVLINDKL................S.AHLAYIL..............A..L.Y..R.H..RPE..L.INRLKEIT.DF.YS.N........KHA.S..D.VG..T..IGSHVRIINTGSIK.N..VRIGDFTHIEGTCRLLNGSI.NS...NKK...A..S...VHVGYGVICEDFIISSGSHVDDGSMLARCFVGQACQLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......K..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...E..N..Q..LDYINYNLLSPYTVQKMFKGRDMLM.....A..LR.QA.S..G..EL........SDT.....................................................................YSYQ.SAK.I........KN....S....S...LK.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....D.F...R.N...D....DE.IRSRL....R.P..DTEV.G..A.G.EWVDISGLIAPKSEV.DRLITAIESGEVN.R.LKDINACFAEMHSK...YYTYEWTWAYQK.IEEF..YG.......VK......P..E.E...M.TAQDVIDIVLM.W.KDAVIG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSRRE.KKQDFEQVR.GD.F..ESNPFVTAVLKHIETKSALGDELINRM......................................................................
A0A2P8CEI1_9BACT/5-659               .............................................................................................................................................n-RKLTSDEIEKLEQ.R.HCTA..ED..WNQ.I...T...V.........P...H.........D...F.D.....I.........R.........NLRNVHFYGT...NVL..GRFDK.KI..KF...FNG..I..EK.PTGIYDASLH.NCTI...GD.N.....VLIRG..........V.....QH.......LIA..N..YD........IEEDVVIKNTDQV.....V.........V.T........E..S..........STFGNGTM......................VAVLDES.GG.RSIPIYDHL................S.AHLAYMM..............T..L.Y..R.H..RRD..L.QEKLFAWV.EQ.YA.E........SRR.A..E.RG..F..IGKGTRILNCHSII.N..VYFGPYTLAEGVHRLENATL.NS...KME...S..P...VVLGAGVIGRNFIVSSGSEISDGAIVENCFIGQGCQLSKQYSAENSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHMYKLGPIHHGIVQRGSKTASDSYLLWP.........A..KI..G..PFTLVM.GRHY.KNSDTSDLPFSYM.......I..E..........N.......K..D..E.......S..Y........LM.PGI.........................NL..R..S..V.G.........T...I.RDAIKWPRRDR.RT.D...P..D..M..LDFINFNLLSPFTIQKMLRGQQVLE.....D..LQ.NI.S..G..KT........SQT.....................................................................YSYS.STI.I........KN....S....S...LQ.......KG.....WQLY...N..MGITKFLG.NSVI..T.R.......LKDS....G.I...K.T...E....EE.MRQRL....T.P..GTEI.G..E.G.EWIDLGGLIAPKKEV.SSLMNKIEAGEIT.E.LTEAREWFARLHSN...YYEYEWTWASHL.LEKR..LG.......KS......I..S.E...M.TISDIKGMVER.W.KESVVS....LDRMLYDDARKEFT.LKS...QTGFGS...DGNEET.RSQDFEVVR.GT.F..ENNQFVREILDHIERKSRLADIMLEQL......................................................................
A0A1M4WA10_9BACE/4-658               ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGN.V...L...V.........A...E.........G...F.N.....S.........E.........CVHHTRFSGE...VKL..GVFDA.EF..TL...PGG..I..KK.HSGLRHVTLH.NVVV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNDTFIENVDII.....L.........V.D........G..L..........STFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIM..............A..L.Y..R.H..RPE..L.INRMKSIT.DY.YS.N........KHA.A..T.VG..S..IGDHVMILNTGSIK.N..VRIGDYSHICGTCRLTNGSI.NS...NVT...A..P...VRIGHGVICDDFIISSGSHVDDGSMLTRCFVGQSCKLGHNYSASESLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDYINYNLLSPYTIQKMLKGRSILK.....D..LR.RV.S..G..ET........SET.....................................................................YSFQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....QE.IRQRL....K.P..DTEI.G..K.G.EWVDISGLIAPKSEI.DRLLDGIESGSIN.R.LKSINACFSEMHEN...YYTYEWSWAYDK.IQEF..YG.......LN......P..E.T...I.TAQDVIRIVKS.W.KEAVVG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSHDE.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEDKTALGDELIKRI......................................................................
A0A095ZH30_9BACT/3-616               ..............................................................................................................................................YRKLTDEEIITLED.R.SCWA..ED..WNN.I...N...V.........S...D.........D...F.K.....P.........K.........YMHRVMLYGE...VNI..GAFEK.NV..EV...SKG..F..WK.HSGINNATLR.NVTI...GD.D.....CLIEN..........I.....GN.......YIN..N..YD........IGDDCHISNISTI.....E.........T.T........E..G..........ATYGEGNL......................VSVLNEV.GD.GNVILFREL................N.SQFAAFM..............V..K.H..F.G..DRE..L.KDAIRRII.RE.EI.E........MTT.P..D.RG..T..IGNRVKIVNTKEIT.N..TVVGDDCEINGAARLSDTTI.MS...SPN...A..T...VYIGTGVICENSIISDGSSIINSVKMQDCFVGEACHISNGFTASASVFFANSYMSNGETCAAFCGPFTASHHKSSLLIGSMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGTKTASGAYVLMP.........A..TI..G..TFSVCF.GKLM.HHPDTRNLPFSYL.......T..A..........Y.......G..D..T.......M..C........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIQKWPKRDL.RP.K...G..S..Q..KSIVNFDWLSPFSVGEIEKGKKILE.....A..LR.DA.S..G..ED........VSK.....................................................................YNFH.EYV.I........NG....S....S...LK.......KG.....IKYY...D..IALRIYMG.A-VL..K.R.......VRKR....D.P...D.L...N....--.-----....P.P..ATPT.G..T.G.DWNDLSGLLLPDSEE.RRIIKDIKNGTLD.T.VEKIINRFIEINEH...YREYQWTWTYRL.ILDY..YG.......LT......-..-.E...L.TEEAAEKIKQD.Y.VDARRA....WVAEIRKDAEKEFK.MG-...------...------.---------.--.-..---------------------------dveqevldnfinsldhekdye.................................................
D8LVS2_BLAHO/7-209                   ...................................................................................................................................alsvrtrsnpl--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...---------------------------------------------TLLAPNTGVSSGECNSSLVGPFIGFHHNSVL-ISALWf..yGKGNIGY....GANIgSNHTGRL-PDQEIIPGEGVFFGLGCNIKYP.........C..NLqnS..PYSIVA.SGVT.MLPQRMDLPFSLInr...psT..H..........R.......E..G..Vsp...elN..E........VF.PGWil.....................ygNY..Y..M..I.-.........-...V.RNEDKFANRNK.SK.R...-..-..-..-NLFEMSIMRPDIIAMVVKARNALA.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------fvphskrlidlstms.......................................................
A0A2S2DX75_9BACT/41-716              ..............................................................................................................................................YRLLSAREIEILEA.N.FNEA..EN..WKD.I...Q...V.........K...P.........G...F.N.....P.........H.........LIKNCRFFGI...IRI..GILEH.VY..LE...FKN..L..RM.PVGIYNSTII.SSDI...GD.N.....VSIDR..........V.....-N.......LLS..N..YQ........IGNEVMILQVNEL.....A.........T.T........P..T..........AKFGNGIVkegee...........eririwLELGNEN.GG.RKVIPFVGM................R.PADAYLW..............T..Q.D..R.D..DDL..L.QAQYKALT.QA.EF.S........TKR.G..Y.YG..Q..IGDRTVIKNTGIIK.D..VNMGSDTYIKGANKLKNLTI.IS...YPE...A..N...TQIGEGCELVNGIIHEGCRIFYGVKAVRFILAAHSQLKYGARLINSFLGSNSTISCCEVLNALIFPAHEQHHNNSFLCAAIIk.gqSNMAAGAt..lGSNH.NSR----GADGELQAGRG---------FWPglsislkhnS..KF..A..SFNLISkGNYP.AEIQNP-LPFSLIg.....nD..E..........A.......S..G..G.......L..L........II.AAYwf.....................qyNL..Y..A..L.A.........-...-.RNAWKFANRDQ.RI.N...K..N..M..--LLEYDFLAPDTIEEILNALTLLE.....T.wVG.DS.L..P..EK........TQEagkkwlenpa.................................................nenvsldvwaTGIE.N-S.K........RK....S....K...IA.......KS.....YRAY...H..IFKDLIHY.HAFQ..E.W.......LGAH....E.R...N.P...N....LS.TLDIL....K.N..ASKQ.R..I.S.HWENLGGQLVPSEAV.EGLKTNIRTSQIT.S.WNQVHQFYQEQAEL...YPDLKFQNALAA.LKII..QT.......SD......L..G.D...P.T------FMQQ.W.KNKAIEvsafIAKGIERSRAKDFQ.DPF...R-----...-QAMFH.NQKEMENVI.GD.W..KENDFILQAQKTHEA------------fvqkiins..............................................................
A0A024U2H3_9STRA/37-517              ...........................................................................................................................................spv----TPAQIQVLEQ.Q.GNRA..DS..WDS.V...Y...T.........K...G........sA...A.S.....L.........K.........RVRNCTFRGR...VYL..GDFEK.DV..MV...-DN..V..PF.PSGCYNSTVV.DSYV...LD.N.....ALVQDtfllhrsassV.....SGqlhltstCLSvvG..TY........VSQGAVIVGCGTI.....T.........C.S........G.pE..........VTYGNGTV......................LKVGVEI.GG.REIAMFADM................P.FHLAAIV..............G..E.S..R.G..NAA..E.LKAYEDLV.RT.YA.K........SVR.C..DgFN..V..IARQAKVLRCPKIR.D..VFVGDGGVVEDS-VVSNSTI.LS...TPA...E..F...SSIVGFSQVHSSILQWNAHVDGGSSVERSFLFDCSHVERHGMVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..rGRGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALV......nI..P..........G.......H..N..I.......P..E........LS.PAInei..................ypgwVL.sH..S..IfT.........V...L.RNQDKFDKRNK.SK.R...-..T..K..L---DAPIFRPDIVTMMQVACQRLV.....D..A-.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ekkpvkirhgreiiytekqvp.................................................
A0A6H5K4J9_9PHAE/45-298              ..............................................................................................................................................-RGLTSEEVRKLQV.H.GNWA..TN..WSL.V...R...V.........S...EgsgpsetksS...I.A.....A.........G.........RVRGCVFHGP...VLL..GDFSG.EI..ILp.vAEQ..Y..SQ.PCGVYNSTLS.WVVV...GD.G.....ALVKG..........C.....-H.......AMT..R..CV........VGPGAAVINCGLV.....S.........C.S........Q..Q..........PSDSSGSSgssgssssssdggfcsfangiaVTVGPET.RG.RELACYVTM................P.LAAAAAA..............A..A.D..R.S..SPE..A.VNEHRLAV.DA.YA.E........LAR.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------hgearermytsllrsiglasvikphaaavtataiplvsrkpcviglncciddy.................
A0A060REM3_9BACT/3-657               ..............................................................................................................................................YRKLTIEEIRQLEQ.Q.SCLS..DD..WGK.V...L...V.........K...E.........S...F.A.....V.........N.........HIFHTRFSGE...IRL..GVFEK.VF..EL...EGG..L..RK.HSGLRHVTLH.NCSV...GD.N.....TLIEN..........V.....PN.......HIS..N..YN........IGEDCFIQNVNLI.....V.........V.D........G..E..........TCFGNGVQ......................VSVLNET.GG.REVPIFNKL................S.AHLAYLI..............A..L.Y..R.H..RPL..L.IEKLQMLI.EK.YS.R........KHS.S..F.TG..S..IGRNVKIINTGTIR.N..LIIGDGAIIDGASRLENGTL.SS...NMQ...A..P...IHIGHNVIASDFIVCSGAHITDGAVLVRTFVGQACHLGHLFSAHDSLFFANCQGENGEACAIFAGAYTVSMHKSSLLIACMF....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RI..G..AFSLVM.GRHV.NHPDTSELPFSYL.......I..E..........N.......K..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDSQKWPKRDK.RT.D...D..E..K..LDFINFNLLSPYTVSRMMRGVELLK.....N..LQ.DL.S..G..ET........SAE.....................................................................YAYQ.STH.I........RN....S....A...LK.......KG.....IQYY...N..KAIDKFFG.NSLI..S.H.......LQKA....D.N...Y.S...I....GA.IRAHL....T.T..QCGK.G..E.G.EWLDISGLIVPKSEI.SHLISRIENDGFE.D.ITDIHKQFEELHNH...YYEMEWQWAASA.MQGW..YG.......VD......F..S.K...V.TKEELVNIIKR.W.MDAVVS....LDRLLYEDAHKEFS.MVS...QVGFGV...DGAHHR.RVCDFEQVR.GS.F..EQNQFVVSVLKHIETKSNLGKEMINKL......................................................................
A0A2N8N867_9BACT/3-414               ..............................................................................................................................................YRKLTQGEIDTLVA.G.GCEA..ED..WQC.V...E...V.........A...S........vG...F.D.....A.........K.........QVRRVRFSGQ...VCL..GST--.--..--...---..-..--.-VDLRDAAIH.DCAV...GD.A.....VHIAG..........I.....RT.......TLS..G..YE........IGRGARLVDIGSM.....T.........Y.R........A..G..........ATAGNGVR......................VAVANEN.GG.RTIPLFDGL................T.AQTAHVM..............V..F.H..R.H..RTE..A.LSRAFGSI.EA.YA.A........QIA.A..EpRG..R..VGEGAVVEGCGRIA.D..VHIGDGATVCGAALLQGGTI.LS...RPD...A..P...TKVGVGVMARDFILAPGAHVVDGSFVERCFVGEGCVVEQGFTAIDCLLFANGMFAKGEAISVFAAPHTASHHKSSLSIACGL....SFANIGS....GSNM.SNHAYKLGAVHQSVAERGCKFGSNSYVQAP.........A..HF..G..AYSMIT.GEHR.NHPDTHALPFSYL.......M..E..........E.......G..G..Q.......S..M........LI.PAV.........................NL..F..R..T.G.........T...L.RDARKWPQRDR.RS.A...D..R..P..RDLICYDFLNPYLIERI--------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------l.....................................................................
A0A3P5VJM4_9SPIR/25-691              ..............................................................................................................................................WRPLTEPELSTLKV.N.HNYS..DN..WSN.L...E...V.........A...E.........G...F.N.....P.........S.........LVSNCKFYGR...VRI..GKLTD.EV..IV...YHS..L..IL.PVGLYSSTIV.SCII...GD.N.....VALHN..........L.....-D.......YIS..N..FI........VEDCCIIFNVNEM.....I.........T.T........E..N..........AKFGNGIVmegec...........edhriwLEVANEN.GG.RKILPFVGL................V.PADAWLW..............S..K.Y..R.S..DSK..L.MERMIEMT.AK.VY.K........PQP.G..N.YG..R..IGRKSVIKNSRTLK.D..VMIGSHAYIKGANKLKNLTI.NS...NAA...W..P...SQIGEGCELLNGIIGYNCRIFYGVKALRFVLCNNSELKYGTRLINTVLGPNSTISCCEVLNSLIFGSHEQHHNSSFLCASLLk.gqTNIASAAt..vGSNH.NSR----APDGEIVADRG---------FWPglavslkhnS..RF..A..AFILIAkGSYP.AELDIP-LPFTLV.......S..N..........S.......H..D..S.......KtlL........LS.PGYwf.....................hhNL..Y..A..L.A.........-...-.RNSAKAKAREK.CG.E...E..-..-..--LLEYDWLAPDTVDQMRSGLKIME.....A..WA.EE.T..P..EV........KNGtytsgaaf....................................................lasnpsptlFATD.SYR.I........EA....S....R...RP.......VR.....ILHA...G..RAWNDFH-.-RMI..R.F.......YVIR....T.L...-.L...G....ST.-LQHV....P.T..ASTA.S..P.D.SWVNLGGQLITRPKL.SKMISLIKNGELS.D.WPSLHQHYHSLGQN...YDADKQSHALAL.LQEI..FG.......SP......E..TpK...L.SAITP-ALITE.A.LQTAAF....ILEGIKKSRLKDYQ.KHF...R---NI...NF---D.SPDERDAVL.GL.Y..HKDAFIQQATHTLD-------------alrqtlk...............................................................
G0J7R8_CYCMS/42-735                  ..............................................................................................................................................FRNLNANEIEQLVR.N.QNQA..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...IRI..GKLEP.FF..LE...YHN..L..RM.PVGLYNSHII.SCDI...GD.N.....VIIDN..........V.....-S.......YLS..H..YI........IGNEAILVNINEM.....S.........T.T........S..H..........AKFGNGIVkegek...........eevriwLELCNEN.GG.RKVAPFSGM................L.PGDAWLW..............S..R.N..R.T..DTL..F.QSRLLEFT.QN.EF.D........VKR.G..Y.YG..K..VGDRCIIKNTLIIK.D..VWFGSDAYIKGANKLKNLSI.HS...TPD...A..S...TQIGEGCELVNGIVSEGCTVFYGVKAVRFLMAAQTQLKYGARLINSYLGSNATISCCEVLNSLIFPSHEQHHNNSFLCAALVq.gqSNMAAGAt..vGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RL..A..TFTIVAkGDYP.AELDIP-IPFSLL.......S..Nd........vT.......N..N..E.......L..V........VM.PAYwf.....................qyNL..Y..A..L.S.........-...-.RNAWKYEARDK.RI.E...K..F..Q..--RLEFDFLAPDSMMEVLKSLAILE.....E..IC.GK.A..Y..YQ........KFPtedkvsiqsikekgkel...................................ldsddpilqeltyfasgWENS.KRK.I........RV....I....K...LT.......DA.....YLRF...K..QVINYYPV.YCLT..K.Y.......YAET....D.L...R.D...-....GG.LIKNL....T.S..DLSQ.-..P.E.VWVNLGGQLVPKSSM.DQMITDIKNKKIN.S.WKELHLCYKNLGNE...YEQEKTKHAFAI.FFAS..EV.......IP......T..S.E...F.TSAHLIQMLTK.A.KTFRQW....MSDSIYISRKKDYD.NPF...R-----...--NMVYaDEKERDQVL.GS.L..EDNSFIQSEKIESKKFMEQIDQFL---ial...................................................................
Q8A5I2_BACTN/4-658                   ..............................................................................................................................................YRKLTEDEVLQLKS.Q.SCLA..DD..WGN.V...L...V.........A...E.........G...F.N.....C.........E.........YVHHTRFSGE...VKL..GVFDA.EF..TL...PGG..I..RK.HSGLRHVTLH.NVVV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGNDTFIENVDII.....L.........V.D........G..L..........STFGNGVE......................ATVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKAIA.DY.YS.N........KHA.S..A.VG..S..IGDHVMILNTGSIK.N..VRIGDYCHICGTCRLTNGSV.NS...NVT...A..P...VHIGHGVICDDFIISSGSEVDDGTMLTRCFVGQSCKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LR.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..T.G.EWVDMSGLIAPKSEI.DRLLDGIENGSVN.R.LKSINASFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......LN......P..D.E...I.TAQDIIRIVKA.W.KEAVVG....LDKMVYDDARKEFS.LSS...MTGFGA...DGSHDE.MKQDFEQVR.GD.F..ESNTFVTAVLKHIEDKTALGNELIKRI......................................................................
R6WUC7_9BACT/54-577                  ...........................................................................................................................................arv--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........I.....RS.......RVS..N..YR........IGEGSLVEGVTAL.....E.........C.R........S..R..........SSFGNGVP......................VATMNEC.GG.RTVKIFDTM................S.AQIAYLM..............A..V.Y..R.H..RPQ..A.IAALERMI.DA.HA.G........NRT.S..E.MG..E..VGRNCRIVGARFIR.E..VRIGDNVTVDGASMLCNGTL.C-...---...D..G...VRIGVDVKAYDFIAAEGARIDNGATVERCFVGENCRLDKGFSAAESLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGAVHQAVHPRGCKFASGAYVMSP.........A..LE..G..AFTMVM.GHHT.HHHDTSAFPFSYL.......I..E..........K.......Q..E..R.......S..F........LM.PGA.........................NL..T..S..Y.G.........T...V.RDLEKWPARNG.RT.V...R..R..-..-DAINFEACNPYLTGAMLQAVDALH.....G..LE.EQ.D..-..PD........AAE.....................................................................YPCN.KTV.I........RA....A....A...LR.......RG.....LKLY...N..KAIVAALG.QMLD..R.G.......----....-.-...-.-...-....--.----E....S.S..ERYN.G..S.G.RWLDIAGQYVTKREV.EALLDALEEGRMT.T.PAEVDNRFRVFFVH...YGDYAHSWAEQT.CAAL..LG.......HT......P..S.V...-.--GELNDFIAA.G.RNAADT....LRRMTDADRERDCA.PEL...SVSYGL...DGDDND.RMADYRAVR.GL.-..---------------------------nep...................................................................
F8EZM5_TRECH/46-753                  ..............................................................................................................................................WRKLRADEIAILVK.N.NNFC..AN..WDD.F...L...V.........S...D.........P...F.N.....P.........H.........LIRSSQFYGL...VRL..GAVRE.NL..LQ...YHD..Y..KI.PAGIRDSTII.SCDI...GD.D.....CAIQN..........C.....-P.......YIS..H..YI........IGNQVIISRVDEI.....Q.........V.S........N..H..........AKFGNGILtpges...........edvriwIDVMNEA.GG.RSILPFEDM................I.PADAYLW..............A..T.Y..R.D..DAE..L.VTKLKDIT.QN.QY.G........AGR.G..R.YG..T..IGSWSVIKGCGIIK.D..VAIGSCAYIKGANKLKNLTI.LS...SAD...E..P...TQIGEGVELVNGIIGYGCHIFYGCKAVRFVMGRNSNLKYGARLIHSVLGDNSTVSCCEMLNNLIFPAHEQHHNNSFLIASLVq.gqSNIAAGAt..iGSNH.NSR----ANDGEIRAGRGFWPGLSVTLKHP.........S..RF..A..SYVLIAkGDYP.YELDIP-LPFSLV.......N..Hd........vA.......R..D..R.......L..E........VM.PAYfw.....................myNM..Y..A..L.E.........-...-.RNAWKAANRDK.RV.V...K..I..Q..--QIETDYLAPDTAEEILYAMDLLE.....L..WT.GR.A..A..ILa......gGENpdtytegalrqfgrn......................................llaaaenrmgglevytEGLE.RHK.R........PA....L....V...LKp.....rKA.....WRAY...N..RMLRYYAL.KALL..A.Y.......AESR....P.D...T.R...I....GE.LLAELnegyQ.K..NGAQ.R..E.H.EWVNLGGQIVPSSRL.DALRQDIRQGLLT.S.WDEIHARYEAMAAS...YRRDAAIHAWAV.LLEI..PP.......LDgsapftS..E.S..lM.QGGDLQKLLQE.G.RETRRW....IEAEVYKSRAKDWR.DPF...K-----...--KMTFrNEAEMEAVL.GR.V..EDNPFINMARKETQAFEQRLDALETR-l.....................................................................
A0A1Y4HLV2_9BACT/3-657               ..............................................................................................................................................YRKLTNREITSLQA.Q.SCLA..DD..WER.I...S...V.........A...E.........G...F.T.....T.........E.........YVHHTRFSGE...VRL..GVFES.DF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GN.N.....CCIEN..........I.....QN.......YIA..N..YD........IGDSTFIENVDRI.....L.........T.E........G..V..........SRFGNGVE......................VSVLNET.GG.REVPISDKL................S.AHIAYIM..............A..L.Y..R.H..RPS..L.TARLKEIT.DF.YA.S........KHA.S..D.RG..C..IGSQVTILNTGSIK.N..VRIGDCCRISGAGRLYNGSI.NS...RTE...A..P...VHIGHGVICEDFIISSGSHVDDGAMLTRCFVGQACRLGHSYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGILERGSKTSSDSYILWP.........A..KV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..Y........LA.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDG.RT.D...P..D..K..LDFINYNLLSPYTVQKMFKGREILL.....N..LR.QA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IQLY...E..TAIHKFLG.NSII..K.R.......LEEM....Q.F...R.N...N....EE.IRARL....R.P..DTAT.G..S.G.EWVDVAGLIAPKSEI.ERLIDNIETGSVN.R.LKDINAEFEQMHLN...YYTYEWTWAYGK.IEEF..YG.......IC......P..E.E...M.TATDIIRIVEK.W.KEAVVG....LDNMLYEDARKEFS.LAS...MTGFGA...DGSRQE.KKQDFEQVR.GD.F..ESNPFVTAVLKHIEVKTALGDELIGRM......................................................................
A0A1G7KU69_9BACT/1-560               .............................................................................................................................................m-RNLTEAEIAALEH.N.GCVA..DD..WSN.V...K...V.........S...H.........S...F.D.....Av.......eN.........RIRNVEFFGC...VNL..GCFDS.DV..EA...DGG..A..VR.KSGIFNACLE.NVTV...GD.N.....AYIRN..........V.....--.......---..-..--........----------GII.....R.........S.Q........K..S..........ARTAWGRK......................IAVLCES.GD.DNVVLHPCL................S.AQEAAIM..............-..-.V..G.H..SDE..M.QDYMAG-I.EE.DG.S........HSL.D..D.FA..R..IGNNTVIINVKTIE.N..SNIGDETKIVNATRIEGCEI.SG...G--...-..-...AEIGDNVICRNSIVCRSASVQSGATVDSCFVGEAVEISSYFSATNSLFFANSIMSNGEACAAFCGPFSVSHHRSSLLIGGMY....SFYNAGS....GTNY.SNHAYKSGAVHYGFMRRGAKTASGAHILLP.........A..EI..P..PFTMVM.GKVT.NHPQLADFAFSYL.......I..A..........D.......A..D..R.......L..W........LV.PGI.........................NS..A..T..L.G.........T...Y.RDVNKWKKRDG.RI.G...N..K..G..IDHIEYDFLHPYILQKVMRASAKLK.....E..WE.SA.C..T..G-........-DV.....................................................................YAIDgKTN.I........RR....S....A...IL.......KG.....IKYY...D..CVLKM--G.FGLY..Q.N.......IDGL....K.D...-.-...A....C-.---AL....-.-..---A.D..S.V.EWADVQGLFLPAECV.EAIAKTAK-----.N.PQEMKNLVNQAKDE...SKAVADSWMASA.MARF..YN.......VA......-..-.K...V.DGKTIETAKHD.A.LEARSK....WIELIKEDAKKE--.---...------...------.---------.--.-..---------------------------aalgd.................................................................
A0A108TAK1_BACSE/3-657               ..............................................................................................................................................YRNLTEDEVLRLKS.Q.SCLA..DD..WGK.V...T...V.........A...E.........E...F.S.....T.........E.........FVHHTRFSGE...VRL..GVFHS.EF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..L..........SRFGNSVE......................VSVLNET.GG.REVLISDKL................S.AHQAYIM..............A..L.Y..R.H..RPE..L.IARMKEIT.DF.YS.N........KHA.S..A.TG..S..IGSHVMILNTGSIK.N..VRIGDYCHICGTCRLYNGSV.NS...NEN...A..P...VHIGHGVICDNFIISSGSHVDDGAMLTRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPRRDQ.RT.D...T..N..K..LDFINYNLLSPYTVQKMFKGRETLK.....N..LR.YA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IRFY...E..IAIHKFLG.NSVI..K.R.......LEGI....G.F...H.T...N....EE.IRARL....K.P..DTPI.G..S.G.EWVDISGLIAPKSEI.DALIDGIESGAIN.R.LKHINAEFERMHRN...YYTYEWTWAYEK.LEEF..YG.......IA......P..E.N...M.TAEDIIHIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRLE.KELDFEQVR.GD.F..ENNPFVTAVLKHIEVKTALGDELIGRM......................................................................
A0A1M4VIQ2_9BACT/10-664              ..............................................................................................................................................YRPLRDDEIGQLIY.Q.GCSS..PD..WNL.V...K...V.........S...P.........E...F.S.....P.........D.........HINDAKFTGH...VRL..NSFNK.SV..CL...IGG..I..TC.HTGISSAWLH.NCTV...GK.D.....ALIHN..........V.....RN.......YIA..N..YE........IGDGVIIHNVTTI.....A.........V.D........G..E..........TAFGNGVL......................VEAINEG.GG.RAIPIYDYL................S.THVAYIL..............A..L.Y..R.H..RPA..L.ISGIKSMV.AT.YT.A........SIL.S..G.TG..T..IGANSKILNCNTVL.N..VKVGPAALIDGAKKLRNGSI.NS...THE...A..P...VVIGEGVIMDDFIVCSGSRITDATLVSKCFVGQGCVLDKHYSAVNSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHLYKLGPIHQGIMERGAKTTSDSYLLWP.........S..RI..G..AFSLVM.GRHY.KHCDTADFPFSYL.......V..E..........S.......K..D..E.......S..I........LV.PGI.........................NL..K..S..I.G.........T...V.RDSQKWPRRDT.RK.D...S..N..L..LDLINFNLLSPYTVQKMLNGRQKLI.....D..IR.KS.S..G..EY........ASA.....................................................................YSFN.KMK.I........EK....R....A...LD.......RG.....ILIY...E..MAIWKFLG.NSLI..T.R.......LQGK....N.F...G.S...D....AE.IRETL....Q.P..DTSA.G..K.G.YWVDLSGLICPFEAL.DKLLKSIETGEIS.T.LEEVNAALLMLHNN...YYNYEWTWAADV.LGRF..YG.......KT......I..A.R...F.SAADVIAVVEK.W.KESVLE....IDRLLYEDAKKEFS.LTK...MTGFGV...DGQNGD.RELDFAEVT.GE.F..EKNETVKAIQIHMQAKEKLGNELIARM......................................................................
A0A0B8T2I2_9SPHI/41-727              ..............................................................................................................................................FRPLSEEEIKVLVR.N.DNFA..SN..WKD.V...W...V.........T...D.........Q...F.L.....P.........E.........QIQNSKFYGM...VRI..GDMDD.VY..LD...FRD..L..RL.PCGIYNSTII.SCDF...GS.T.....VAVHN..........V.....-R.......YMS..H..FI........VGNDVMLANISEM.....E.........T.S........S..S..........AKFGNGILkrgdv...........eerrirLELCNEN.GG.RSVLPFDGM................Q.AGDVFLW..............S..R.Y..R.E..DTT..L.QRRFQELA.EA.QF.S........VEH.G..Y.YS..E..IGNHSIIKNTHTIK.D..VKIGAHAYIKGVNKLKNLTI.NS...SSE...S..Y...TQIGEGCELVNGIIGYGCRIFYGVKAVRFILSSNSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAAVVk.gqSNMAAGAt..vGSNH.NSR----AADGEIVAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELDIK-FPFCLV.......S..N..........Ev.....dT..N..R.......L..V........IL.PGYwf.....................lyNM..Y..A..L.M.........-...-.RNTSKFAARDK.RK.F...K..N..Q..--YIEYDVLAPDTINEMFVALGEIE.....T.aVG.KT.F..A..KE........GASederagfgrtlln..........................................andslagksvlldnVEFS.KRK.V........VL....A....K...PR.......ES.....YHVY...K..RMIRYYAS.LEII..G.A.......LEAS....-.-...E.S...M....DS.FWTRI....R.G..I-SQ.N..R.K.AFENIGGQLIPAAKL.KQLLDNVREGALS.S.WNDVHEHYHAWSRD...YLEDRFEHAVSS.LAEI..QE.......KE......V..A.A...W.DHLFLRNLLTD.A.LDTKTW....ICSEIENARSKDYQ.NPF...K-----...--QMIYnSYEEMEEVV.GK.L..ADNDFINKEKSALAKFEATIERLINKL......................................................................
A0A264Y7R5_9BACT/3-614               ..............................................................................................................................................YRNLTDPEITALQT.N.GCWA..ED..WMR.I...E...V.........S...E.........D...F.M.....P.........D.........FFHRVMFYGD...IRL..GTFTN.NV..EV...SRG..F..MK.HSGINNATLR.NVTI...GN.N.....CLIEN..........I.....SG.......FIN..N..YV........IGDDCIITNVCTM.....E.........T.T........D..G..........ATYGEGNL......................ISVLNEV.GD.GNLILFRGL................T.SQVAALM..............V..K.H..F.Q..NRP..L.KDAIRRLV.RE.EI.E........RTS.P..E.TA..T..IGNRVKIVNTKEIT.N..TVIYDDCEIAGAARLSDCTL.MS...NRD...A..S...VYIGTGVICENSIISDGSSIINSVKMQDCYVGEACQLSNGFTAASSVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGTLERGSKTASGAYILMP.........A..HI..G..AFSVCF.GKLM.YHPDTRSLPFSYL.......I..A..........Y.......N..D..V.......M..Y........LV.PGR.........................NL..T..T..V.G.........L...Y.RDIRKWPKRDK.RL.A...G..A..R..KSVVNFDWLSPFTVGEILRGKKILE.....D..LR.EA.S..G..ED........VST.....................................................................YNYH.EYV.I........KN....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.-.......----....-.-...-.-...-....--.-HAPV....E.P..TTTV.G..T.G.PWTDISGLLLPVSEE.QRIIDDIISGEIE.T.THDLIERFEEINAN...YSEYRWAWSYCM.ILDY..YG.......FT......-..-.S...L.TEENVERVKSD.Y.ITARRA....WIAEIKKDAAKEYR.LG-...------...------.---------.--.-..---------------------------dveeevfrnfndqldkevdfenqk..............................................
A0A1G4G9S0_9BACT/4-658               .............................................................................................................................................e-RSLTDQEIDLLKS.Q.NCEC..DD..WTL.V...T...V.........A...P.........G...F.N.....P.........H.........FVKNTRFSGK...IRI..GLLDE.EF..EL...AGG..L..RK.HACINNAVIH.NCEI...GN.N.....VVIEN..........I.....QN.......YIA..N..YV........IGDNCFIQNVDVI.....L.........V.D........G..M..........TTFGNGTE......................VNVLNES.GG.REVHIHDKL................S.AHFAYVY..............S..L.Y..R.H..RPN..L.IRRMRAMV.DF.YA.R........KHA.S..E.MG..Y..IGDHAMIVNVGYIK.N..VKIGSYSKITGAMKLKNGSI.NS...NGQ...A..P...VYVGRNVIAEDFIISSGSRVEGGSIISRCFIGQACHLDHGYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIIERGAKTTSNSYVLWP.........A..KV..G..PFSLIL.GRHY.QHSDTSNLPFSYL.......V..E..........N.......N..N..A.......T..H........LA.PAI.........................NL..R..S..V.G.........T...I.RDAKKWPERDK.RR.D...P..N..K..LDYINFNLLSPYTIQKVFAGVEILK.....N..LQ.AT.A..G..ET........SEI.....................................................................YTYQ.SCI.I........KN....A....A...LR.......RG.....LELY...E..IVIHKFLG.NSII..K.R.......LEKT....G.F...T.S...N....VE.IRERL....K.P..DTPI.G..T.G.EWVDISGLIAPKSEI.DKLLCRIENGEIT.R.LKEINKVFKELHEQ...YYTLEWTWAWEK.IQEF..YN.......VT......P..E.S...I.TAGEIIEIVEK.W.KAAVVK....LDEMIYNDAKKEFS.LSF...KTGFGS...DGDIQD.QAMDFEYVR.GA.F..DKNPFVVATLRHIEDKKALGNELIERI......................................................................
A0A1G6TT63_9BACT/41-733              ..............................................................................................................................................YRQLTRQETAILKS.N.GNRS..DN..WSQ.V...L...V.........R...E.........G...I.D.....I.........L.........LIEECTFFGL...VRI..GRLEP.YF..LE...FSQ..L..RT.PVGLYRSLIV.SCDI...GN.N.....VAINN..........V.....-R.......LLS..H..YI........IEDEAILINVNEM.....S.........C.T........S..H..........SKFGNGIVkdgep...........edlriwLEICNEN.AG.RKVIPFDGM................L.PGDAWLW..............S..K.Y..R.A..SEP..L.QDAFKAFT.DR.QF.G........TYR.G..T.YG..T..VGKRTVIKNTHIIK.D..VKIGSDAYIKGANKLKNLTI.NS...NEN...A..K...SQIGEGCEMVNGIMGAGSRAFYGVKAVRFILAPFSQLKYGARLINSYLGENATISCCEVLNTLLFPAHEQHHNNSFLCASLVm.gqSNIAAGAt..iGSNH.NSR----AADGELQAGRG---------FWPglcvslkhnS..KF..A..SFTMIAkGDYP.AELNIP-MPFCLV.......S..Nd........vH.......N..D..R.......L..L........VM.PGYwf.....................qyNM..Y..A..I.L.........-...-.RNERKFADRDK.RR.E...K..A..Q..--LLEYDFLAPDTVNEMFVALQLLC.....R..FT.GQ.A..F..YQ........KHAliggsreheqkgkell.....................................esnapvlkqleiqargFENS.GRP.V........HL....I....K...VQ.......EG.....YLLY...K..KMIAYYGT.RLLI..G.Y.......LQKN....S.D...K.S...I....RS.LALL-....-.F..AGAG.S..R.S.NWLNAGGQLIPEENI.NTLIRDIENGRLE.RgWQQVHAFYEQQALL...YPDQKLQHGLAA.LMET..GN.......FR......P..D.M...A.SLPLLRELLLN.A.IDTKQW....MAQSVYASKAKDYE.NPF...R-----...--KMVYdSTGEMEAVV.GK.L..KDNPFINEQLKEAEAFESNIQELIG--al....................................................................
A0A5J5ICS6_9BACT/42-703              ..............................................................................................................................................YRSLTTREKEILIR.S.DNSS..DD..WGK.I...L...V.........S...D.........A...F.D.....P.........V.........LVKNCKFFGL...VRI..GKLEP.YY..LE...FHN..L..RM.PVGIYNSTII.SCDF...GD.N.....VCIDN..........A.....-H.......YLS..H..YI........IGNEVMIANVNEL.....A.........A.T........D..Y..........SKFGNGILkeget...........eltrvwMEVRSET.GG.RRVIPFESM................L.PGDAYLW..............S..S.N..R.N..DKE..L.MERFIELT.QK.EF.D........KKR.G..Y.YG..T..IGDRCVLKDCNIIK.D..VCIGSDAYLKGANKLKNLTI.NS...DEE...R..T...SQIGEGCEIVNGIIGYGCKIFYGVKAVRFVMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPAHEQHHNNSFLCASLIm.gqSNIAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..KF..A..SFTILSkADFP.YELNIS-LPFCLV.......S..N..........Dv.....aN..D..K.......L..V........LM.PGYwf.....................myNM..Y..A..L.A.........-...-.RNSWKFADRDQ.RT.E...R..I..Q..--HIEHDYLAPDTINEMFDAIEMLL.....R..LK.AD.K..D..GN........YFA.....................................................................TGFE.NSD.R........KT....E....I...LKv.....pQV.....ISLF...K..ELITFYGI.TQIT..D.H.......ITRN....K.F...S.S...F....EE.LKKSI....Q.V..K--I.Q..R.A.KWINVGGQLICAADV.DKLKNDIKRNKVN.S.WTQVHNYYRQKGSD...YEKDKLIHAYTS.LLET..EN.......IT......S..K.Q...F.TKDVFIELLES.S.IATKTR....MGKDIYTSRAKDYT.NPF...R-----...--KMVYdSNDEMNAVI.GR.L..EDNQFIQDQLAETDRYKKMIKGIIKKM......................................................................
A0A1J1E9U7_9FLAO/41-732              ..............................................................................................................................................YRTLSKGEIESLIK.N.GNES..NN..WED.I...F...V.........S...E.........G...F.N.....A.........S.........MVKNCKFYGK...IRI..GILED.CH..LE...YST..L..KV.PVGLYDSMII.SCDI...GD.N.....VSISN..........V.....-Q.......YLS..H..YK........IANEVILSNLGNI.....H.........T.S........N..H..........SKFGNGILkegeq...........ehvriwLEICNES.KG.RAVLPFDGM................L.SADAYIW..............S..K.Y..R.D..RDV..L.MSKLKGLT.NN.RY.S........DKR.G..H.YG..T..IGNGVVIRNSHSIQ.D..TKIGDHAYIKGVNKIKNTTI.NS...SMI...A..P...SQIGEGVEMVNGIVGYGCRVFYGVKAVRFIMDDHSTLKYGARLINSYLGGNSTISCCEVLNSLIFNGHEQHHNNSFLCASLVm.gqSNIAAGVt..iGSNH.NSR----ANDGEIIANRG---------FWPalcvnlkhnS..KF..A..SFCLVSkGSYP.HELRID-FPFSLVa.....nD..E..........R.......E..N..S.......L..K........II.PAYwf.....................lyNF..Y..A..L.E.........-...-.RNCKKMYQRDK.RV.Q...K..R..Q..--NIEFDYLAPDTIDEIFSAIEKLE.....E..YI.DL.A..I..ER........SGIvccdssdkskikkeyl.....................................esskhenlyleilaedVENS.TRK.V........HI....L....K...VK.......ES.....YKIY...K..DLILLYSV.KTIC..K.Y.......FYTQ....-.V...E.D...F....GD.ILEFI....KsT..NLTH.Q..Y.D.KWKNIGGQLMKESDV.EDIISEIENGKLE.S.WEAIHDKYSLLGEG...YLKHKFEHAVIS.LLKL..LE.......IQ......M..SsD...L.NADIWNNSVKR.A.ISVQEY....LCDSVISSREKDYT.NPY...R-----...--KMVYdNTKEMNNTL.GE.L..NQNSVIISVKEETESIKQ---------mflnsm................................................................
A0A0A2F1T7_9PORP/8-663               ..............................................................................................................................................YQPLTPTQILDLER.N.GCRC..ND..WSR.V...L...V.........S...N.........G...F.E.....T.........N.........RCRDVHFSGD...VWL..SRLDS.QI..KL...AGG..V..CK.PAGIYHAHLH.NCSI...GP.N.....VLIER..........I.....HE.......YIS..G..YN........IGEGATIVNVDRL.....F.........V.S........G..K..........TSFGNGLG......................VEVLNET.GG.REVWISHNL................S.AQVAYLM..............A..F.Y..R.H..DTQ..L.IERLRQLS.QR.EA.E........AHT.S..D.RG..E..VGAHALVRCVRNIE.N..VNIGAYAHIEGASHLREGTI.IS...TRE...A..P...VHIGYNVSCINFIILSGSRILDGATISNCLLGQGSRLSHLFSAHDSLFFANCQGENGEACAVFAGPYTVSMHKSSLLIAGYY....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYILWP.........S..HI..G..PFTLVM.GRHV.DHVDSSDFPFSYL.......I..E..........D.......H..N..E.......T..F........LV.PGV.........................NL..R..S..V.G.........T...I.RDAKKWPERDR.RT.D...S..H..K..LDNINFNLLSPYTVGKMLKAHRQLS.....E..LS.QL.L..G..NT.......eDHK.....................................................................IAYR.NMR.I........RQ....R....A...LE.......RG.....IRLY...A..IAIVKFLG.NSVI..H.R.......LRNC....P.C...R.S...D....AE.VRAHL....L.P..QSER.G..L.G.RWIDLCGMLVPQREI.EQTIEAIKAGQIA.S.LDELNTTLSSLHQE...YYDLEWPWAYRE.MLEW..FG.......LE......A..D.K...I.TCEDIRRIVDE.W.ERSVVE....LDQMLYEDAKKEFA.MSI...KVGFGL...AAGADT.READFECVR.GG.F..DTNPFVLSVLEHIKTKQTLADSIRERL......................................................................
A0A1V9ZHC0_9STRA/32-544              ..............................................................................................................................................FRPISQTQIELLEK.A.GNRA..ES..WAT.V...Y...A.........R...N.........A...E.P.....L.........D.........RIRNCSFRGH...VYL..GTFTK.NV..VV...-EG..V..PF.PSGCLNSTLY.DVFI...TD.D.....ALVQD..........T.....-F.......LLQ..G..TY........VSSGASVVGCGTI.....T.........A.S........T..N..........PSYGNGTP......................LKVGVEI.GG.REIVAFADL................P.FNLAVDV..............G..K.H..R.A..DPA..E.LARYKCNV.DA.YT.V........AAQ.C..G.VN..V..FGPDAQVLRCPKLR.D..VYAGEGAVLQDS-VVEASTI.LS...SLQ...E..R...SRVMGLSHVMSSLLQWHTVVEGKSTVERSFLCEYSHVERHGIVMDSLLGPNTSIAEGEVTSSFLGPFVGFHH-QAMIIASFWp..eGKGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSVKFP.........S..NFtgA..PYSVLA.TGVN.TLPQKLEMPFALV......nL..P..........G.......H..N..I.......P..A........LS.PAVnei..................fpgwVL..G..S.sIfT.........V...L.RNMDKFEKRNR.AK.R...-..-..-..-TVVEHEIFRPDIVRMMEVALGRLV.....N..AK.ET.P..L..VL........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gkqkiytdkqvpglgknymtessrraaidaytfyirfyalngfwrvlrqgslpleavlaaptscsrws..
A0A399D1U7_9BACT/2-655               ..............................................................................................................................................YRCLSDKEIEILEL.R.GCSA..DT..WNT.V...E...V.........K...D.........T...F.L.....P.........E.........RLRNVRFSGK...IRL..GKNNG.KT..DF...NGT..F..FK.PSGIFNCDIR.NCIV...GD.N.....VYLSN..........I.....-G.......TLA..N..YT........IEEDVFIENVGVL.....V.........V.S........G..V..........STFGNGHE......................IEILNEG.GG.RELPVFDRL................S.AQLAYLL..............V..I.Y..R.H..SRK..F.SDTLKSII.DR.YV.R........TRA.S..E.IG..T..IGKGSKIRDVKTIH.N..VRIGAFANIRGASLLEEGTV.GS...NQL...A..P...VFIGEDVSASRFIVLSGSVIKDGAIISSTFVGQGVQIGRQFSAENSAFFANCEAFHSEACSIFAGPYTVTHHRSTLLIAGLF....SFYNAGS....GTNQ.SNHMYKLGPVHQGIIERGAKTGSFSYMLWP.........C..RV..G..AFSVVM.DKHA.GNFDTTDLPFSYI.......S..V..........E.......N..G..K.......S..V........LT.PAM.........................NL..F..T..V.G.........T...A.RDSGKWPARDR.RK.D...T..E..K..LDLIHFDILSPFTAQKILNGIKLLE.....R..LH.AD.T..P..KS........REF.....................................................................VLYK.GVF.I........NR....L....M...LR.......TS.....KRYY...E..LALVVYLT.GQLV..K.R.......LETA....E.F...K.S...L....PG.IKKIL....Q.P..RFTP.V..Q.E.KWVDLAGMFAEKKSV.EYLMDSVVSGEIT.S.LDILVSRLQAIYEE...YEEKSWSWCLAI.LKEW..KD.......FD......L..E.S...L.SIPLLLEVLEE.W.KNNSLK....LNNMILKDAEKEFD.QLS...RIGFGN...DGDEKE.QLDDFENIR.GK.Y..ESNSFVLGLKQESEKTEALYSRLSGR-l.....................................................................
I9GWI0_9BACE/5-659                   ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGK.I...S...V.........A...K.........D...F.T.....T.........E.........YVHHTRFSGE...VKL..GVFQS.EF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGDDAFIENVDII.....L.........V.D........G..R..........TTFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKEIT.DY.YS.N........KHA.S..T.VG..T..IGNRVMILNTGSIK.N..VRIGDCCHICGTCRLSNGSI.NS...NAI...A..P...VHIGHGVICDDFIVSSGSHIDDGTMLTRCFIGQACRLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..F........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..K..LDYINYNLLSPYTIQKMFAGRTILK.....D..LK.RV.S..G..ET........SET.....................................................................YSYQ.SAK.I........KN....S....S...LN.......SG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....ED.IRERL....K.P..DTEI.G..T.G.EWVDISGLIAPKSEI.EKLMCGIESGEIN.R.LKEINACFSEMHNN...YYTYEWTWAYGK.IQEF..YG.......LD......P..E.T...I.TAKNIIDIVRS.W.KEAVIG....LDRMVYSDARKEFS.LSS...MTGFGA...DGSQDE.MKLDFEQVR.GD.F..ESNPFVTAVLQHIDDKNALGDELINRI......................................................................
C5K8Q3_PERM5/385-588                 .........................................................................................................................................iveen--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...------------------------------------------------------AVGEVTASLIGPFVGF-HHQALLIACFWp..aGRGNVGY....GANVgSNHTG-KAPDQENWPGEGTFFGLASNIKYP.........F..NLvdA..PYSLIA.TGVS.CLPQAIGLPFSLV.......N..E..........S.......T..E..H.......I.sG........LS.PAInevtp..............gwmlsdNM..Y..S..L.F.........-...-.RNEAKFESRQG.NL.P...K..D..G..-VMYQYSVFRPEIMDRVVKARDALK.....A..VD.P-.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------kdarlrdakgravytdkqiailgk..............................................
A0A0M2XXT2_9SPHI/41-722              ..............................................................................................................................................YRDLTETEVQQLIN.N.GNWS..SD..WTK.V...K...V.........S...A.........V...F.D.....P.........N.........QVQHCKFYGL...VRI..GNLSP.SY..LD...YRN..L..QL.PIGLYHSTII.SSDF...GD.D.....VAVHH..........V.....-G.......YLS..Y..FI........VGNEVLLSQIKEM.....E.........T.G........S..T..........AKFGNGILrdgee...........sdkrieLELCNEN.GA.RSVYPFDGM................Q.AADVYLW..............T..R.N..R.H..DHA..L.QRRFGELT.DQ.KF.G........TQR.G..Y.YS..Q..IGDRCVIKNTLTIK.N..VKIGTDAYIKGVSKLKNVTV.NS...SQE...S..Y...TQIGEGCELVNGIIGYGCRIFYGVKAVRFILASYSQLKYGARLINSYLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYCLIVkGDFL.HELDIK-LPFTLV.......S..Nd........vQ.......H..D..Q.......L..V........LI.PGYwf.....................myNM..Y..A..L.V.........-...-.RNANKYAARDN.RH.F...K..N..Q..--YFEYDMLAPDTVNEMFAGMDMLAlavadS..LH.AA.A..G..QE........EHQrivagrall..................................................annmdlkdqtIVLQ.GAE.N........SR....Rp..tV...IQk....vgEA.....YHLY...R..SFIKYYGV.LHLM..D.A.......LEEG....-.-...L.S...L....QD.IMASL....S.G..RSR-.-..-.T.NWENIGGQLIESNAL.HTFLDDVKSTKID.S.WDEIHEFYHDKSKS...YALDKREHALLS.LIEV..LN.......LE......G..M.V...L.STDKIVSLLDQ.A.LGHRIW....IGEQIYKSRAKDYK.NQF...K-----...--NMVYaNDEERDIVV.GK.L..EENSFINQQQKELE-------------ifkirvanl.............................................................
A0A1Q2MCK0_9BACT/5-657               ..............................................................................................................................................YRKLTEAEIKVLES.N.GCVC..SR..WDD.V...S...V.........C...K.........G...F.D.....P.........A.........FIKESFFSGT...VRI..GRTGE.TV..EM...ECG..L..VL.HSGIYRSRIH.NCSF...AD.N.....VLIEN..........V.....-S.......LLA..N..YD........IQNDAVICNTDLM.....T.........V.E........G..P..........TSFGNGVF......................IEVANES.GS.RAIPMFDRM................S.SHAAYMM..............A..M.Y..R.H..RPQ..M.MQKLLGMV.DK.YS.K........KVT.S..E.RA..V..VGEKCIIRGARLIR.N..TKFGPGTRVEHADCLENGSI.NS...SLD...D..P...VYIGVGVTAKNFILCQGVSVEDRTILKKCFVGQATRLSNQFSAENCAFFANCGLHHGEACSVFAGPYTVSHHKSTLLISGTY....SFFNAGS....GSNQ.SNHMYKLGALHQGVIERGSKTTSDSYILWP.........A..RV..G..AFSLVM.GRHY.SHGDTRNMPFSYL.......I..E..........S.......D..D..K.......S..M........LF.PGV.........................NL..R..S..I.G.........T...I.RDSRKWPERDN.RK.T...K..D..I..LDFISFNLLTPYTAEKMFNALEIID.....R..LL.ED.-..D..SD........SAI.....................................................................VAYN.GMW.V........KR....S....S...LT.......KG.....KKLY...M..LAINRYLG.NILV..H.F.......MRKS....G.F...K.S...L....DD.IYKLL....E.R..EDGR.A..R.G.EWIDLAGLLVPKAMA.EELLDEIESGKIN.G.LEQIHERLKKLHES...FADLEASWIRAA.IERL..YS.......KK......W..H.D...F.TKNDFITFVNT.W.IESVAS....LDYMRCSDAAKEFS.ETM...SIGYGI...DGDREV.QKKDFEATR.GT.A..ETHPFTRAILERLEKKRASAAKIIKKL......................................................................
A0A1H4FVX4_9BACT/41-730              ..............................................................................................................................................YRKLTAYEVEALVR.N.DNTS..DD..WNT.I...F...V.........S...E.........E...F.N.....P.........Q.........LVQHCHFYGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........IGNEVILANINEM.....A.........T.T........D..Y..........AKFGNGIVkeaeq...........esgriwLELCNEN.GG.RRVMPFDGM................L.PGDAYLW..............T..R.N..R.D..DEQ..L.QQQFKSFT.EK.QF.D........KKR.G..Y.YG..M..VGDRCVIKNCKMIK.D..VTIGSDAYLKGANKLKNLTI.NS...SAE...A..S...SQIGEGCEMVNGIVGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAARG---------FWPglcvslkhnS..SF..A..CFTLISkGTYT.SELDIS-IPFSLVv.....nD..E..........H.......E..N..R.......L..K........IM.PGYwf.....................myNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RT.E...K..I..Q..--HIEYDYLAPDSVEEMFNGLAIME.....L..AT.GE.A..W..YR........LEEnapkktltekdirkkgke.................................lllnhpdevarltilvkgMENS.SRE.V........QL....L....K...VH.......KA.....YPLY...R..ELIALYGI.KNIL..A.-.......----....-.-...A.D...K....AS.FAALK....E.A..VKSA.K..R.G.AWHNVGGQLMKAETL.EQLKTRIKKNKIS.N.WNQLHDAYIEIGEA...YVDDKLQHAFAS.LLEI..KE.......VN......I..K.D...F.TGEQLASWLTD.S.VGTMQF....LTEQIRRTREKDYK.NPF...R-----...--QMTYgNMKEMNAVI.GS.L..EDNSFINQTATELEAYKQKVQKTI---re....................................................................
A6L1G8_BACV8/4-658                   ..............................................................................................................................................YRSLTQEEIQQLKE.R.SCTA..VD..WDE.I...E...V.........V...E.........N...F.K.....T.........D.........YIYHTRFSGK...VRL..GVFED.EF..TL...AGG..M..RK.HSGLYHATLH.NVTV...GD.N.....CCIEN..........I.....KN.......YIA..N..YI........IGDYVFIENVDII.....L.........V.D........G..R..........SKFGNGVE......................VAVLNET.GG.REVPIHDRL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.ICRMKAII.DR.YA.E........ENA.S..D.TG..T..IGHHVTIVDAGYIK.N..VRIGDYCKIEGAGRLKNGSL.NS...NEQ...A..P...IHIGYGVVCDDFIISSGSNVEDGTMLTRCFISQACHLGHNYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGAMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......Q..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...P..N..R..LDQINYNLLSPYTIQKMMKGRSILK.....E..LR.KV.S..G..ET........SET.....................................................................YSYQ.SAK.I........KN....S....S...LN.......NG.....IRFY...E..TAIHKFLG.NSLI..K.R.......LEEV....R.F...S.S...D....EE.IRARL....I.P..DTEI.G..T.G.EWVDISGLIAPKSEI.EKLMADIESGILT.N.VDQIHDRFVEMHRN...YYTYEWTWAYGK.MLEF..YN.......LR......S..D.E...I.TAKDVIAIVKK.W.QEAVVG....LDKMVYADAKKEFS.LSA...MTGFGA...DGSREE.MEQDFEQVR.GV.F..ESNPFVTAVLQHIEAKTALGNELIERI......................................................................
F8WZV8_9BACT/3-657                   ..............................................................................................................................................YRNLTPEEITRLES.Q.GCLA..DN..WNN.I...S...V.........H...K.........N...F.K.....P.........D.........YIKHTNFSGK...VKL..GVFED.EF..TL...PGG..L..KK.HSGLKHACLH.NCEL...GD.N.....VLIEN..........V.....QN.......YIA..N..YR........IGSNVRIQNIHHL.....Y.........V.E........G..Q..........SSFGNGIE......................VSVLNET.GG.REVMIYDKL................S.AHFAYIL..............S..F.Y..R.H..RPA..L.IKKLQGMV.AD.YA.K........ERT.S..D.FG..Y..IGDNVTIVNAGAIK.N..VHIGDYATIEGARHLENGSI.NS...NQY...D..P...VHIGYSVMANDFIVCSGSRVEDGTMLTRCFVGQSCQLGHTYSASDSLFFSNCQGENGEACALFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGIVERGGKTTSNSYILWP.........S..RI..G..AFSLIM.GRHY.YNADTSNMPFSYL.......I..E..........D.......K..D..E.......S..V........LV.PGI.........................NL..R..S..V.G.........T...I.RDAQKFPKRDK.RK.D...P..E..K..LDQINFNLLSPYTIQKMFKAIEILE.....G..LK.ET.C..G..ET........SGS.....................................................................YTYQ.SCR.I........KG....T....S...LK.......RG.....LKLY...N..MAINKFLG.NSII..S.R.......LSKC....S.Y...T.S...N....EE.IRECL....K.P..DTEV.G..L.N.EWSDVGGMLVPRSEI.DKLIDDIESDNIK.H.VSEMNAIFEQLHKN...YYSLEWTWAWDK.IQQY..YN.......LS......L..D.T...I.TAQDIVDIVSQ.W.KEAVVE....LDRMIYEDAKKEFS.LSS...HTGFGV...DGDKHQ.QKIDFEQVR.GI.F..EENPFVETVLKHIESKTRLGNETISKL......................................................................
R6C6Z1_9BACT/4-602                   ..............................................................................................................................................YRPLTTEEIEVLKH.N.DCWA..ED..WTS.V...N...V.........S...E.........D...F.K.....P.........N.........FMHRVMLYGE...INI..GSFNK.NV..EV...SQG..F..VK.HSGINNATLR.NVTI...GD.D.....CLIEN..........V.....GN.......FIN..N..YT........IGDDCYISNISTM.....E.........T.T........E..G..........ATYGEGNL......................VSVLNEV.GE.GNVILFSDL................N.SQLAAFM..............V..K.H..F.P..DKE..M.KEKIRQLI.KT.DI.D........NKM.P..E.RG..Q..IGNNVKIINTKEIT.N..CVINDYCEVNGASRLSDCTL.LG...SVH...G..N...VYIGTGVITENSIIAEGASVINSVKIQDCFVGEACQLANGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGILERGSKTASGAYLLMP.........A..TL..G..SFSVCF.GKLM.HHPNTRNLPFAYL.......I..A..........D.......G..D..K.......M..F........LI.PGR.........................NI..T..T..V.G.........L...Y.RDIKKWPKRDL.RA.M...E..N..R..KSIVNFDWLSPYSVGEILKGKKILE.....N..LR.EV.T..G..DN........VSQ.....................................................................YLYH.EYI.I........PA....S....S...LH.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKRD....P.-...-.-...-....-A.I---T....P.P..ATHV.G..V.G.DWDDLSGLLLPVSEE.EGIVRDVKEGTIG.N.IEQLLDRFEEINAN...YRDYQWAWTYQM.ICDY..YG.......I-......-..S.D...I.TLEDANRIHED.Y.IKARRS....WIAEIRKDAEKEFA.M--...------...------.---------.--.-..---------------------------gdveeev...............................................................
A0A1M7L879_9BACT/42-734              ..............................................................................................................................................YRNLNAREIELLVR.N.NNQS..DD..WNK.I...L...V.........A...D.........A...F.N.....P.........D.........LVKNCKFFGL...VRI..GKLEP.CF..LE...YHN..L..RM.PVGIYNSTII.SCDI...GD.N.....VVIDN..........V.....-H.......YLS..H..YI........LGNEVVLVNVNEM.....A.........T.T........S..H..........AKFGNGIVkegep...........eevriwLELCNEN.GG.RKVAPFSGM................L.PGDAWLW..............S..R.Y..R.A..DEA..L.QSQFLAFT.QK.AF.D........HKR.G..Y.YG..K..VGDRCIIKNSLIIK.D..VWIGSDAYIKGANKLKNLTI.HS...TPE...A..S...TQIGEGCEMVNGIVSEGCTIFYGVKAVRFLMASHSQLKYGARLINSYLGSNATISCCEVLNSLIFPAHEQHHNNSFLCAALLq.gqSNMAAGAt..vGSNH.NSR----GADGELVAGRG---------FWPglcvslkhnS..RF..A..TFALVTkGDYP.AELDIP-LPFALI.......S..Nd........vH.......R..N..E.......L..R........VM.PAYwf.....................qyNM..Y..A..L.A.........-...-.RNAWKYKDRDK.RI.E...K..T..Q..--HLEFHFLGPDSMSEVLEAIYILE.....K..LC.GL.A..F..FR........QFPqdqtpnveltrnkgkel...................................letkdpilqrldifaegWENS.SRK.V........RV....V....K...VM.......EA.....YRIY...K..QLLLYYPI.HCIL..E.N.......LDEA....A.P...L.K...P....ED.IHAMI....G.N..K-NT.D..L.A.SWSNVGGQMIQEADL.EAIISSIKKGRIS.S.WSKLHKQYKHLGDD...YASSKTVHAFRL.LMKD..--.......QG......S..K.E...V.SEELLEKMLFS.A.IEFRSW....LSEQVLLSRKKDYD.NKF...R-----...--NMVYqSLDERDLVL.GS.L..DHNSFIREDRDACR-------------sflekshrwldni.........................................................
Y851_TREPA/42-719                    ..............................................................................................................................................WRPLSKEEIHTLIQ.K.GNHC..DT..WHD.V...L...V.........A...D.........P...F.D.....A.........S.........LIRNSSFAGL...VRI..ASLER.RL..LR...YHD..F..TV.PTGITHSTLI.SCDV...GE.N.....CAIHH..........C.....-A.......YIS..H..YI........IGNHVILSRIDEL.....C.........T.T........N..H..........AKFGAGIIkdgeq...........eavritIDPLNET.GG.RKIFPFVGM................I.AADAFLW..............A..C.H..R.D..RTL..L.MQRFESMT.QQ.QH.D........TRR.G..Y.YG..T..IETQSVIKSCRIIK.D..VCFGPGSYVKGANKLKNLTV.QS...SLQ...E..P...TQIGEGVELVNGVIGYGCRVFYGVKAVRFVLGNNCALKYGTRLIHSVLGDNSTISCCEVLNALIFPYHEQHHNNSFLIAALIr.gqSNIAAGSt..iGSNH.NTR----KNDGEIIAGRGFWSGLASTLKHN.........C..RF..A..SFVLIT.GKNYpAELDIP-FPFSLVt.....nN..E..........R.......E..N..R.......L..E........IM.PAYyw.....................lyNM..Y..A..I.E.........-...-.RNEKKFAARDK.RK.T...K..T..Q..--TVEISVFAPDTIGEIENALALLD.....S.aIE.RA.W..V..NA........GNSaltaedivlkh...............................................ptkaqtipvllTGIE.HST.R........ST....L....V...LKp.....lEA.....RKAY...R..DILIWYCT.KTLL..S.F.......FEQT....T.-...-.-...-....RC.ISHFT....S.H..DPKT.I..T.H.NWVNMGGQLVPEDKF.ETLLQNIETGKFK.S.WHHIHKEYDALAAT...YETDKALHAYAV.LCSL..AR.......TR......I..D.-...-.-APLLCTYVQH.A.ITIEKY....RVTQIHKTRCKDYL.NPF...R-----...-EITYR.NPLERNAVL.GT.P..EEDQLIRTTEEES--------------ahlcalyaryia..........................................................
F0RX97_SPHGB/44-726                  ..............................................................................................................................................YRHLRESEIKDLED.N.LNSS..PC..WED.V...L...V.........T...D.........P...F.D.....T.........S.........LIRNSEFYGL...IRI..GKMDK.SI..VS...FHD..F..SV.PVGIANSRIV.SCDI...GD.H.....CAILD..........C.....-A.......YLS..H..YI........IDHHVILYRIGEM.....Q.........T.T........N..H..........AKFGSGILkeged...........edvritIDIMNEA.GG.RTIRPFDGI................L.PSDAFLW..............G..T.Y..R.D..DQA..L.MRTFEELT.EK.TM.D........KRR.G..Y.YG..F..VGQQSVVKSCDTIK.D..VWMGPGSYIKGANKLKNLML.RS...TLA...E..S...IQIGEGVELVNGIIGSGSRIFYGCKAIRFIMGDNCNLKYGARLIHSFLGDNSTVSCCELLSNLVFSGHEQHHNNSFLIASLIm.gqSNMAAGAn..iGSNH.NSR----GNDGEMVAGRGFWPALSSTLKYD.........C..KF..A..SYVLITkGNYP.HELNIP-LPFSLLs.....aD..T..........K.......E..S..R.......R..V........VM.PAYww.....................myNL..Y..A..L.E.........-...-.RNSYKYRKRDK.RK.V...I..R..Q..--HIETEYLAPDTVNEIFKACDLIC.....L.wVA.QN.Y..N..RA........HAStkeqkdltqmgrell......................................lskpsevsslhvyawgLENG.NEP.V........EI....L....K...VV.......EA.....YQAY...Q..EMLLYYG-.---V..K.T.......LSSY....C.L...A.T...K....QS.I-ACF....Q.E..KETI.K..R.E.DWLNVGGQLVPEFRV.EKLKSDLKNNAIL.S.WNEVHQIYDVWFAS...YEQDRAIHALAT.LYQA..--.......LD......T..K.Q...I.NDAQWQDLVQN.V.AKIRLN....IESQVFKTKEKDFN.NRF...R-----...-ESTYR.NLAERDAVL.GS.L..DDNPFIQESRQITEQVLS---------qirsv.................................................................
A0A174K0N3_9BACE/4-658               ..............................................................................................................................................YRRLTEDEVLQLKS.Q.SCLA..DD..WGN.V...L...V.........A...E.........G...F.N.....C.........E.........FVHHTRFSGE...VKL..GVFES.EF..TL...PGG..I..KK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGSDTFIENVDII.....L.........V.D........K..L..........TTFGNGVE......................VAVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.INRMKSIA.DY.YS.N........KHA.S..A.TG..S..IGEHVMILNTGSIK.N..VRIGDYCHICGTCRLSNGSI.NS...NVT...A..P...VHIGHGVICDDFIISSGSKVDDGTMLSRCFVGQSCKLGHNYSASDSLFFSNCQGENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTMERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHADTSNLPFSYL.......I..E..........Q.......R..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPRRDK.RQ.D...P..N..R..LDYINYNLLSPYTIQKMFKGRSILK.....E..LR.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....T....S...LN.......NG.....IRFY...E..IAIHKFLG.NSII..K.R.......LEGI....N.F...Q.S...N....EE.IRQRL....K.P..DTEI.G..V.G.EWVDVSGLIAPKSEI.DRLLDGIENGTVN.R.LKSINACFAEMHEN...YYTYEWTWAYNK.IQEF..YG.......IN......P..E.I...I.TAQDVIRIVKS.W.QESVVG....LDKMVYEDAKKEFS.LSS...MTGFGA...DGSHDE.MRQDFEQVR.GD.F..ESNTFVTAVLKHIEEKTALGNELIKRI......................................................................
R6MK87_9BACE/4-658                   ..............................................................................................................................................YRSLTNEEINRLEA.Q.ACSA..SD..WND.V...Q...V.........D...E.........H...F.T.....P.........D.........YVHHARFSGK...VRL..GVFEY.EF..AL...PGG..I..CK.HAGLSYVTLH.NVTV...GD.N.....CCIEN..........V.....KN.......YIA..N..YE........IGAYTFIENVDII.....L.........V.D........K..K..........SRFGNGVE......................VSVLNET.GG.REVMIHDRL................S.AHQAYIM..............A..L.Y..R.H..RPQ..L.IERMKALI.EA.YA.D........EHA.S..D.VG..T..IGSHVTIVNSGYIK.N..VRIGDYCEIEGAGRLKNGSI.NS...NAA...D..P...VHIGYGVVCDDFIISSGSHIEDGTMITRCFVGQACHMGHNYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGALERGAKTTSDSYILWP.........A..RI..G..AFSLVM.GRHV.NHPDTSDLPFSYL.......I..E..........D.......K..N..T.......T..Y........LA.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDL.RK.D...P..V..R..LDQINYNLLSPYTIQKMMKGRSILK.....E..LQ.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....A...LN.......KG.....IGFY...E..TAIHKFLG.NSVI..K.R.......LEGI....C.F...K.N...N....EE.IRCRL....Q.P..DTVI.G..E.G.EWVDISGLIAPKTEI.ERLMNDIETGTLY.T.VDQIHDRFAEMHAN...YYTYEWTWAYGK.MLEF..YG.......LN......A..E.T...I.TAKDIINIVHQ.W.QKSVVG....LDRMVYEDAKKEFS.LTS...MTGFGA...DGSKEE.QVLDFEQVR.GV.F..ESNPFVTAVLKHIEVKTALGNELIERL......................................................................
A0A3N4MEV2_9BACT/42-733              .............................................................................................................................................h-RKLKAGEIETLVR.N.DNTS..DD..WNN.I...F...V.........D...N.........D...F.D.....P.........N.........LVQHCHFFGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVIHN..........V.....-N.......FLS..H..YI........IGNEVMIANVNEM.....A.........V.T........D..H..........AKFGNGIVkegep...........esvriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.H..DQA..L.MDQFKNFT.EK.QF.D........KRR.G..Y.YG..M..VGDRTVIKHCNIIK.D..VTIGTDAYLKGANKLKNLTI.NS...EAG...A..P...SQIGEGCELVNGVVGLGCRVFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglsvtlkhnS..KF..A..SFTLIAkGNYM.SELRIP-FPFSLVv.....nD..E..........H.......D..N..S.......L..R........IM.PGYwf.....................mhNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RT.D...K..T..Q..--HIEYDYLAPDSAEELLEALELME.....L.aVG.KA.Q..M..QQ........KEKdkagkkaiqqtgkkll.....................................leenakvarmeilgeqVENS.SRK.V........ML....L....K...VH.......KA.....YPLF...R..ELIVLYAV.KNLL..Q.Q.......AANL....D.I...Q.S...F....PA.LQSYL....K.Q..---C.K..R.G.PWSNVGGQLMKTEDL.EELKQRIRKGKIG.S.WQQLHDAYRQLGER...YDEDKLQHALAC.LLHL..HQ.......LS......P..K.E...L.TAAQFKKFLDQ.S.VYTFGM....ITEGIYHSREKDYL.NPF...R-----...--QMTYeNNEEMEAVV.GR.L..EDNSFIQQTIQVLKAYKKQVKDLIKK-w.....................................................................
A0A1T4JJ20_9SPIO/24-722              .............................................................................................................................................k-RRLTPAEISVLTD.N.LNSS..EDpeWKN.V...Y...V.........D...D.........DrfgF.D.....P.........T.........LIKNSTFSGF...VVL..GRIWP.AM..LK...YHD..L..EL.RTGIYNSKLR.DVVT...GN.D.....NAIHN..........T.....--.......AID..N..YH........IGSRIMLFNIQEL.....S.........C.T........N..H..........SKFGNGILkegep...........esnridIAVSNEN.GG.RAVLPFEKM................I.PADAYIW..............S..R.Y..R.D..DNV..L.MERLKVIT.EA.EY.P........KTL.N..T.FG..I..IEDDAVIKNTTLIK.D..AKIGACAYIKGAFKIKNVTI.LS...SSD...E..V...SQIGEGVELVNGIVGYGCHIFYQAVAVRFVIGRNCQLKYGARLLNSVLGDNSTVSCCELLNNLIFPFHEQHHNSSFLIATTVl.gqSNIAAGAt..iGSNH.NSR----SPDGEIIAGRGFWPGLSSSFKHN.........S..RF..A..SFVLIAkGSYQ.YELDIE-YPFALV.......A..Q..........Ge....spD..S..P.......V..H........II.PAWwf.....................myDM..-..-..F.A.........I...V.RNKYKFSARDK.RI.Q...K..I..Q..--HIETDPFAPDTMQEVEDAIDRLI.....D..LT.AE.N..L..SE........LAPeraekadtpeklr..........................................qagkdflhskeaqsFTLH.DNI.C........QKk..yG....S...IIyk...pgNA.....YKMY...R..KIIKYFCT.KTIV..D.F.......CSDN....G.F...E.T..vT....EE.VIEKI....R.K..I--P.L..Y.T.DWENAGGQVIPQKKL.NELFKKIKEGKIN.S.WQEVHSFYDECQAH...YTEYKAGYSLYL.LERL..YS.......AK......I..E.D...F.PAAIYKDIIKD.V.TVISND....MYESSVSSREKDFT.DYY...R-----...-CMTYR.NKNEMNAVL.GT.I..SDCGFLHTLKEDTETFNNR--------lktvfsgm..............................................................
R5PGQ4_9BACT/3-614                   ..............................................................................................................................................YRQLTGQEIRLLED.N.SCWA..ED..WSA.I...S...V.........A...E.........D...F.K.....A.........N.........YFHRVMFYGT...IRL..GTFEK.SV..EV...SKG..F..VK.HSGINNATLR.NVTI...GD.N.....CLIEN..........I.....GN.......YIN..N..YV........IGDDCYISNVCTM.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GN.GNLTRFHGL................N.SQFAAFM..............V..K.H..A.A..NKP..L.KDAIRRLI.NE.EI.E........RNS.H..E.CG..T..IGNNVKIVNTKEIT.N..TVIYDDCEISGASRLSDCTI.MS...SSD...A..N...VFIGTGVICENSIISDGSSIINSVKMQDCFVGEACQISNGFTASSSVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHYGLMERGTKTASGAYLLMP.........A..NI..G..TFSVCF.GKLM.YHPDTRNLPFSYL.......I..A..........Y.......N..D..T.......M..Y........LV.PGR.........................NL..T..T..V.G.........L...Y.RDIRKWPKRDM.RA.H...G..G..R..KSIVNFDWLSPFSVGEILRGKRILE.....S..LR.EA.S..G..DD........VST.....................................................................YNYH.EYV.I........KA....S....A...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.H.......ILE-....-.-...-.-...-....--.-----....K.P..LTDT.G..T.G.NWNDLSGLLLPESEE.QRLIADIIDGTID.T.TQGVEERFRDINDN...YPEYRWAWTYRM.MLDY..YG.......L-......-..E.T...L.TEEDAEKIRQD.Y.VTARRA....WIAEIKKDARKEYA.LG-...------...------.---------.--.-..---------------------------dieeevflnfndqldrevdfenqk..............................................
A0A421K8I3_9SPIR/1-637               .............................................................................................................................................n--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...-RI..GSLPK.VI..LE...HGT..L..RL.PVGIYSSTVI.SCDI...SD.N.....SAIHN..........V.....-A.......YLS..R..MQ........IEERCILFNVDEL.....E.........T.C........G..H..........GLLPDEESrea................rkwVEIANEN.GG.RRVLPFAGM................L.PADAWLW..............S..K.Y..R.D..DGE..L.MARFLEMT.DR.MK.N........GCP.A..S.YG..L..IAAGSVIKNCHILK.N..IRVGQSAYIKGVNTLENLII.NS...STD...R..Q...TQIGEGCELVDGIIGYGCKVFFGVKAISFVMNDHSVLKYGAKFIHSILGANSSVACSEILNSLLFGTHIQHHSTSFLCSSVIk.gmSNIAAAAn..iGSNH.NSR----AADGEIVAERGFWPGLDVSLKHN.........S..SF..A..AFCLIAkGSYP.AELDIS-LPFCLVs.....nD..K..........H.......A..D..E.......L..K........IV.PGYwf.....................rhNM..Y..S..L.A.........-...-.RNSIKTALRDK.RS.G...D..S..Q..--RLEYDWLAPDTVDQMQEGRRLLE.....E..LA.NK.S..D..YV........IQDqypdgrsllla...............................................qdpdlfadtgaVESG.SRP.V........RI....L....H...AG.......RG.....WRDY...G..RMIRFYAV.RTLLisN.RmnacvlsLRDT....H.P...S.S..qE....AD.AETGF....S.S..PHSA.V..S.D.PWENVGGQLIRKSRL.EEIKKRIKAGEIS.D.WNTMHTSYAREADI...YPDECCKHAVQV.LREC..AP.......MH......F..S.P...-.--E---RLIAE.A.LETAKF....IYDGIIRSRQKDYE.NKF...R-----...--NMVYdTAQERDAVL.GT.I..EDDKYIKISLEEFRRFEALA-------gkeln.................................................................
L1NHP2_9BACT/2-592                   .............................................................................................................................................n-RLLTEEEIGLLED.Y.GCTA..ED..WTA.I...N...V.........S...E.........D...F.Q.....P.........T.........YIHNVSFYGN...IEL..GVFEK.NI..EV...SKG..F..QK.HSGIRNATLR.NVSI...GD.N.....SLVEN..........I.....GN.......YIH..N..YT........IGEECYISNVSTI.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEI.GE.GNVMLFGNL................N.SQLAAFM..............V..K.H..H.N..DKE..L.RDKLRKLI.YE.EL.S........KTA.P..E.RG..I..IGFGAKVVNTKEII.N..TVIFDNCEINGASRLFDCSI.LS...VAG...S..S...VYIGSGVICENSIIADGSSVTNGCNLQDCFVGEACQLTNGFTASSSLFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPLHYGTFERGTKTASGAYILMP.........A..NI..G..AFSVCF.GKLM.HHPDTRNIPFSYL.......I..A..........Y.......G..D..I.......M..Y........LV.PGR.........................NL..N..T..V.G.........L...Y.RDVRKWPKRDI.RP.R...S..G..Q..KSIVNFEWLSPFTVNEMLQGKKILE.....R..LR.DA.Q..G..EM........VSE.....................................................................YNFR.GYV.I........TN....N....S...LN.......IG.....LRNY...D..IAIKIFIG.TRV-..-.-.......-EKY....G.I...D.-...-....--.-----....E.P..TSII.G..Q.G.TWNDLSGLLLPDSEE.QRMKEDIKSGNIR.N.IQTILERFADIAEH...YEDYEHVFTHWL.IKEF..YK.......ID......Y..P.T...-.-VDDLDTIIEE.G.KQAKRD....WIATIKQDALKEYK.L--...------...------.---------.--.-..---------------------------gdve..................................................................
A0A4U3L040_9BACT/44-739              ..............................................................................................................................................YRQLTAYEIEVLVR.N.RNTS..DN..WNN.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.YV..LS...FSD..L..KL.PVGLYNSTII.SSDF...GD.N.....VAIDN..........V.....-H.......YMS..H..YI........TGSKVIITNVNEL.....V.........T.T........D..H..........SKFGNGIVkegee...........esvriwLEICNEN.GG.RKVIPFVSM................Q.AGDAWLW..............S..R.Y..R.E..DDL..L.LERFKEFT.EK.EY.K........VAR.G..Y.YG..K..IGDRTVIKNCGIIK.D..VWIGADAYIKGANKLKNLTI.NS...GEE...G..Q...TQIGEGCELVNGVIGFGCRVFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPSHEQHHNNSFLCAAMVm.gqSNIPAGAt..iGSNH.NSR----GADGEIIVGRG---------FWPglcvslkhnT..KV..A..SFTIIAkGDYN.YELNIP-VPFALV.......S..N..........Dv.....aK..D..R.......L..V........VM.PAYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKYADRDN.RT.E...R..I..Q..--FLETDFLAPDSVNEMFDAIALFE.....T.aVG.AA.F..Y..RE........K-Rpeilptdeqcllegrq.....................................llqqknevvkeleinvAGFE.NAK.R........KT....A....I...TKv.....qQA.....YDAF...R..EMITFYGI.CGLI..T.V.......AEQY....D.Y...-.-...-....TG.LQSLL....K.T..ATYA.H..R.N.NWLNVGGQLIPEDEV.EKAKRLIKEGEIA.S.WIDVHQFYITQGQR...YPEQKLLHQLAS.LSEV..KQ.......MP......L..D.M...L.SMEEIHILLED.A.IVIKEK....VAAAIHASRAKDYN.NPF...R-----...-KMVYE.SELEMEKVV.GR.L..EDNSFILQQAKEVEAFKNKVAELKEKLmqq...................................................................
A0A024U0N0_9STRA/37-520              ...........................................................................................................................................spv----TPAQIQVLEQ.Q.GNRA..DS..WDS.V...Y...T.........K...G........sA...A.S.....L.........K.........RVRNCTFRGR...VYL..GDFEK.DV..MV...-DN..V..PF.PSGCYNSTVV.DSYV...LD.N.....ALVQD..........T.....-F.......LLH..R..TY........VSQGAVIVGCGTI.....T.........C.S........G.pE..........VTYGNGTV......................LKVGVEI.GG.REIAMFADM................P.FHLAAIV..............G..E.S..R.G..NAA..E.LKAYEDLV.RT.YA.K........SVR.C..DgFN..V..IARQAKVLRCPKIR.D..VFVGDGGVVEDS-VVSNSTI.LS...TPA...E..F...SSIVGFSQVHSSILQWNAHVDGGSSVERSFLFDCSHVERHGMVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..rGRGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALV......nI..P..........G.......H..N..I.......P..E........LS.PAInei..................ypgwVL.sH..S..IfT.........V...L.RNQDKFDKRNK.SK.R...-..T..K..L---DAPIFRPDIVTMMQVACQRLV.....D..AE.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------kkpvkirhgreiiytekqvpglgknymtessrvvaieaysfyt...........................
D8E096_PREBR/5-56                    ..............................................................................................................................................YRNLLSEEIEQLQL.Q.RCHA..SD..WTA.I...Q...V.........A...K.........D...F.N.....V.........N.........LITNVNFEGH...ICI..GN---.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------qvt...................................................................
A0A1N6KHJ6_9BACT/42-728              .............................................................................................................................................h-RKLNAREIETLVR.N.DNTS..DD..WNN.I...F...V.........D...N.........D...F.D.....P.........N.........LVQHCHFYGM...VRI..GKLEP.YF..LE...FHN..L..RL.PVGLYNSTIA.SCDF...GD.N.....VVVQN..........V.....-N.......FLS..H..YI........IGNEVIIANVNEM.....A.........T.T........D..H..........AKFGNGIVkegep...........esvriwLELCNEN.GG.RSVMPFDGM................L.PGDAWLW..............T..R.N..R.H..DAV..L.QEQFKAFT.EK.EF.D........KKR.G..Y.YG..M..VGDRTVIKNCKIIK.D..VTIGTDAYLKGANKLKNLTI.NS...EAG...A..P...TQIGEGCEMVNGIIGLGCRAFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglsvtlkhnS..KF..A..SFTLISkGNYL.HELQVP-YPFSLVv.....nD..E..........H.......E..N..S.......L..K........VM.PGYwl.....................mhNM..Y..A..L.A.........-...-.RNSWKYIDRDK.RT.D...K..T..Q..--VLEFDYLAPDSVEELFTTLELLE.....L.aVG.KA.H..H..GN........KKVsektlrqdgrqlll........................................kenesvkrmtiyadgIENS.ARK.V........QL....L....K...VH.......RS.....YPLF...R..ELIVLYAM.RNLL..K.N.......IVVV....-.-...-.P...S....FN.ALSAL....C.R..--NS.K..R.T.AWHNAGGQLIKAEDM.DDIKMRIRKGKIN.S.WQQLHDTYRQLGER...YEQDKLQHALAS.LLEL..LQ.......LT......P..K.E...F.TTSQLRKCLEQ.S.VHTLGA....LTEGIYRSREKDYV.NPF...R-----...--QMTYeNQEEMEAVV.GK.L..DENSFIQQTITDLKAYKKQVKDLIKK-w.....................................................................
A0A173MLA4_9BACT/44-741              ..............................................................................................................................................YRKLTAYEIEILVR.N.GNTS..DD..WNN.I...L...V.........S...D.........A...F.N.....P.........Q.........QVKHCKFYGL...VRI..GKLEP.YC..LE...FSD..L..KV.AVGLYNSTII.ACDL...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........IGNEVIIVNVNEL.....T.........A.T........D..H..........AKFGNGIIkdgen...........esiriwLEICNEN.GG.RSVIPFNGM................L.PGDAYLW..............S..K.Y..R.D..DDA..L.LQQFKILT.EQ.QF.K........KER.G..Y.YG..K..IGDRTVIKNSSIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GPE...G..K...TQIGEGCEIVNGIIGFGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGSNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNIAAGAt..iGSNH.NSR----SPDGEFIAGRG---------FWPglcvsikhnS..RV..A..SFTILAkGNYD.YELNIP-MPFSLVs.....iN..E..........S.......L..N..Q.......L..T........VM.PGYwl.....................myNM..Y..A..L.A.........-...-.RNAWKYKDRDK.RT.D...K..S..Q..--YLEYDYLAPDSVNELFTSIYLLE.....K..LI.GK.A..W..YS........KERpgkatpsdtvcqnkgk....................................ellaanntvlnelevvaDGFE.NAK.R........KT....V....I...IKa.....aKA.....WSIF...R..DLVIYYGG.QQLI..G.F.......IKEN....K.L...T.S...L....NE.IKAAL....P.P..SLAR.G.nE.G.GWLNIGGQLMPAEDV.QTLKTRIKENKIK.S.WDAVHNYYAEASNR...YPQQKLKHALSS.LSEI..LE.......TN......I..K.K...A.DEAVFTSIFDS.V.INTKEW....MTEGIYSSRAKDYQ.NAF...R-----...--KMVYsNKAEMDKVV.GK.L..EENSFIQQQQDELATLKRQVKA-----lkktl.................................................................
E6K3J9_9BACT/5-597                   ..............................................................................................................................................YRSLSVEEIEILEQ.N.GCSA..ED..WTT.I...N...V.........P...E.........D...F.R.....A.........E.........HIRNVSCYGE...INL..GVFDK.SI..EI...EEG..F..FR.HAGISNAVLK.DVTI...GD.N.....CLIEG..........V.....GN.......YIS..N..YD........IGEECYISNIGRL.....S.........S.T........A..D..........ATFGQGNT......................ISVLNEA.GT.GNAVIFSRL................S.AQLAALM..............V..R.H..A.G..DRN..F.QAALRSLI.KS.HI.E........STR.P..R.RG..Q..IGYRVKIVNTTEMV.N..VVVSDDCEISGATRLSECSI.LG...TAD...A..G...TYVGHNVMIDNSVVQAGSSILDGAKIDNCFVGEACHIGKGASAEASLFFANSYLDNGEACAAFCGPFTVSHHKSTLLIGGAY....SFYNAGS....NTNF.SNHAYKLGPVHWGTMERGSKTASGAHLLWP.........A..TI..G..AFSMCM.GKIQ.THPAVKNLPFSYI.......F..G..........A.......G..D..T.......T..Y........LV.PGR.........................NL..T..T..V.G.........T...Y.RDTDKWPRRDR.RP.C...M..S..R..ESLVCFDWLSPFTVLECIRGKRTLE.....T..LR.AE.Q..G..EN........MAS.....................................................................YVYG.GCI.I........RN....Q....S...LQ.......RG.....IKYY...D..MAIRLFLG.EEIG..Q.H.......A---....-.-...-.-...-....--.I---E....L.P..ESSI.G..T.G.EWSDLSGLLMPESEE.QQMVDDLCSGALN.D.LQLVEARFAETFRK...YEDYKWAWTYRA.AIDY..YG.......L-......-..E.T...L.TEEDAERIARE.Y.ERAHTE....WINAIKYDAEREFA.LGD...------...------.---------.--.-..---------------------------meee..................................................................
A0A2X4PLN5_9PORP/6-650               ..............................................................................................................................................YRQLSNDEIAQLKT.N.GCFA..ED..WSL.I...K...I.........T..sE.........D...F.Q.....T.........D.........HVYDVYFAGE...CSL..GANKG.HV..IL...PSG..L..RL.PAGVYRCSLY.NCHI...GD.N.....CRIAN..........I.....GR.......HIS..N..YQ........IGESCLISDCSLL.....E.........T.N........E..E..........SSFAQGEE......................IAVLNES.GG.REILLTDLL................S.AQTAYLM..............A..M.Y..R.D..RPK..L.QKKLRQLS.KK.RA.E........QKQ.S..S.LG..Q..IGNGCRLLSCSQIK.N..VLIGNSAELEGCTLIEDCSI.VS...SSE...S..P...TKIGSGTTIKKTVIADGACVDDGAHIVHCFVGQACHISAHFSAENSLFFANSVMHNGESCAAFLGPHSISMHKANLLIGGYF....SFSNSGS....GSNQ.SNHYYRLGPIHHGIVERGGKLASDSYLLWP.........S..RI..G..AFSLIK.GRHG.SGLDSADFPFSYL.......I..G..........Q.......D..D..H.......T..D........LK.PGY.........................ML..G..S..I.G.........L...L.RDAQKWSLRDK.RK.G...E..L..Q..-DFISYQVLSPYTMGKVAKGLTKLR.....E..TK.TE.R..L..S-........---.....................................................................---N.QLS.V........SE....K....A...KQ.......RG.....IKLY...T..LISDYYLL.RVLL..K.Y.......LQGI....E.H...P.-...D....RQ.ISIEL....P.-..-SPQ.S..G.N.EWCDLCGLLLPQTAV.EELISFVLSDKCS.T.LQEINLYIQRLHHS...YNSFEWAWYSTA.LKLF..KG.......ID......Q..P.N...L.RAPLICNILRS.G.LRSLAQ....LSGYIYEDAQKEFA.SSM...QVGFGI...DGDISA.RQKDFQSVR.SG.N..KTQETLDTIATNITEIFRQTTDYLQR-i.....................................................................
E6SSU1_BACT6/3-657                   ..............................................................................................................................................YRSLTEDEILRLKS.Q.SCLA..DD..WGK.V...T...V.........A...E.........G...F.T.....T.........E.........FVHHTRFSGE...VRL..GLFHS.EF..TL...PGG..I..RK.HSGLRHVTLH.NVTV...GD.N.....CCIEN..........I.....QN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........G..V..........SRFGNGVE......................VSVLNET.GG.REVLINDKL................S.AHQAYIL..............A..L.Y..R.H..RPE..L.IARMRAIT.DY.YS.G........KHA.S..S.TG..M..IGSHVMILNTGSVK.N..VRIGDHCRICGTCRLYNGSI.NS...NEV...A..P...VHIGHGVICDDFIISSGSHVDDGAMLSRCFVGQACKLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGTLERGAKTTSDSYILWP.........A..RV..G..AFSLVM.GRHV.NHSDTSNLPFSYL.......I..E..........Q.......N..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDA.RT.D...T..N..K..LDCINYNLLSPYTVQKMFKGLETLR.....N..LR.HA.S..G..EL........SDI.....................................................................YSFH.SAK.I........RN....S....A...LV.......KG.....IKFY...E..IAIHKFLG.NSVI..K.R.......LEGI....G.F...R.N...D....EE.IRDRL....K.P..GTDI.G..G.G.EWVDVSGLIAPKSEV.DALIDGIESGKVN.R.LKCINAEFERMHGN...YYEYEWTWAYGK.LEEF..YG.......FN......P..E.N...I.RAEDIIYIVEK.W.KEAVVG....LDRMVYEDAKKEFS.LAS...MTGFGA...DGSRLE.KELDFEQVR.GD.F..ESNPFVTAVLKHIEVKTALGDELIERM......................................................................
A0A255SZG8_9BACT/4-617               ..............................................................................................................................................YRQLTDREIDILEA.N.NCWA..ED..WTD.V...M...V.........A...E.........D...F.R.....P.........N.........YMHRVMLYGT...IRL..GAFEK.NV..EV...SKG..F..VK.HSGINDATLR.NVTI...GD.N.....CLIEK..........I.....GN.......FIN..N..YT........IGDDCHIANVSTI.....E.........T.T........E..G..........ATYGEGNL......................ISVLNEV.GD.GNVVLFRDL................N.SQFAAFM..............V..K.H..F.S..DKE..L.KARIRTMV.RE.QV.A........ATI.P..E.RG..V..IGDRVKIVNTKEIT.N..TVICDDCEIDGASRLSDCTI.MS...SPN...A..T...VYIGTGVICENSIVSDGSSIINSVKIQDCFVGEACQLSNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHWGVLERGTKTASGAYLLMP.........A..TI..G..TFSVCM.GKLM.HHPNTRNLPFSYL.......I..A..........G.......G..D..T.......M..F........LA.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.A...G..S..Q..KSIVNFDWLSPFSVGEILKGKTILE.....D..LR.KA.S..G..DN........VST.....................................................................YNYH.EYV.I........NA....S....S...LR.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......LKR-....-.-...-.-...D....PE.LN---....P.P..TTDV.G..L.G.DWNDLSGLLLPASEE.QRLVNEIKDGTLS.D.VNSVVERFRDIDNH...YREYQWTWTYRM.ILDY..YH.......L-......-..D.E...L.TLEDAARIHAD.Y.ITARRS....WIAEIRKDAEKEYA.MG-...------...------.---------.--.-..---------------------------dveedvfrnfidsldhevdfe.................................................
A0A1V9ZYU4_9STRA/37-546              ............................................................................................................................................sg---LSREQIVALEK.N.GNRA..ES..WTT.V...H...C.........A...S.........M...D.D.....L.........D.........RIRNCSFRGH...VYL..GKFTE.NV..LV...-EG..V..PF.PSGCYNSTLT.DVFV...AD.N.....ALVQD..........T.....-F.......LVH..G..TF........IDSQASIVRCGTI.....T.........V.S........D..N..........AVYGNGTP......................LKVGVEI.GG.REILAFADL................P.FDLAVKV..............G..K.Y..R.S..NAN..E.LATYEENV.LR.YA.K........AIK.C..G.VN..I..ISSNAQILRCPKLR.D..VYFGVGALIEDSC-VSNSTV.LS...SLS...E..Q...SRISGFSHVVSSLLQWHTIVETGSSVERSFLCEYSHVERHGIVMDSLLGPNTAIAEGECTSSFLGPFVGFHH-QAMIIASFWp..eGKGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSVKYP.........S..NFthA..PYSVLA.TGVS.TLPQKLEMPFALV......nI..P..........G.......H..N..I.......P..A........LS.PAVnei..................fpgwVL.gQ..S..V.F.........T..vL.RNMDKFEKRNK.AK.R...-..-..-..-TVVEHEIFRPEIIRMMEVALTRLT.....E..AG.NK.S..T..SIq......lGKQkiyt.............................................................dkqvPGLG.KNY.M........TE....S....S...RV.......AG.....IEAY...N..YFIRFYAL.NGFW..R.T.......LRQ-....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gplpvdavlhapttc.......................................................
H1HMK2_9BACT/1-615                   .............................................................................................................................................m-RQLTDEEIRVLED.R.NCWA..ED..WTN.V...Y...V.........S...E.........D...F.K.....P.........N.........YMHRVMLYGE...IRI..GDFDK.NI..EV...SRG..F..LK.HSGINNATLR.NVSI...GD.N.....CLIEN..........I.....GN.......YIN..N..YT........IGDGCYISNVSSM.....E.........T.T........D..G..........ATYGEGNL......................ISVLNEV.GD.GNVILFSDL................N.SQFAAFM..............V..K.H..F.H..DKP..L.KDAIRRLI.NE.EI.A........RNR.H..D.RA..S..IGNNVKIVNTKEIT.N..TVIHDDCEINGAARLSDCTI.LS...SPA...S..N...VYIGTGVICENSIISEGSSIINSVKMQDCFVGEACQISNGFTASSSVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGQF....SFYNAGS....ATNF.SNHAYKMGPMHYGILERGTKTASGAYVLMP.........A..NI..G..TFSVCF.GKLM.YHPDTRNLPFSYL.......I..A..........Y.......G..D..T.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDV.RP.S...G..S..Q..KSIVNFDWLSPFSVGEIVQGKKILE.....K..LL.DA.S..G..EN........VTS.....................................................................YTYH.NYV.I........NP....S....S...LN.......KG.....IKYY...D..IALRIYMG.AVLK..R.V.......VKS-....-.-...-.-...-....--.LGAVE....P.P..TTTV.G..Q.G.KWNDLSGLLLPESEE.MRLLDDIKDGEIE.T.IQDVLDRFEEINRN...YREYQWAWTYQL.ILDY..YH.......L-......-..T.E...I.TDADEARIRED.Y.VRARRA....WIAEIRKDAEKEYA.MGD...VEKHVL...D-----.---------.--.-..---------------------------dfidnldheidfen........................................................
A0A088F162_9SPHI/41-725              ..............................................................................................................................................YRKLTPEEIVILVQ.N.DNRA..DD..WGN.I...Q...V.........S...T.........S...F.I.....P.........N.........QIKHNNFFGL...VRI..GDMAP.IY..LE...YRN..L..KL.ESGIYNSTIV.SCDL...GN.H.....VAIHH..........V.....-R.......YMA..H..FI........IGNEVLLSNISEM.....E.........T.S........S..T..........AKFGNGILregev...........eqlriaLELCNEN.GI.RSILPFDGM................Q.AADAYLW..............T..R.N..R.Q..DHQ..L.QKRFKEIT.EK.RF.T........KTR.G..S.YS..V..IGDRCIIKNSQNIK.N..VKIGSDAYIKGINKLKNLTI.NS...SPE...A..Y...TQIGEGCELVNGIVGYGCRIFYGVKAVRFVLSSFSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAAMIm.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLLVkGDFP.YEMDIK-IPFSLV.......N..Nd........vK.......N..D..K.......L..T........II.PGYwf.....................myNM..Y..A..L.-.........-...I.RNANKYEVRDK.RL.L...K..N..Q..--YLEYDILAPDTVNELFNAIKMIE.....H..AV.GS.D..D..-N........AEIqlskeetihrgktkl.......................................thggdqvpsvvhmsgFEHS.KRK.V........EI....V....K...IQ.......EA.....YSLF...K..RFIKYYGT.IHLI..D.F.......LIKH....R.Y...E.-...-....-D.LRIKM....R.-..--DC.Q..R.K.DWENIGGQLIEKDAI.QHLLNGIKSGEID.H.WEDVHKNYHELSRG...YPETKLAHALAS.LLEI..TG.......ES......A..E.T...L.NVEVIKSWLIE.A.IEHKRW....MVKEIYGSRAKDYQ.NPF...R-----...--NMVYnSTEERDVVV.GS.L..EDNSFILQQRQELIDFEMSVGNL----isvl..................................................................
F5YQY5_TREPZ/43-738                  ..............................................................................................................................................WRKLTVQEIEILVK.N.DNFC..SN..WDN.F...L...V.........S...D.........P...F.D.....P.........S.........LIRNSNFYGL...IRL..GELRG.LL..LQ...HHD..F..CI.LAGIRNSTII.SCDI...GD.N.....TAIHD..........C.....-S.......YIS..H..YI........IGDRVILSRIDEM.....Q.........T.T........N..H..........AKFGNGTLkeget...........edvrvwIDVMNEA.GG.RSILPFRDM................I.CADAYLW..............A..C.Y..R.D..DTE..L.VEKLTAIT.QQ.NY.A........AKR.G..L.YG..I..VGSGSVLKSCAVIK.D..VDVGEAAYIKGANKLKNLTI.LS...SSK...E..S...SQIGEGVEMVNGIVGYGCHAFYGSKAVRFVMGRNSNLKYGARLIHSVLGDNSTVSCCELLNNLVFPIHEQHHNNSFLIASMIq.glSNMAAGAt..iGSNH.NSR----ANDGEIRAGRGFWPGLSVTLKHP.........S..RF..A..SFTLIAkGNYP.YELNIT-LPFSLV.......N..N..........Nv.....rR..D..R.......L..E........VM.PAYfw.....................myNL..Y..A..L.E.........-...-.RNSWKASDRDK.RV.V...K..V..Q..--HIETDYLAPDTAEEIIAALAQIE.....T..WM.SD.A..G..TP........ASGpalsvqfqdstdeed.......................................peyayipetgeeipaPGLE.RHK.R........RA....V....L...LKp.....rKA.....RSAY...L..EMLRFYAI.KALI..A.R.......LESS....P.G...L.S...F....EG.LVAEL....E.SpgSNTE.R..V.T.EWVNLGGQIVPAFRV.DKLRAQIREGKLD.S.WDAIHRAYDEFWDA...YPLDKARHAWGV.LRFL..QK.......GE......N..P.L...T.DAAAFCGELDR.V.LETQRW....ITDQVYRSRAKDFH.DPF...R-----...-SITYR.NREEMDQVA.GN.A..ENNFFIKLTRERLGQFEET--------vkvlkerv..............................................................
H8KQU0_SOLCM/41-723                  ..............................................................................................................................................YRQLRRDEIQLLQA.N.QNLS..DD..WNN.L...L...V.........T...D.........K...F.N.....P.........S.........FVRNCNFYGL...VRI..GDLEE.YF..LE...YHD..M..RY.PVGLYNSTIV.SCDL...GN.N.....VSLNN..........V.....-N.......YVS..H..YI........IGNESILFNVNEL.....Q.........V.S........N..Y..........SKFGNGILkkged...........envriwLEICNEN.GG.RKILPFDGM................L.TSDAFLW..............S..K.Y..R.D..DDE..L.MHKFVEIT.EN.QF.S........ATR.G..F.YG..T..IGEQCVIKNCQIIK.D..VIIGNGAYIKGANKLKNLTI.NS...SFE...S..R...TQIGEGVELVNGIIGFGCKIFYGVKAVRFSLGNNSSLKYGARLINSILGENSTISCCEVLNCLIYPGHEQHHNNSFLIAATVl.gqSNIAAGAt..iGSNH.NSR----ANDGEIVTGRG---------FWPglcvslkhnS..KF..A..SFTLLAkGSYP.AELNIS-LPFSLVs.....iN..E..........R.......E..D..L.......L..Q........II.PAYww.....................myNM..Y..A..L.A.........-...-.RNSWKYHARDA.RK.I...R..Y..Q..--EFEFDYLAPDTIEEIFEALSLLE.....N..WV.GA.D..R..SR........KKDlngqagagyeeigra......................................tllnsskklnqievlgGIVE.ANS.R........KT....V....I...LKp.....sEA.....YNSY...R..EMIHYFAI.KTVI..E.Y.......SRTH....K.L...A.N...L....NQ.IIARL....G.E..G---.Q..R.S.KWINLGGQLVSENDV.AELKSKIKDGSLD.N.WNKIHDHYNYLHRF...YEQRKAEYAFAV.LKDL..HL.......TR......T..A.V...D.IENKWNEWLDW.A.IEIAEK....VKDRTFDSRNKDYM.NEF...R-----...-KLPYD.NEKEMEMVL.GN.I..NDNEFIKTVQT----------------sylhfle...............................................................
A0A291QZY6_9BACT/42-731              ..............................................................................................................................................YRKLNAQEIETLVR.N.DNTS..DD..WNN.I...F...V.........A...D.........E...F.D.....P.........K.........LVQHCHFYGL...VRI..GKLEP.YY..LE...YRN..L..RL.PVGLYNSTIA.SCDF...GD.N.....IVIHN..........V.....-N.......FLS..H..YI........IGNEVILANINEM.....A.........T.T........D..Y..........AKFGNGIVkdged...........eklriwLELCNEN.GN.RSVMPFDGM................L.PGDAYLW..............T..R.H..R.D..DQQ..I.QQRFKEFT.EK.KF.D........KKR.G..Y.YG..I..VGDRSVIKHCNIIK.D..VAVGSDAYIKGANKLKNLTV.NS...SAQ...A..P...SQIGEGCELVNGIIGYGCRIFYGVKAVRFILASHSQLKYGARLINSFLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEVIAGRG---------FWPglsvslkhnS..IF..P..TFTLIAkGTYS.HEMNIP-FPFSLV.......IndE..........H.......E..N..S.......L..K........IM.AGYwf.....................tyNM..Y..A..L.A.........-...-.RNSWKYVDRDK.RN.D...K..M..P..--VIEYDYLAPDSVEELMESLPIMA.....S.aVG.KS.Y..L..LQ........QQLplegdfrktghdllm.......................................nqpeivaglevlldnIENS.HRK.V........KL....L....K...AH.......KI.....YRFY...H..DLIVLYGV.KNLV..A.H.......SEEL....G.L...S.N...W....QS.M---L....D.F..FADA.H..R.E.AWVNVGGLLMPRSRM.NKLTDNIKSGTID.S.WDSVHEAYKLIGSD...YKKEKLKHAWAS.MLEV..AG.......YN......L..P.D...I.DMKVLRQLFNR.A.IATQEI....IAHRIYHSREKDYK.NPF...R-----...-LMSYD.NVAEMEAVI.GK.L..DDNTFINETITALETFKHESTQLLSRI......................................................................
A0A2S9JIC3_9SPHI/41-725              ..............................................................................................................................................FRNLTTEEIKILVR.N.DNYS..NN..WNH.V...L...V.........T...D.........K...F.L.....P.........E.........QIQHSKFYGL...VRI..GDMED.VY..LD...FRD..L..RL.PCGIYNSTII.SSDF...GS.T.....VAVHN..........V.....-R.......YMA..H..FI........IGEEVMLANISEM.....E.........T.S........N..S..........AKFGNGILktddv...........eerrirLELCNEN.GG.RSVFPFDGM................Q.AGDVYLW..............S..R.H..R.N..DYE..L.QRRFQEMM.EA.QF.S........PHH.G..F.YS..E..IGHHSVVKNTHTIK.D..IKMGSHAYVKGVNKLKNLTI.NS...SAE...S..Y...TQIGEGCELVNGIIGYGCRIFYGVKAVRFILSSNSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVk.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYTLIVkGDFL.HELNVR-FPFCLV.......S..N..........E.......AdtN..R.......L..I........VL.PAYwf.....................lyNM..Y..A..M.M.........-...-.RNTSKFQSRDK.RK.F...K..N..Q..--YIEYDVLAPDTVNEMFDA---LL.....E..IE.KA.V..G..KT........YSNdrtsadpqalgkeil.......................................lsdqqltgkdilldnVEFS.RRK.V........VL....A....K...PK.......EA.....YVIY...G..RMIRYYAA.TQII..S.F.......LESK....P.L...A.D...L....QT.LISSF....-.-..--ST.S..R.S.AFENIGGQLVPKTKL.DTLLADIRDNKIL.S.WKDAHARYHAWSDV...YLEDKLQHAIAS.LAEL..SG.......VN......P..I.S...W.DKQYLKQLIEE.A.LDTRRW....IFDEIEGSRAKDYQ.NPF...K-----...-QMVYD.SYEEMEEVV.GR.L..EDNDFINKERKGLKVFECAVKKILEE-l.....................................................................
A0A6A3F5H9_9STRA/33-548              ............................................................................................................................................ff--PLSDAEIRALEA.N.GNSA..DD..WSN.V...R...K.........T...H.........EhepL.Q.....T.........P.........SIRQCSFHGR...VAL..GSFSA.SY.sHD...VDG..I..PF.RCGVYNSALS.NAVV...LD.D.....ALVKD..........T.....-L.......VLK..N..VL........VDARAAVIQCGSV.....T.........G.P........EqlD..........AVCGNGRE......................LHVGVET.GG.RDLRVVADM................P.FSLGAAV..............A..T.K..R.R..DVE..F.LETYDAFV.DK.YV.A........EIK.A..P.MA..I..VAQNARVRGCARVE.G..TFVGEHALVEDS-DVANSTI.LS...TAE...E..P...SVVRMKSIVRDSIVQWNSTVETLSVVEGAFLCDTSHVERHGVVMSSVIGPNTSVAEGEVTSSFVGPFVGF-HHQALLIASMWp..kGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVIA.TAVN.TLPQLVAMPFALI.......N..T..........P.......A..H.vI.......A..S........LS.PAInei..................spgwVL..S..S.sVfT.........V...L.RNEDKFRSRNK.SK.R...-..-..-..-THIEAAIFRPEIVQYMKDARSELA.....A..AE.GK.A..K..ISl......pNGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RQ.......AG.....IAAY...T..FFIKLYAV.EALL..L.L.......VESG....R.I...S.A...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------dgtvgtsd..............................................................
A0A0A0X0X4_9SPIO/42-728              ..............................................................................................................................................WRPLTFNEVETLIK.N.GNTC..TN..WNT.F...L...V.........E...D.........P...F.T.....P.........S.........LIKNSLFAGL...VRI..SSLTE.CY..LR...YHD..F..IV.PAGITNSKII.SCDI...GA.N.....CAVHD..........C.....-A.......YLA..H..YI........IGNTVILSRIDEM.....A.........A.T........D..H..........AKFGEGVIkdged...........eavrvtIDVMNEA.GG.REILPFADM................I.CADAFMW..............A..R.Y..R.D..DAK..L.MAQLKKLT.QD.SC.D........SAR.G..Y.YG..T..VGDNAVIKSCRIIK.D..VRFGEAVYIKGANKLKNLTI.RS...SAE...E..A...TQIGEGVELVNGIIGYGCRVFYGVKAVRFVLGNNCTLKYGARLIHSVMGDNSTISCCEVLNALIFPYHEQHHNNSFLIAAMIq.gqSNMAAAAt..vGSNH.NTR----GNDGEIIAGRGFWPGLSATLKHN.........C..RF..A..SFVLLNkGNYP.AELDIP-FPFSLV.......S..D..........Nl.....rE..D..C.......L..D........IM.PAYfw.....................myNM..Y..A..L.A.........-...-.RNNDKFKKRDK.RK.T...K..T..Q..--KIETEVLACDTAREIIYAMELLE.....H..IF.ET.A..W..TA........AGNqsesaqnllahk............................................rdelkklpltaenIEHS.DRP.V........KI....L....H...GV.......DA.....WYAY...R..DMLVWYGV.TVLA..K.Y.......IDETgaggE.V...F.S...R....SG.VCSRF....-.-..NLQN.G..T.I.PWVNAGGQLIREDEY.DRLRSRVGAGEFN.S.WHAIHAEYDRLWER...YPFDCAEHAYSV.LCRL..AG.......VS......-..-.A...L.TGSHWQTYLDE.A.LCLNRY....IEAQVLITKKKDYT.NHF...R-----...DIT-YR.NQAERDAVL.GH.V..EDNAFVQQSKLDAQRYAELFARVGER-l.....................................................................
A0A5B8VQK0_9BACT/42-732              ..............................................................................................................................................YRQLSAFEIEVLVR.N.RNTS..DN..WNN.I...L...V.........S...D.........H...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.YF..LG...FSD..L..KV.AVGLYDSTII.SSDI...GD.N.....SVINN..........V.....-H.......YLS..H..YI........IGQEVILTNINEI.....Q.........T.T........E..T..........CKFGNGIIkegeq...........esvriwLELCNEN.GG.RKILPFNGM................L.PGDAWLW..............S..K.Y..R.D..DEK..L.LERFKQLT.EA.EF.K........TAR.G..F.YG..K..IGDRTVIKNSNIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GQE...G..R...TQIGEGCELVNGSVGFGSRIFYGVKAVRFVTASHTQLKYGARLINSYMGSNATISCCEVLNSLIFPGHEQHHNNSFLCASTVm.gqSNIPAGAt..iGSNH.NSR----GADGEIVAGRG---------FWPalcvslkhnC..KF..A..SFTMLAkGDYN.YELNIP-LPFSLVs.....iH..P..........I.......T..N..S.......L..I........IM.PGYwf.....................myNM..Y..A..L.K.........-...-.RNAWKYKDRDQ.RK.E...K..V..Q..--NLEFDFLAPDTAGEIIETIQLLE.....K..YT.GQ.A..Y..FK........AEGakesdeasliekgkal....................................lndpdsnvesltilatgIENS.KRN.V........EI....I....K...VR.......RA.....YQCY...K..NMIRLYGY.QHLF..A.A.......ERLQ....E.A...K.N...L....KG.LLQGL....P.A..N--L.K..R.Q.TWLNVGGQLIPEKNV.ENLKDKVRNAKIQ.S.WDQLHAFYSDQGAK...YEQFKREDALAA.LGEA..LG.......YP......L..A.T...L.SKDQITSLAKD.Y.LDIQKW....MVDQIVVSRKKDYS.NPY...R-----...-KMMYE.NQQEMEAVV.GK.L..ADNSFIKDQKKALKKLTEQLSGLI---g.....................................................................
D7JFI7_9BACT/2-625                   ..............................................................................................................................................YRKLYSSEIKKLVA.Q.GCSA..DD..WQN.I...E...V.........V...D.........D...F.S.....T.........E.........RILRVRFSGQ...NRL..GKFDK.TF..TS...DSG..V..EL.YSGIFDATVH.NCII...NN.D.....VYLSN..........I.....-A.......IIA..N..YE........VGEGCFIRNVDNI.....A.........C.T........Q..G..........CSFGNGVM......................VAAVNEN.GG.RAIPIFEKL................S.AQLAYML..............T..Y.H..H.H..HQH..F.IQTVFATI.DD.YC.G........SLR.T.rQ.RG..T..IGKRAKITETSSVI.N..VRIGDMALIEGATRITNGTV.G-...---...E..R...SLVGSGVIARDFVAAADSRIDEAANVERCFVGEGCIVTKGFSAVDCLMFANGEFANGEAVSAFAAPYTVSHHRSSLIIACGL....SFANIGS....GTNM.SNHAYRLGAVHQSVIERGCKFGSNSYLLSP.........S..YI..G..DYTIIL.GSHK.NHPDTHEFPFSYL.......V..E..........D.......G..G..Q.......S..I........LI.PAV.........................NI..F..R..V.G.........T...L.RDIDKWQHRDR.RQ.S...N..S..T..LDIITYDMLNPFIIGKIEKAIDILE.....N..LR.ND.A..P..D-........AEY.....................................................................YEYK.NCK.I........HR....H....S...LR.......KG.....IGYY...R..DAIAVFLG.DFII..G.A.......ENSE....-.-...-.-...-....--.----H....S.T..KAQY.D..C.N.EWIDVAGLIAPKAEI.KNIIDN--PQLID.K.NNFGINIFRRIDND...YNKCLAVFVAEK.----..YG.......A-......-..-.-...-.--FDRQEILVR.Y.TSVLDT....IERRLIKEADTEFF.GDS...QTGYGL...DFEEE-.RANDFEAVR.GS.T..RNNRFIMQTSEMLRTKIEKAKQLCK--k.....................................................................
A0A1H4EDX9_9BACT/53-442              ..........................................................................................................................................gari--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........I.....RS.......RVA..N..YR........IGEASLVEGVTAL.....E.........C.R........R..R..........SAFGNGTG......................VATMNEC.GG.RTVKIFDAM................S.AQVAYIM..............A..V.Y..R.H..RRK..T.IAALEKMV.DE.YA.G........ERS.S..E.MG..E..VGRGCRIVGARFIR.E..VRIGNDVEIDGASILENATL.C-...---...D..G...VRIGVDVKAYDTIAAECAVIGNGSIVERCFVGESCRLDKGFTAAESLFFANSHCENGEAASIFAGPYTVSHHKSSLLIAGMF....SFFNAGS....GSNQ.SNHLFKSGAVHQAVHLRGCKFASSAYIMSP.........A..LE..G..AFTMVM.GHHS.YHHDTSAFPYSYL.......I..E..........K.......E..G..H.......S..H........LM.PGA.........................NL..T..S..F.G.........A...V.RDIEKWPSRDR.RT.V...C..R..-..-DIINFEEYNPYVAGAMLEAVNILH.....E..LE.ER.-..D..PD........AQV.....................................................................YTYN.KAI.I........RA....T....A...LR.......RG.....LKLY...N..KAIVAALG.AML-..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gkg...................................................................
R5VAS6_9BACT/7-661                   ..............................................................................................................................................YRNLSPKEILALQQ.Q.YCTS..DD..WNR.I...K...V.........A...E.........D...F.T.....P.........E.........HICHVRFSGD...IYL..GKFQD.SF..TL...AGG..L..VK.HSGLFHVTLH.NCCV...GN.N.....VLIEN..........I.....QN.......YIA..N..YE........IGDNSFIQNVNLI.....V.........T.E........G..K..........SSFGNGVL......................VSVLNET.GG.REVPIFNDL................S.AHLAYIV..............A..L.Y..R.H..YPI..L.TEKLVQFI.DR.YV.E........THS.S..E.KG..R..IGKNVSIVSAGSIR.N..VMIGDHCTIDGTSRLKNGSI.NS...NVL...A..P...IYVGYNVVAEDFIISSGSRITDGVTLMRCFIGQACHFSHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYILWP.........A..KI..G..AFSLIM.GRHV.NHPDTSDLPFSYL.......I..E..........K.......N..N..Q.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDALKWPKRDK.RT.D...P..H..Q..LDCINFNLLSPYSIQKMLTGMEVLN.....S..LR.QV.S..G..ET........SEE.....................................................................YAYQ.SAR.I........KN....S....S...LE.......KG.....LVLY...A..KAVNKFLG.NSLI..K.R.......LEKI....S.F...A.A...D....SE.IRARL....Q.P..NSEK.G..L.G.EWIDLAGLIAPQKEI.ENLIRQIETGEIT.S.VEQINKTFDTLHQQ...YYELEWNWAWQI.ICKW..YD.......VS......L..D.T...I.TSSDIIRIVNI.W.KEAVIS....LDEMLYADAHKEFS.LTA...QTGFGI...DGNSRQ.KQKDFEQVR.GG.F..ENNPFVENVRRHISDKRALGDELIARM......................................................................
A0A2P8HKN5_9BACT/41-731              ..............................................................................................................................................YRRLTAYEVEALVR.N.DNTS..DD..WNI.I...F...V.........S...N.........E...F.N.....P.........Q.........LVQHCHFFGM...VRI..GKLEP.YY..LE...FHN..L..RM.PVGLYNSTIC.ACDF...GD.N.....VVVHN..........V.....-N.......YLS..H..YI........LGNEVIVANVNEM.....A.........T.T........D..Y..........AKFGNGILkdgea...........eagrihMELCNEN.GG.RSVMPFDGM................L.PGDAYLW..............T..R.Y..R.D..DDQ..L.QQQFKVFT.EK.QF.D........KRR.G..Y.YG..M..VGDRSVIKNCKMIK.D..VTIGTDAYLKGANKLKNLTI.NS...SSD...A..S...SQIGEGCEMVNGIVGYGCRVFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..KF..A..SFTLISkGNYM.SELNIN-IPFSLVl.....nD..E..........H.......D..N..R.......L..K........IM.PGYwf.....................mhNM..Y..A..I.A.........-...-.RNSWKYVDRDK.RT.D...K..V..Q..--LIEYDYLAPDSVEEMFQALAVME.....L..ATgKA.W..Y..AI........AENapkkeltekdirkkgke..................................lllnnpeevaaltilatgM---.---.-........EN....S....S...RE.......VQ.....LLKV...Q..KAYPLFRE.LIVL..Y.G.......IKNI....I.A...A.N...K....PS.YLALQ....A.A..VKTA.K..R.T.DWLNIGGQLMKAETV.ATLKTKIKKNKIS.G.WPQLHDAYQEIGKE...YAADKLQHAVAS.LLEI..KD.......LA......I..K.N...L.TTAHLAQWLTD.S.IETMEW....ITSNIRRSREKDYK.NPF...R-----...-QLAYE.NEKEMNAVI.GS.L..EDNSFINQTINDLEEYKTRVRQIIN--ew....................................................................
A0A2U2BB35_9BACT/4-658               ..............................................................................................................................................FRALTTEETEKLEE.Q.GCMC..ND..WSK.V...H...V.........K...D.........G...F.E.....T.........K.........HVRHSTFSGE...VRI..GCFSK.EF..DF...PGG..V..KK.HSGISFATIH.NSSI...GD.N.....VYISQ..........V.....RN.......QIA..N..YH........IEDEVIIENVDSL.....T.........T.E........G..E..........SCFGNGEK......................IAVLNEA.GG.REVPIFNEL................S.AHTAYLM..............A..F.Y..R.H..RPK..L.IEKLYSLV.DE.YC.S........NVC.S..T.AG..S..IKKGAKLINSRTLL.N..VNIGPSAKVEGIYRLVNGTI.NS...SPD...H..P...TYFGPGVIAEDFIAASGAEVTDATLISKCFIGQGCVLGKHYSAENSAFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYY....SFLNAGS....GSNQ.SNHMYKLGPVHQGVVERGSKTTSDSYLLWP.........A..KI..G..PFSLVM.GRHY.RNPDTSCFPFSYL.......I..E..........N.......K..D..E.......S..Y........LA.PGV.........................NL..R..S..I.G.........T...I.RDARKWPNRDK.RK.D...P..K..K..LDYITFNLLSPYSVEKIISGKHTLL.....K..LK.ET.S..G..AT........SEY.....................................................................FMYN.SVK.I........EA....N....A...LE.......RG.....IRLY...E..TGISKFLG.NGLL..K.I.......LESK....E.Y...D.S...I....EE.LRKAL....K.P..SSDE.G..T.G.QWIDMAGMIVPKEKV.LELVEDVEKGKIN.T.LREIDNIFQSWQNS...YYQWVWNWSVKV.FKDE..LD.......ID......I..N.S...I.TRGELLDFISR.W.EHAVLS....LDQMMFEDARKEFT.LKA...QTGFGM...DGEDEI.RNTDFEQVR.GA.F..EKHPAVCDILEHSQKKKELAAKVSEKL......................................................................
A0A521BLI5_9SPHI/41-724              ..............................................................................................................................................YRQLKPNEIQLLIA.N.HNLS..DN..WKN.V...M...V.........T...D.........T...F.N.....P.........S.........FVRNCNFYGL...VRI..GDLEE.FF..LE...YHD..M..RF.PVGLYNSTIV.SCDL...GN.N.....VSLNN..........V.....-N.......YIS..H..YI........VGNESILFNISEL.....Q.........V.S........N..H..........AKFGNGILikgea...........eslriwMEVSNEN.GG.RRILPFDGM................L.TSDAFLW..............S..K.Y..R.N..DAE..L.MERFVELT.ES.KF.Q........RQR.G..I.YG..T..IGEQCVLKNCQIIK.D..VKIGDAAYIKGANKLKNLTI.NS...NFE...S..P...TQIGEGVELVNGIIGYGCKIFYGVKAVRFSLGNNSSLKYGARLINSILGENSTISCCEVLNCLIYPGHEQHHNNSFLIAATIf.gqSNIAAGAt..iGSNH.NSR----ANDGEIVAGRG---------FWPglcvslkhnS..KF..A..AFTLLAkGSYP.AELNIS-LPFSLVs.....iN..E..........R.......D..D..V.......L..Q........II.PAYww.....................myNM..Y..A..L.A.........-...-.RNSWKYSVRDT.RV.I...R..Y..Q..--EYEYDYLAPDTVEEIFEALHMLE.....K.wIL.DD.Q..L..RK........NEIesaanngnktgke..........................................illnkkikqieilgGVIE.ASS.R........KS....I....I...LKp.....sAA.....YESY...H..EMIHYFAM.KTII..D.H.......AKTH....K.L...A.D...L....QQ.IYSRL....H.H..---G.K..R.S.KWINIGGQIITENHI.QELKNNIKSGLIK.N.WDQVHEYYQYQRRF...YEQQKAEYAFAA.LLDL..HN.......IV......N..F.D...G.LSIHWNQLIER.S.VEIAKK....IRSRTFDSRNKDYM.NEF...R-----...-KLPYD.NQEEMEAVL.GK.I..NDNEFIKTIESDYEK------------fvvgvek...............................................................
F4LPZ4_TREBD/25-710                  .............................................................................................................................................t-RRLTDDEIRRLER.N.GNRA..ANgsWNG.V...F...V.........KtapD.........R...F.D.....P.........D.........LIRGTEFRGT...VVI..GNLQA.AS..LK...YHD..L..EL.DCGIYNSYIE.NCVI...GN.D.....SCIRN..........V.....-K.......YLV..N..YR........IGDRVILFNIEEM.....S.........C.T........R..H..........SKFGNGILkeged...........esvrvrIGVSNEN.DE.RSVLPFESM................L.PADAFIW..............S..R.Y..R.E..DTA..L.MNRFVELT.EY.GN.D........KKR.R..T.YG..I..VCDDAVVKNTVLIK.D..AKIGSFAYIKGAFKLKNITV.CS...SEA...E..P...SQIGEGVEMVNGIMGYGSKVFYQAVAVRFVIGRNCQLKYGARLLNSVLGDNSTVSCCELLNNLIFPFHEQHHNTSFLIATTVl.gqSNIAAGAt..iGSNH.NSR----SPDGEIYAGRGFWPGLCSDFKHN.........S..KF..A..SFTLVSkGSYQ.NELNIT-YPFSLV......sI..D..........S.......T..E..R......aV..H........II.PAYwf.....................lyNM..F..A..I.A.........-...-.RNNSKFRKRDK.RA.V...K..A..Q..--HIETDPLAPDTMQEVLAALDRLI.....K..LT.GR.T..L..HA........LDYqsakdflhqn.................................................pdsdivledpG--A.QKR.F........GA....R....I...LKp.....aQG.....YREY...R..KVVKYFAV.RSLM..E.Y.......CAAR....G.-...-.S...D....FL.CETML....A.E..IGAVpL..Y.T.EWVNAGGQVLPQERL.NELFALVKDARIK.T.WDEVHAFYDACQES...YLSYKARYALYL.LERL..YS.......RP......V..G.E...F.SAEIYADIRGD.V.TVVSND....MYESSIASRQKDYT.DFF...R-----...-AMTYR.NEAEMTAVL.GT.V..EGNDFLQQLESDTA-------------afnrklsvffdri.........................................................
C5LN64_PERM5/45-565                  .............................................................................................................................................l-RPLTVDEIAALQG.S.GCTA..ED..WGE.I...M...V.........I...G.........Ds.pL.A.....V.........G.........RIRGCTFQGR...IEL..AVEEG.SK..VS...IGDsrR..QL.PCGIINSFLE.DVVV...ES.G.....TLVKD..........C.....-G.......LVA..N..TV........VRRGAVLVRCSVVe...gS.........T.E........P..H..........CKYGNGHS......................MSLAEET.GS.RHTRQFAEL................T.IEIAAKV..............V..S.N..R.K..ESD..AyHAAVDAYV.DA.VE.D........AGQ.G..-.RT..I..IDENAEVISCCSIK.G..SYIGRHVRVVN-SRVHNSSL.--...---...L..E...LNIVEDCSLNTAILQKSASVATFGVVEGSVLCPTVHVERHGKVFDSIIGPGSGVAEGEVTASLVGPFVGF-HHQALLIACFWp..aGRGNVGH....GANVgSNHTG-KAPDQENWPGEGTFFGLASNIKYP.........F..HLvdA..PYSLIA.TGVS.CLPQAIGLPFSLV.......N..E..........S.......S..E..Y.......I..N.......gLS.PAIneitp..............gwmlsdNM..Y..S..L.F.........-...-.RNEAKFESRQR.NL.P...K..D..G..-VMYQFSVFRPEIMDRVVKARDALK.....A..AD.PK.D..A..KL........KDAkgrav..........................................................ftdkeiPIMG.KNW.M........ND....S....T...RL.......IA.....IKTY...S..TFLQWYAI.RGLW..R.R.......LASI....H.F...E.S...G....H-.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------acsdeaaklvss..........................................................
A0A1F0FX82_9PORP/1-661               .............................................................................................................................................m-RTLTRSEVAVLEK.N.NCRS..EQ..WGL.V...K...V.........A...E.........T...F.D.....P.........E.........SCRDVQFSGS...CQI..GDLSG.SR..VN...EYG..I..AV.QNGIRSASIN.ECKI...GN.G.....VCIDH..........V.....HD.......VIS..R..YD........IGDNVTISNVNVV.....A.........M.K........G..C..........STFGIGVR......................ASVLNET.GG.MEVPISRDL................T.AQTAYMF..............T..L.I.gR.Q..DGA..L.RGSLIDLV.DQ.EA.R........EAE.S..E.RG..I..IEESVSIRNCGSIV.N..AYIGAHAKVEGATFLENCSL.CS...SAE...H..P...IEIGYNVMGRDFVASLGAKIGGSSIIERCFIGQSCHIDHLFSAHDSLIFANCNLENGEACAIFAGPFTVSSHKSSLLIAGHF....SFLNAGS....GSNQ.SNHLYKLGPIHQGVVERGSKTSSDSYILWP.........S..RI..G..AFTLIM.GRHV.HNVDTTDFPFSYL.......L..E..........D.......D..N..R.......S..Y........LV.PGR.........................NL..L..S..V.G.........T...M.RDAKKWPARDK.RP.E...T..I..R..PDCINYNLLSPFTIGKMERAYNKLL.....S..LK.KF.L..G..GH........EHV.....................................................................YVYY.NLF.I........KP....S....S...LE.......KG.....LEIY...K..WGIEKFIG.NSLI..Q.R.......IQNKfgneA.I...T.S...E....QK.LLEVL....M.P..DHSF.G..K.G.EWIDASGMIAPLGCI.QEIMGEIRGKQLK.S.LPEINHRIRGLHKM...YYEYEWDWSFDL.LCRW..YD.......IN......E.gH.P...L.TIELIRSILKD.W.IDAVLA....IDDALLNDAHKEYN.IIG...RVNFGV...KNSDMQ.TTTYTEQIE.AE.Y..AENPIVLSVLEHISRKKELYATTLEQL......................................................................
A0A1T4KX03_9PORP/1-631               .............................................................................................................................................m-RNLKNIEIEQMKA.L.GCSA..ED..WSL.I...T...V.........D...D.........D...F.Y.....P.........A.........SYHHVTLKGK...CHL..GTCRG.VY..RS...QAY..A..PR.TLGVSHVVLE.ECTL...GR.D.....VLIEY..........V.....DG.......SIR..G..YK........IGDNVTIAHIASL.....K.........A.D........P..R..........ASFGIGFP......................ISVLDET.GG.RRVSISSSL................S.AQLAYII..............A..F.A..K.H..DAV..L.QERIDTLI.RE.EA.E........NVA.Q..Q.GA..Y..IGAGTTLLYGGIYH.N..VCIGKNTYIEGNVSLKDGII.G-...---...D..S...VHIEGNSIGNTFWIGRDSQLQ-GSTLLHTFVGEGCHISGGFYAHDSLIFANSTLANGEAAAAFLAPYTVSMHKSTLLIGGLF....SFFNAGS....GTNQ.SNHHYRLGAMHYGVLERGVKFASDAYILWP.........A..HI..G..AFSKIM.GRIY.ALPNTSDFPFSEV.......R..G..........E.......G..N..K.......A..H........LY.PAL.........................TL..V..Q..V.G.........T...W.RDLFKWPKRER.RN.KdfsE..E..W..LDNIDFRWEQPFLVESCFRGWSALA.....H..--.--.-..H..TP........EEM.....................................................................FNLY.RVT.V........TA....G....D...MA.......TG.....KELY...R..RLLTIILA.LSL-..-.-.......-QD-....-.-...-.-...-....--.--TTL....S.E..SSSI.T..E.K.RYLDLAGVSVAFSDY.NAWVEQEKNSPST.T.IRELKKRLDTISKG...SDRQDTLLLSTI.LSAL..YP.......-E......Y..S.T...L.PESAWKFLLKEqA.LKDALH....IEKLVLKEATRELM.PQR...AMNFGF...LAEEKGgFEADFRAVR.GA.I..EAHSSIRELKDYFA-------------tlrnrlssl.............................................................
A0A553GSC1_9BACT/4-658               ..............................................................................................................................................YRSLSTEEIGLLEA.R.NCYC..SD..WSL.V...S...V.........I...D.........G...F.R.....I.........E.........SLRNVTFSGS...IKI..GQFNR.SF..TF...PGG..V..EK.KAGISNATLH.NCII...ES.D.....AYINQ..........V.....KN.......HIA..N..YH........IHSNVVIENVDSI.....I.........T.E........K..Q..........SCFGNGVP......................VSALNEA.GG.REIYIYNDL................S.AHTAYIM..............A..M.Y..R.H..EPA..V.IQQLQKMI.ND.YK.A........KIC.S..S.MG..T..IQEGAQLINCRTII.D..INIGKFAKVEGIYRLTNGTI.NS...SAE...A..P...SYFGPGVIAEEFIAASGSKVSDSALLSKCFVGQGCELGKHYSAENSVFFANSQGFHGEACSVFAGPYTVTHHKSTLLIAGYF....SFMNAGS....GSNQ.SNHMYKLGPIHQGVVERGSKTTSDSYLLWP.........A..HI..G..AFSLVM.GRHY.RNPDTSQLPFSYL.......I..E..........N.......K..D..E.......S..I........LA.PGV.........................NL..R..S..V.G.........T...I.RDARKWPKRDK.RT.D...T..K..L..LDYINFNLLSPFTIQKMINGKKVLK.....A..LR.KS.S..G..AT........SDY.....................................................................YMYN.SVK.I........ES....G....A...LV.......RG.....IQLY...N..TGIIKFLG.NALI..K.K.......LEDV....I.F...E.S...L....SE.LRQSL....S.K..TSEC.G..I.G.EWIDMAGMLVPKERV.KTLLDDLQNGSVS.N.LEELNGRYALLHDN...YFDYAWTWCLKV.FKEE..YD.......LD......F..Q.T...A.EIDQILSFVDD.W.KKSVID....LDNMVYADAHKEFT.LNT...QTGFGI...DGTEET.RIQDFEQVR.GE.F..EKHPSVQDISNHIRVKSRLAEELKERL......................................................................
A0A4U2LEA9_9BACT/11-665              ..............................................................................................................................................FRKLTNEDIGQLVM.Q.GCSS..ED..WTL.I...E...V.........T...D.........D...F.I.....P.........D.........RIRNSNFSGH...VRL..GKFDE.TI..TL...FGG..I..RF.ETGIYNARLH.NCNI...GD.N.....VLIYN..........V.....NS.......YIA..N..YN........IAPRAVIHNINQL.....A.........V.E........G..K..........CAFGNGTR......................VQTINEG.GG.REIPIYDHL................S.AHMAYIL..............S..L.Y..R.H..RVK..V.IEKLESLV.QN.YV.S........YIT.D..T.KG..Y..IGYGAHIINCENIR.N..VKIGPHASLEGVCKLQNGSI.NS...TKE...D..P...ISIGHDVIMDDFIISSGSKVMDATLVSHCFIGQGCILDKHYSAENSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGLF....SFLNAGS....GSNQ.SNHLYKLGPLHQGILERGAKTTSNSYILWP.........S..RV..G..AFSLVM.GRHY.KHSDTSDFPFSYL.......I..E..........S.......K..D..E.......S..I........LA.PAV.........................NL..K..S..I.G.........T...I.RDTQKWPKRDN.RK.D...P..N..K..LDHINFNLLSPYTVQKMLNGIKLLN.....D..IE.SA.S..G..KS........AEE.....................................................................YSYQ.GLK.I........KR....S....A...LK.......KG.....IELY...K..MAIWKFLG.NSLI..T.R.......LQNK....N.P...N.S...N....ER.IREIL....K.P..DTPI.G..T.G.QWIDLSGLICPAKAL.KQLLNAIEESSIQ.S.LEEADAVLKSIHDN...YYNYEWTWASNV.FTEF..YG.......KS......I..E.E...F.TVEDVIIITEN.W.KKSVLE....IDRLLYADAQKEFS.MLK...RTGFGV...DGGEEV.KELDFEVVR.GE.F..ETNDTVKAIKEHMTKKENLGNDVIARM......................................................................
A0A5R9QMU6_9BACT/3-653               ..............................................................................................................................................YRNLTKQEITELKK.Q.NCRS.iNG..WEN.V...F...V.........S...H.........Y...F.I.....S.........Q.........NIISVTFSGK...NYI..GVLSD.II..EL...PQG..S..KD.MSGIYNTHIH.NCHI...GN.Q.....VYIKN..........I.....GS.......SIS..N..YT........IEENVIIQNVGSI.....C.........V.N........T..E..........SSFGNGTV......................VCPVNEG.EG.RDVIIFNKL................S.AHTAYLM..............T..F.Y..R.D..NIQ..L.IEKLKEVA.LH.ES.S........KIK.S..T.QG..F..IKKGTKVINCGTIN.E..VNIGEYATIEGTAYLENGSI.NS...SKD...S..P...AYIGHQVNAAHFIVSSGSLVSDGANLRHCFVGQGCEISKNYTAENSLFFANSQCLQGEACSIFAGPYTVTHHKSTLLIAGYY....SFFNAGS....GTNQ.SNHMYKLGPLHQGVMERGNKTGSDSYILWP.........A..KI..G..AFTMVL.GRHY.NNPDTSDLPFSYL.......L..E..........D.......G..G..K.......S..V........LM.PAQ.........................NI..F..N..V.G.........T...T.RDVEKWPKRDK.RQ.G...S..N..H..LDCIITDALTPYTINKIIKGIEVLK.....E..LQ.QK.A..N..PE........RKT.....................................................................LMYK.STQ.L........SL....T....S...IN.......RG.....IKLY...E..QALVKYVG.DELI..K.L.......LKQS....N.F...D.S...M....IK.NFNSL....-.-..--TK.E..N.D.AWLDLSGLICQKNKL.DEFIEYIINNKVD.N.Y-NFNNFFQEQYVN...YDFLKSQHCMQI.LETY..FN.......ID......I..K.N...H.SKTELINFIQE.W.INNNDK....IKASIIMDAKKEFN.QKS...KIGFGI...DGNETT.GLKDFEAVR.GS.V..ETNEYIQKIEAEFKEKNKNAELIINT-l.....................................................................
R5VUQ7_9BACE/5-659                   ..............................................................................................................................................YRLLTKEEIARLEA.Q.HCIA..SD..WSG.V...E...V.........A...D.........D...F.H.....T.........D.........YIHHTRFSGK...VRL..GVFEK.EF..TL...AGG..M..AK.HSGVYYATLH.NVTV...GD.N.....CYIEN..........V.....KN.......YIA..N..YE........IGHDTFIENVDII.....L.........V.D........C..H..........SRFGNGVE......................VSVLNET.GG.REVIIHDRL................S.AHQAYIM..............A..L.Y..R.H..RPV..L.IDKMRKII.ES.YA.D........AHA.S..D.TG..T..IGSHVMIVNAGYIK.N..VRIGDYCQIEGTGRLKNGSI.NS...NEH...A..P...VHIGYGVICDDFIISSGSHVEDGTMLTRCFVGQACHLGHTYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF....SFMNAGS....GSNQ.SNHMYKLGPIHQGALERGAKTTSDSYILWP.........A..RI..G..AFSLVM.GRHV.THPDTSNLPFSYL.......I..E..........E.......K..N..T.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDQ.RK.D...P..N..R..LDQINYNLLSPYTIQKMMAGRQILK.....E..LA.RV.S..G..ET........SEI.....................................................................YSYQ.SAK.I........KN....S....A...LN.......KG.....IKFY...E..TAIHKFLG.NSVI..K.R.......LEAI....R.F...A.S...D....EE.IRARL....V.P..DTPI.G..T.G.EWVDISGLIAPKSEI.ERLMEDIECDRLS.S.VDEIHDRFAEMHAN...YYTYEWTWAYEK.MLDF..YG.......LQ......T..D.K...I.TAADIAAIVRQ.W.QEAVVG....LDKMVYEDAKKEFS.LTS...MTGFGA...DGSSEE.KMRDFEEVR.GV.F..ESNPFVTAVLEHIKVKTELGNELIERV......................................................................
A0A1E7FR13_9STRA/183-531             ..................................................................................................................................crvyrnsfisrt--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................-------.--.---------................-.-------..............-..-.-..-.-..---..-.--------.--.--.-........---.-..-.--..Y..IGSKTVLMNCGHIStNgdININSNRNCFGRLEISVG-A.ES...GGG...R..P...LVLTAESTMIN-VTQQLATITDNSKINNVLMMEHSHCGPSSIMESTVMGPDSHASAGEVHASIIGPQTNAHHQ-SLLIGVLWplgrGNVAYGAn..vGSNH.TGR----LPDQECTVGEGIFWGLNCIVKFPi.......dL..TL..S..PYSMIAaGTKL.SPQRIG-MPFSLI.......V..EssvhcpaqqqK.......Q..Q..W.......N..D........II.PGW.........................VI..QhsP..Y.T.........L...I.RNDKKYITRRK.A-.-...S..R..H..AFYTGWNILRPSTIERCRVARSILQ.....S..SI.EH.S..I..PL........QDV.....................................................................SGIG.ECR.L........TL....R....A...RD.......VG.....IKAY...E..DCIHLYAL.QGLM..S.W.......LDKT....C.S...K.K...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------htrtnndemssf..........................................................
A0A3R6INC7_9BACT/7-661               .............................................................................................................................................l-RKLRPQEIAALEA.N.GCSA..EN..WDN.I...W...V.........V...S.........A...F.R.....G.........E.........YVVNVRFSGL...IVL..GLFKK.EF..TF...PGG..V..KK.HSGIRNATLH.NCQV...GN.N.....TLIED..........V.....HN.......YIA..N..YV........IGDECIIQNVNVM.....I.........V.E........G..E..........ASFGNNVL......................VSVLNET.GG.REVPIYGGL................S.ASLAYLI..............A..L.Y..R.H..RPE..L.IDRLQSLI.AK.YA.E........DVS.L..E.YG..I..VGDYVKITNVGTLR.S..VWIGDYATIENCTRLANGTI.RS...NEK...A..P...TYIGDSVIAEDFIISSGAVVADAAKIIRCFIGQACHVTHNFSAHDSLLFSNCTFENGEACAIFAGPFTVSMHKSSLLIAGMY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGSKTTSDSYILWP.........A..RV..G..AFSLVM.GRHH.HHSDTSDMPFSYL.......I..E..........K.......D..D..E.......T..Y........LV.PGV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RT.D...P..E..R..LDMINYNLLSPYTIYKMMKAVGILK.....N..LQ.EL.V..G..ET........SEV.....................................................................YYYQ.NTR.I........KG....S....S...LR.......TA.....LELY...G..MAINKFLG.NSLI..K.R.......LEGT....V.F...Q.S...M....NE.VWAQL....K.P..TSAE.G..R.G.EWLDLSGLILPREEL.DKLIQKIENGDIH.S.LDEIERFFATMHSR...YYDMEWTWAYDK.LEEY..YG.......IS......L..S.S...I.SAEQIIELVRR.W.QDSVIG....LDNLLYKDAKKEFS.LTS...MTGFGV...DGSDKE.KQEDFEGVR.GA.F..ESNPFVTAVKEHIIVKRALGDELIDRM......................................................................
W4G6L3_9STRA/41-499                  ...........................................................................................................................................spv----TPAQIQLLEQ.H.GNRA..DS..WDT.V...Y...T.........S...G.........S...L.A.....T........lI.........RVRNCTFRGR...VHL..GSFTK.DV..MV...-DN..V..PF.PSGCYNTTIV.DSFV...LD.D.....ALVQD..........T.....-F.......LLH..R..TY........VSHGAVVVGCGTI.....T.........C.S........G..T.........dVTNGNGTV......................LKVGVEI.GG.REIAMFADM................P.FHLAAVV..............G..E.T..R.G..NVS..E.LKAYEDLV.RT.YT.K........KVQ.C..DgFN..V..IAHQAKLLRCPKIR.D..VFVGDAAVLEDS-VVSNSTI.LS...SPA...E..V...SSILGFSQVHSSILQWNAHVHSGSSVERSFLCDCSRVERHGVVMDSLLGPNTAIAEGECTSTFLGPFVGFHH-QAMIVAAFWp..rGRGNVGY....GANVgSNHTLK-APDQELWPGEGVFFGLSVSIKYP.........S..NFtnA..AYSVIA.TGVS.TLPQKLDMPFALI......nT..P..........G.......H..N..I.......P..D........LS.PAInei..................ypgwVL.sH..S..IfT.........V...L.RNQDKFDKRNK.SK.R...T..N..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------vdspifrsdiimmmqvacqrlvdaekkpvnlrhgkqiiytdkq...........................
F9ZCM7_ODOSD/3-657                   .............................................................................................................................................s-RNLTQEEITRLQA.Q.GCSS..TD..WQR.V...K...V.........A...S.........G...F.K.....T.........D.........YIQNVRFSGD...IEL..GIFDY.EF..IL...EGG..L..PR.HAGLFNVTLH.NCRV...GN.N.....VLIEN..........I.....PN.......YIA..N..YR........IGENCFIQNANLI.....V.........T.E........G..R..........SSFGNGTL......................VAVLNET.GG.REVPIFNEL................S.AHLAYII..............A..L.Y..R.H..FPV..L.TERLKALI.ER.YT.E........QVS.S..T.EG..K..IGNHVRIINTGTIR.N..VCIGDYTTIEGTSRLKNGSI.NS...NAE...A..P...VFIGHNVMAEDFIFSSGTCINDGAALVRCFIGQACHLGHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF....SFLNAGS....GSNQ.SNHLYKLGPIHQGIVERGSKTTSDSYILWP.........A..KI..G..AFSLIM.GRHV.SHPDTSDLPFSYL.......I..E..........Q.......N..N..Q.......T..Y........LV.PAV.........................NL..R..S..V.G.........T...I.RDAQKWPKRDK.RK.D...S..H..Q..LDYINFNLLSPYTIQKMLSGIEVLR.....T..LQ.QV.S..G..ET........SEE.....................................................................YSYQ.SAH.I........KS....N....S...LK.......KG.....IQYY...S..MAINKFLG.NSII..K.R.......LENL....T.F...H.N...N....EE.IRQRL....A.P..TRTE.G..S.G.EWVDLSGLIVPQQGI.IRLIRRIENGEIE.S.VGQITDTFRQLHAD...YYQLEWTWAWEV.MQPW..YR.......VT......P..E.S...I.TAGDVIRIVNT.W.KEAVVN....LDKMLYEDAKKEFS.MTA...QTGFGA...DGNQKQ.KKIDFEQVR.GA.F..ENNPFVETVQEHIKAKTALGDELIERL......................................................................
A0A0L0F4U8_9EUKA/1-205               ..............................................................................................................................................--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........----------...---..-----.--..--...---..-..--.----------.----...--.-.....-----..........-.....--.......---..-..--........-------------.....-.........-.-........-..-..........--------......................------T.GG.RETRTYAEI................T.VAVAAGV..............A..S.N..R.H..DTE..A.LERYNKAV.DE.YC.V........LAE.S..N.IT..I..FADGCRVSSTPKII.N..TYVGHGAVIDGATWIENTTL.LS...EPD...E..H...CTVSAGAVVKHSILQWGSEVDTFGLSQNSVLCEHSHVERHGMLSDSLLGPNSGVAEGEITASLCGPFVGFHH-QSLLIAAFWp..eGKGNVGY....GANVgSNHTSKVGRCMHIVM---------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------nat...................................................................
A0A099BV64_9BACT/1-597               .............................................................................................................................................m-RQLTDKEIITLEE.N.NCWA..ED..WTA.I...Q...V.........A...E.........D...F.M.....P.........N.........YLHRVMFYGD...IEL..GEFTK.NV..EV...SRG..F..MK.HSGINNATLR.NVSI...GD.N.....CLIEN..........I.....GT.......YIN..N..YT........IGDDCYIGNVAMM.....E.........T.A........E..G..........ATYGEGNP......................VSVLNES.GE.GNLLLFHNL................S.SQLAALM..............V..L.H..A.E..DKL..L.RDALRRLI.HE.DI.E........RRM.P..D.RG..I..IGNNVKIVNTKEIT.N..TIIHDDCEISGAERLCDCTI.IS...SPN...A..S...VFIGTAVICENSIICDGSSITNGVKIQDCFVGEACQLNNGFTATSSVFFANSNMSKGEVCSAFCGPFSTNHHQNSLLLSGMF....SFYNAGS....ATNF.SNDCGKLGAIHHGILERGCTTESGCQLVMP.........V..HI..G..AFSTCS.GVLT.HHPDTLSMPFSQL.......K..A..........V.......G..D..T.......V..Y........LK.PGY.........................TL..C..T..A.G.........L...Y.RDIHKWVKRDV.RV.H...A..I..Q..RSIVDFDWLNPVTIGSIVEGKEILE.....R..LR.EA.S..G..EH........APT.....................................................................YYYH.EHA.I........SA....A....D...LK.......QG.....IQNY...D..MALHIYMG.AVLK..Q.R.......IEQN....E.A...E.-...-....--.-----....Q.P..YAQT.G..C.G.QWSDLAGMLLPKSEE.RMLINDIKHGDIE.T.VQDIIDRLVDIHES...YREYEWAWTYRL.ILNY..YH.......L-......-..T.E...L.TDDATEQIMQD.G.IAARHM....WADQIRKNAEQELT.S--...------...------.---------.--.-..---------------------------sdveks................................................................
A0A4R4BR74_9SPIO/43-497              ..............................................................................................................................................WRGLEASEIEILVK.N.NNYC..SN..WDN.L...L...V.........S...D.........P...F.D.....A.........R.........LIRDSQFYGL...VRL..GKLER.LL..IQ...HHD..F..RI.PTGIRNSTII.SCDI...GD.N.....CAIQD..........V.....-R.......YLS..H..YI........IGDTVILSRIDEM.....Q.........C.T........N..H..........AKFGNGILtdgee...........esvriwIDVMNEA.GG.RSILPFEDL................I.PADAYLW..............A..S.Y..R.D..DAR..L.VQRLAEIT.QA.QY.G........APR.G..R.YG..M..VGPATVIKSCRIIK.D..VYIGSCAYIKGANKLKNLSI.LS...SEA...E..P...SQIGEGVELVNGIVGYGCRVFYGCKAVRFVMGRNSALKYGARLIHSVLGDNSTVSCCEILNNLIFPFHEQHHNNSFLIASLVq.gqSNIAAGAt..iGSNH.NSR----ANDGELRAGRGFWPGLCVSLKHP.........S..RF..A..SFIIIAkGSYP.YELHIP-LPFSLV.......N..N..........Nv.....fR..D..E.......L..E........VM.PAYyw.....................myNL..Y..A..L.E.........-...-.RNSWKFRMRDK.RV.T...P..V..Q..--RIETEYLAPDTASEILNAMELLE.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------lwvgrayraaqg..........................................................
M4BIJ5_HYAAE/41-561                  ............................................................................................................................................ff--PLTDAEIRALEA.N.GNSA..ED..WKK.V...R...K.........T...Tk......naS...L.Q.....T.........S.........RIRQCAFYGK...VVL..GSFSS.AV.tHN...VDG..V..PF.PCGVYNSVLS.HVVV...LD.D.....ALVKD..........T.....-L.......VLR..N..VL........VDARASVIKCGSV.....TgpdaekgaaA.G........S..K..........EAAANGML......................LHVGNET.GG.RCFRVVADL................PfALGAALA..............T..N.M..R.T..NAA..F.LTTYEAFV.DE.YV.S........KVQ.A..P.MA..I..VAPRARVWGCFRVQ.E..TFVGHSAVVEDCNV-VNSTI.LS...TAE...E..P...SIVRSKSSVHGSIIQWHSIVQMLSVVEGSFLCDTSRVERHGVVMSSVIGPNTSIAAGEVTSSFVGPFVGF-HHQALLIASIWp..kGKGNIGY....GANVgSNH-TLRAPDQEIFHGEGVFFGLGCNIKFP.........S..NFvkA..PYSAIA.TAVN.TLPQLVTMPFALI......sT..P..........G.......H..N..I.......S..S........LS.PAI.........................NE..I..S..P.G.........VftvL.RNEDKFRSRNK.SK.R...-..-..-..-TLIEADIFCPEIVQYMKDARVELI.....T..AE.GE.A..E..LSl......aDGEavyt.............................................................dkqaRGLG.KNY.M........RD....T....S...RL.......AG.....IAAY...T..FFIKLYAL.EALL..K.S.......VEDG....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------cvsadgtvgsvdssr.......................................................
A0A0E9LZP2_9BACT/3-657               ..............................................................................................................................................FRNLSTEEIAQLER.N.GCVC..RD..WSL.I...T...V.........K...S.........D...F.S.....A.........S.........NIRNVQFSGR...VSI..GLLEK.SF..TS...PGG..V..PK.MAGLYHATIH.NCQI...GD.N.....VYISQ..........I.....KN.......HLA..N..YD........IGDDVIIENVDSL.....S.........V.T........E..P..........SAFGNGVR......................VAVLNET.GG.REIAMYNEL................S.AQSAYLM..............A..F.Y..R.H..RPE..L.ISRLMHMV.DA.YV.E........KTR.S..D.RG..K..IGTGAHLLNCRTIL.N..VNIGPYAEIEGIYRLTNGSV.NS...CEE...D..P...AYIGPGVIAEEFITSCGSIVTESTMISKCFVGQGTVLGKQYSAENSVFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYY....SFLNAGS....GSNQ.SNHMYKLGPIHQGIVERGGKTTSDSYLLWP.........A..KI..G..AFSLVM.GRHY.RNPDTSDLPFSYL.......I..E..........N.......R..D..E.......S..H........LA.PAV.........................NL..R..S..I.G.........T...I.RDARKWPKRDR.RK.S...S..E..L..LDSIVFNLLSPYSIQKMIQGIKVLK.....D..LK.ET.S..G..PT........SEY.....................................................................YMYN.SVK.I........SD....T....A...LE.......RG.....IQLY...R..LGLVKFLG.NGLV..K.K.......LELK....R.Y...K.T...D....VE.MRKAL....T.S..DGLE.G..S.G.EWVDMAGLLVPKEIV.LKFVNDLEQGKIE.S.IVDLNGYYREWKEN...YFFWAWNWIVPR.LKEE..IG.......LD......V..A.V...A.GRDEIDGFVEE.W.KNAVVL....LDEMMYKDARKEFT.LKS...QTGFGI...DGSADT.RATDFENVR.GE.F..TSHPAVKDILEHIDKKSKLADKVRKKL......................................................................
A0A399SW77_9BACT/9-662               ..............................................................................................................................................FRNLLDEEIGQLVH.Q.GCSS..TD..WSL.V...K...V.........G...E.........D...F.I.....P.........D.........CIENTKFTGR...IRL..AGFTG.SV..NL...IGG..I..TF.KTGIYNAWLH.NCEV...GK.N.....ALIHN..........V.....RS.......YIA..N..YR........IGENVIIHNITTL.....A.........V.D........G..R..........SSFGNGIV......................VETINEG.GG.REIPIYDYL................S.AHVAYMM..............A..L.Y..R.H..RPG..L.VNSLKTMV.AD.YT.E........FVS.D..E.MG..V..IGAHSKLLNCNTIL.N..VKTGPAAVIDGVKKLKNGSI.NS...NFE...A..P...VVIGEGVIMEDFIVSSGSLVAEATLVSKCFIGQGCVLDKHYSAENSLFFANCQGFHGEACSIFAGPYTVTHHKSTLLIAGMF....SFLNAGS....GSNQ.SNHIYKLGPIHQGIMERGAKTTSDSYLLWP.........S..HI..G..AFSLVM.GRHY.KHCDTAEFPFSYL.......I..E..........S.......K..D..E.......S..I........LV.PGI.........................NL..K..S..I.G.........T...V.RDTQKWPKRDK.RT.D...S..N..L..LDFINFNLLSPYTVRKMMAGREKLL.....A..IR.ES.S..V..E-........EAS.....................................................................YRYQ.KMK.I........EK....H....A...LD.......RG.....IELY...E..MAIWKFLG.NSLI..T.R.......LKGN....K.L...E.S...V....SD.MWKAL....Q.P..DTRL.G..R.G.YWVDLAGMLCPFEAL.DQLLANVENGAIQ.S.LEEVNAGLAMLHKN...YYNYEWTWAADA.LESF..CG.......KP......L..D.Q...F.ETGDVISVVER.W.KNSVLG....IDKYLYEDAQKEFS.MSK...MTGFGV...DGQNGA.RELDFAEVR.GE.F..ESNNTVQAIRQHMDKKEALGNEIIA--lm....................................................................
R7ZR45_9BACT/42-729                  ..............................................................................................................................................YRQLNAMEIEILVR.N.RNQS..DD..WNK.L...L...V.........S...D.........E...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEA.CY..LE...YHN..L..RM.PVGIYNSTII.SCDL...GD.N.....IVIDN..........V.....-H.......YLS..H..YI........LGNEVILVNVNEM.....S.........T.T........N..H..........AKFGNGIVkdged...........pgiriwMELCNEN.GG.RKVIPFSGM................L.PGDAWIW..............S..K.F..R.T..DTD..L.QEKLVAIT.QN.SF.D........TRR.G..Y.YG..K..VGDRSIIKNCLIIK.D..VWIGSDAYIKGANKLKNLTI.HS...SPE...A..S...SQVGEGCELVNGIISEGCRIFYGVKAVRFAMASHSQLKYGARLINSYLGNNSTISCCEVLNSLIFPSHEQHHNNSFLCASLLn.gqSNMAAGAt..vGSNH.NSR----GADGELIAGRG---------FWPglcvsvkhnS..RF..A..TFNIVAkGDYP.AELDIP-LPFSLI.......S..H..........Qv.....hL..N..R.......I..Q........VM.PAYwf.....................lyNL..Y..A..L.A.........-...-.RNAWKYKERDK.RI.E...K..I..Q..--PLEFDYLAPDSVQEMVDALPLLE.....L..AV.GK.S..F..IH........ADLdpsgypfqhagelgrkl...................................leskdprvdsllitvegWENS.KRP.V........EI....I....K...VS.......AA.....WQVF...R..RMIEFYAV.QCVV..Q.Y.......GEIE....K.F...G.D...W....ES.VKGLL....P.S..--PA.R..Q.W.NWKNVGGQLIPAEAL.NELISKLKSDQIQ.T.WTEAHALYENANQN...YNHWKCTHSLQC.LLEM..RN.......VK......A..S.D...L.CQAFWDELLNE.A.VNTRQW....LSDQVYLSRKKDYA.NPF...R-----...--NMVYdSAEERDLIL.GS.L..ETNSFLLQERQD---------------ceafinkvk.............................................................
A0A191TIY0_9BACT/42-731              ..............................................................................................................................................YRNLTAFEIEALVR.N.RNTS..DN..WNN.I...W...V.........S...D.........L...F.N.....P.........E.........LVKNCKFYGL...VRI..GKLEP.YM..LV...FSD..L..KV.AVGLYDSTII.SCDI...GD.N.....SVINN..........V.....-H.......YLS..H..YI........IGEEVILTNINEM.....Q.........T.T........E..K..........SKFGNGIVkdgen...........eniriwLELSNEN.GG.RKILPFNGM................L.AGDAWLW..............S..K.Y..R.D..DKK..L.LDRFIEFT.EA.EF.K........TAR.G..F.YG..K..VGDRTVIKNTDIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GEE...G..H...TQIGEGCELVNGSIGFGNRIFYGVKAVRFVTASHVQLKYGARLINSYLGNNSTISCCEVLNSLIFPAHEQHHNNSFLCAATVf.gqSNIPAGAt..iGSNH.NSR----GADGEILAGRG---------FWPalctslkhnS..KF..A..SYTMLAkGDYN.YELNIP-IPFSLI......sL..D.........vQ.......K..N..N.......L..V........VM.PAYwf.....................myNM..Y..A..L.T.........-...-.RNTWKYFDRDK.RK.E...K..I..Q..--HIEYDFLAPDTVNEMFEALRLLE.....I..YT.GK.A.fY..FS........L-Nknylsneehqkigrei....................................lndeasniedinitaegFENS.KRE.T........KI....I....K...VK.......KS.....YRIF...K..QMIVLYGL.EQLV..N.F.......ILTN....K.I...S.S...V....KQ.LKELL....P.K..DA--.Q..R.N.NWLNVGGQLIPEENV.SSIRKNIYEKKIN.S.WNDLHQHYQAEGEK...YTNEKLKHALAS.LEEI..KQ.......IH......L..N.S...I.NKKILFELFDE.L.LLLNKQ....VLENIKISRKKDYT.NAF...R-----...-KMMYS.SQTEMDSVL.GK.F..SDNSFIRQQEENFKNFSTQI-------qask..................................................................
D0P271_PHYIT/45-561                  .............................................................................................................................................f-YPLSDGEIRALEA.N.GNSA..KN..WQN.V...C...K.........T...D.........PnapL.E.....T.........S.........CIRQCSFHGK...VAL..GRFSA.SF.sHD...VDG..I..PF.PCGVYNSALS.NVVV...LD.D.....ALVRD..........T.....-L.......VLR..N..VL........VDSRALIIKCGSV.....A.........GpE........D..G..........TVSANGNL......................LHVGVEI.GG.RDLRVVADL................P.FSLGAAV..............A..T.T..R.G..DRD..F.LKTYDAFV.DN.YV.A........AVK.A..P.MA..I..VAKYSRVRGCPRVQ.G..TFVGGYAVLEDS-DVTNSTI.LS...TKE...E..P...SVVRIKSIVHDSIVHWNSTVESLSVVEGSFLCDTSHVERHGIVVSSVIGPNTCVAEGEVTSSFVGPFVGF-HHQALLIASIWp..qGKGNIGY....GANVgSNHTLK-APDQELFHGEGVFFGLGCNVKFP.........S..NFvkA..PYSVVA.TAVN.TLPQLVTMPFALI.......N..T..........P.......G..H..T.......I.lS........LS.PAInei..................tpgwVL..S..S.sVfT.........V...L.RNEHKFRSRNK.SK.R...-..-..-..-TYIEAAIFRPEIIQYMKDARAELK.....A..AE.GK.A..K..MNl......pSGEavyt.............................................................dkqvRGLG.KNY.M........RE....S....S...RR.......SG.....ISAY...T..FFIKLYAL.DELL..K.L.......VES-....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gyvavdgtigsvdss.......................................................
A0A4Q0J584_9BACT/1-182               .............................................................................................................................................m-RPLTPSEITRLES.N.GCRC..SD..WNR.I...S...L........rH...D.........E...F.D.....P.........G.........SYAGVWFSGD...VTL..GATLP.--..--...-SA..L..--.-PGISNVHLH.DCEL...GD.N.....VTIHN..........V.....-H.......LIS..G..YT........IGNGATLTRCGTI.....T.........A.D........G..W..........NP--GGIL......................VNVLDET.GS.KALRIHPGL................T.AQMAALA..............I..D.N..D.E..ART..L.INTLPL--.--.--.-........---.-..-.--..-..--------------.-..--------------------.--...---...-..-...----------------------------------------------------------------------------------....-------....----.------------------------------.........-..--..-..------.----.-------------.......-..-..........-.......-..-..-.......-..-........--.---.........................--..-..-..-.-.........-...-.-----------.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------saehnpvrpainhgatlsgaslikssiigaha......................................
A0A1Y2RGA8_9BACT/42-733              ..............................................................................................................................................YRKLSDAERKILLR.N.GNSA..DD..WEK.I...L...V.........A...E.........T...F.N.....P.........D.........LVKNCKFFGL...VRI..GKLEA.MF..AE...FND..L..QM.PVGLYNSTIV.SCDI...GN.N.....AVIDN..........V.....-N.......FMS..H..YI........TGDDVMLVNINEL.....V.........T.S........N..H..........SKFGNGVLkqget...........esiriwMEICNEN.AG.RSILPFNGM................K.AADAWLW..............S..K.Y..R.A..DEK..L.LQQFKDFT.DK.RF.D........TQR.G..Y.YG..K..IGDRTVIKNTSIIK.D..VWVGSDAYIKGANKLKNLTI.NS...DAN...A..K...SQIGEGCELVNGIIGFGSRVFYGVKAVRFMMGSNSQLKYGARLINSYLGDNSTISCCEVLNSLIFSAHEQHHNNSFLCAATIm.gqSNMAAGAt..iGSNH.NSR----GADGELIAGRG---------FWPalcvslkhnS..KF..A..CFTLIAkGDFQ.SELNIP-LPFSLI.......S..Nd........vS.......N..D..Q.......L..T........IM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAGKYEARDN.RV.D...K..T..Q..--QIEYNFLGPDSVNEMFDGLHLLK.....K..YT.AK.A..Y..AT........KSKkqiaekdlvrtgeqi.......................................leknepalaqleilaENFE.NSN.R........KV....R....L...IKt.....aEA.....YHIF...K..EMIVYYGI.TELV..Q.F.......IEKR....K.I...T.S...W....QN.LLPAL....P.I..AT--.E..R.T.EWKNIGGQLIPEKPL.NTLLKNIRTGKIS.S.WDEVHNFYAKKSIQ...YNADKFQHAFAS.LLEI..CS.......LT......P..K.K...L.TKKIFIQLLTQ.A.IKTSQW....MTEQIIRSREKDYQ.NPF...R-----...-QMVYD.NPQEMEKVI.GK.L..SDNSFIQQQNKESQLFCNRVTTIIEQ-f.....................................................................
A0A4S4HDU8_9BACT/4-650               ..............................................................................................................................................YRLLTPQEINILKS.R.NCTA..DS..WHK.I...L...V.........D...-.........D...F.D.....P.........E.........RYYNVNFSGN...IKL..GTARG.ML..TN...SAG..L..KK.PCGIYNASIH.NCEI...GP.H.....VRISS..........V.....DG.......SIS..N..YK........IGEGSFISVIGSI.....C.........C.H........K..N..........AMFGNGTY......................ADVMDET.GG.RSIRIYDCM................T.AQTAYMA..............A..L.Y..R.H..RPD..F.IEALDKMT.DV.YI.N........SRK.S..D.NG..R..IGKNVIIENCPSIS.D..VIINDEAVLTNVSVLTNGTV.GR...RA-...-..-...-KVANSVIAENFIISSQASITNGSMLQNAFIGQASIIANGFTATHSLIFANCNLQCGEACSIIAGPHTASHHKSTLLIGGIF....SFFNAGS....ATNQ.SNHMYRLGPMHQGIMERGCKTGSNSYVLWP.........A..DF..G..QFSIIL.GSHY.SHPDTSMFPYSTI.......V..A..........R.......E..G..K.......T..F........VM.PGA.........................TV..C..T..S.G.........L...I.RDLLKWPKRDN.RH.D...D.iE..N..LDIINYDIISPLNVSKMYRGLEYLA.....K..YD.SD.P..D..A-........LEK.....................................................................YNF-.--T.L........IN....K....T...IA.......SG.....RENY...A..FAIDFFMG.KYLT..N.L.......VNET....T.L...E.Q...N....IP.IGRQL....F.P..KELP.D..N.E.KWIDILGLLAPRNIIrDQIIKPTISGNIS.S.LQELQEKFFEIGNN...YNNLVTDFLHQN.FKKI..YS.......IT......T..D.E...L.TPQNLITILER.W.CETVAA....MKSKRLADGLKEFD.PNM...RIGFSP...DD-INY.RDADFEAVR.GT.P..QNHPQLNAIHEHYTSY-----------inncyhamdkl...........................................................
A0A4Q1D7Y0_9BACT/44-737              ..............................................................................................................................................YRQLKAYEIELLVR.N.GNTS..DD..WNK.I...L...V.........S...D.........A...F.N.....P.........A.........LVKGCKFYGL...VRI..GKLES.YC..LE...FSD..L..KV.AVGLYNSIII.SCDL...GD.N.....VVIDN..........V.....-N.......YLS..H..YI........VGNEVIITNVNEL.....I.........T.T........D..H..........AKFGNGIVkeges...........eslriwMEICNEN.GG.RSVIPFNGM................L.PGDAYLW..............S..K.Y..R.D..DEK..L.LRQFQSFT.EQ.EF.K........PHR.G..Y.YG..K..IGDRTVIKNSSIIK.D..VWIGSDAYIKGANKLKNLTI.NS...GPE...G..K...TQIGEGCEIVNGIIGFGCRIFYGVKAVRFVMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALIm.gqSNIAAGAt..iGSNH.NSR----SPDGEIIAGRG---------FWPglcvslkhnS..RF..A..TYTILAkGDYP.AELDMP-IPFSLM.......S..Nd........vT.......N..N..R.......L..V........II.PGYwf.....................fyNM..Y..A..L.A.........-...-.RNAWKYGDRDK.RT.Q...R..Q..Q..--YLEYDYLAPDTVNELFSALQLFE.....V..LT.GR.A..W..YE........QKHpdeaqteaawaakgrs.....................................lllekdpvideldivaPGIE.NAK.R........KT....V....I...LRi.....tRA.....YHIF...R..ELIVYYGA.QQLV..E.L.......IETK....D.I...N.T...L....AE.LHNAL....P.A..S--A.D..R.N.DWLNIGGQLLPSTEV.EALKNEIKDNKIN.S.WDGVHDWYETAGGK...YAGWKQKHALSC.LSAI..TG.......LT......L..K.K...L.SPEDVAQLLGG.L.VNTQSW....MSNGIYESRAKDYD.NTF...R-----...--KMVYdTKEEMDLVM.GK.L..EDNSFIHQQKQLLAELEQRIQKIKARL......................................................................
T0RJH5_SAPDV/32-538                  .............................................................................................................................................y-APVTPAQIQRLEA.A.GNRA..ES..WAT.V...H...T.........S...S.........Ps.lA.P.....L.........E.........RIRNCSFRGH...VYF..GTFAK.NT..V-...VEG..V..PF.QSGLYNSTLS.DAFI...AT.D.....ALVHD..........T.....-F.......LLH..G..TY........VESGASVVGCGTI.....T.........V.S........S..A..........PVYGNNNP......................LKVGVEI.GG.REIHAFADL................P.FDLAVKV..............G..Q.N..R.S..DAT..E.LAAYAANV.AT.YT.A........AIN.C..G.IN..V..IGADAQVLRCAKLH.D..VFVGGFAVLQDSIVL-NSTV.MS...SNA...E..R...SRITGFSRVTDSILQWHAIVEGSSSVERAFLCEYSHVERHGIVMDSLLGPNTSIAEGEVTSSFLGPFVGFHH-QAMIIASFWp..eGKGNIGY....GANVgSNHTLK-APDQELWPGEGVFYGLSVSVKFP.........S..NFthA..PYSVLA.TGVN.TLPQKLEMPFALV......nL..P..........G.......H..N..I.......P..A........LS.PAVnei..................fpgwVL..G..S.sIfT.........V...L.RNMDKFEKRNR.AR.R...-..-..-..-TVIEHEIFRPEIVRMMQVALERLT.....S..PK.DA.S..I..TL........GPH.....................................................................KIYT.DKQ.VpglgknymTE....S....S...RL.......AG.....IRAY...T..FFIRLYAL.NGFY..T.A.......L---....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------ragpqplesllaa.........................................................
A0A1H3DI07_9BACT/44-735              ..............................................................................................................................................YRQLTAYEIEMLVR.N.GNTS..DN..WNH.L...L...V.........S...D.........A...F.N.....P.........E.........LVKNCKFFGL...VRI..GKLEP.LC..LS...FSD..L..QT.PVGLYNSTII.SCDF...GD.N.....VVINN..........V.....-E.......YLS..H..YI........IGNEVIIVNVNEL.....V.........T.T........N..H..........AKFGNGIVkegep...........edvriwMEICNEN.TG.RRVMPFNGM................L.PGDAFLW..............S..R.F..K.N..DNA..L.QEKFKAFT.EA.RF.D........NKR.G..Y.YG..K..IGNRTVIKNCKIIK.D..VWVGTDAYFKGANKLKNLTV.NS...GEE...G..Q...TQIGEGCEIVNGIIGFGCRIFYGVKAVRFIMASHSQLKYGARLINSYLGNNATISCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNIAAGAt..iGSNH.NSR----GADGEIIMGRG---------FWPglcvslkhnS..RF..A..SFTILAkGDYP.AELDIP-FPFSLV.......S..Nd........vH.......N..D..R.......L..N........IM.PGYwf.....................lyNM..Y..A..L.A.........-...-.RNAWKCVDRDK.RT.E...R..I..Q..--HLEYDYLAPDTINEMFHTLRLLE.....I..NT.GY.A..Y..YK........AHHpkknitqeealttgkql...................................lhgdpklvnqleitiegVENG.KRK.T........IL....S....K...VM.......QA.....YTLF...T..DLIYYYGI.TQLL..Q.L.......LKQQ....K.A...A.S...L....ES.FIAAL....P.A..KA--.V..R.T.NWVNVGGQLILAEDL.QQLKDKIKANKIK.S.WDEVHDYYTTLGNK...YPQQKMNHALAS.LAEI..TG.......KS......L..R.K...I.DKHGFNNLLNT.V.IATQEW....ITKAIYDSRAKDYN.NPF...R-----...-KMVYE.NMAEMNEVV.GK.L..ENNSFIKQQLASLEEFK----------kevagirk..............................................................
D1VYA2_9BACT/1-578                   .............................................................................................................................................m--------------.-.----..--..---.-...-...-.........-...-.........-...-.-.....-.........-.........--HRVMLYGE...VYI..GAFDD.TI..EV...SRD..F..FK.HSGINNATLR.NVTI...GD.N.....SLVEN..........I.....GN.......YIN..N..YT........IGDRCYISNVCTL.....E.........T.S........E..G..........ATYGEGNL......................VSVLNEV.GD.GNVVLFRDL................N.SQLAAFM..............V..K.H..F.H..DKP..L.KEAIRRLI.KE.EI.N........LHA.P..E.QG..W..IGNNVKIVNTKEIS.N..TVIFDECEINGASRLSDCTI.LS...SDN...A..S...VYIGTGVICENSIISYGSSIINSVKMQDCFVGEACQISNGFTASASVFFANSYMSNGEACAAFCGPFTASHHKSSLLIGGMF....SFYNAGS....ATNF.SNHAYKMGPMHYGTLQRGCKTASGAYLLMP.........A..NI..G..TFSVCF.GKLM.YHPDTSCLPFSYL.......K..A..........Y.......S..D..I.......M..Y........LS.PGR.........................NI..T..T..V.G.........L...Y.RDIRKWPKRDL.RP.Q...G..T..L..KSIVNFDWLSPYSVGEIIEGKKILE.....K..LQ.DA.S..G..NE........VAL.....................................................................YNYY.NYV.I........KS....N....S...LQ.......KG.....IENY...D..MALRIYMG.A-VL..K.R.......MRKR....D.A...N.-...-....--.---LT....P.P..SSTV.G..T.G.QWTDLSGLLLPVSEE.ERLIEDIKNGNLE.S.IQDVLQRFEDINEH...YRDYQWAWTYQL.ILDY..YH.......L-......-..N.T...I.TPQDADRIRED.Y.IQARRT....WIAAIRKDAEKEFA.MG-...------...------.---------.--.-..---------------------------dveqnvlddfldkldhevdy..................................................
A0A1X7LAX0_9SPHI/41-724              ..............................................................................................................................................YRQLTIEEIETLTT.N.NNYS..SN..WDH.I...W...V.........T...D.........K...F.I.....P.........R.........LVQNNKFYGF...IRI..GDMEE.VF..LD...YRE..L..RL.PCGIYNSTIV.SCDI...GH.T.....VAISH..........V.....-R.......FIS..H..FI........VGNDVILANVNEM.....T.........T.S........N..N..........AKFGNGILkvgdv...........eerriqLELCNEN.GG.RSVLPFDGM................Q.AGDVFLW..............S..R.Y..R.A..DDE..L.QTRFRELT.EN.KY.S........IER.G..F.YS..T..IGDRCVIKNTQTIK.D..VKIGTDAYIKGVNKLKNLTI.NS...SQE...A..F...TQIGEGCELVNGIIGYGCRIFYGVKAVRFVLSSFSQLKYGARLINSFLGDNSTISCCEVLNSLIFPAHEQHHNNSFLCAALVk.gqSNMAAGAt..vGSNH.NSR----AADGEIIAGRG---------FWPglcvslkhnS..RF..A..SYSLIVkGDFL.HELDVK-FPFCLI.......S..N..........Ev.....dT..N..R.......L..V........VL.PGYwf.....................myNM..Y..A..L.M.........-...-.RNTSKFMARDK.RR.F...K..N..Q..--HIEYDILAPDTINEMFVALSEIE.....K.aVG.KT.M..G..KG........ADMtseqtfgrqlltn...........................................eqpwpkqdvflenVEYS.KRK.V........VL....A....K...PY.......EA.....YNLY...K..RMIRYYGA.MQVF..S.F.......LEQH....D.W...S.S...F....QA.QVAHL....P.P..RFEV.E..-.-.---NIGGQLFRLDRL.AHLLDGIRTGRYN.S.WEEVHAYYHQCSAD...YPLDKFLHGVAA.LVEI..TD.......RP......I..E.T...W.DKNFVSALLEE.A.RETKRW....IFHEIVNSRHKDYE.NPY...K-----...-QMVYD.SYEEMEAVI.GK.F..EDNDFINKETIALEAFEVSLDNLIAKL......................................................................
A0A1I1X663_9BACT/4-658               ..............................................................................................................................................YRSLTTNEIKQLEQ.Q.GCFC..DN..WGK.I...K...V.........T...Q.........N...F.D.....P.........K.........FVRQSHFSGE...NFL..GSFQR.TF..NF...AGG..V..SK.HSGIFNATIH.NSVI...ED.D.....VYINQ..........I.....RN.......QIA..N..YH........IESNVIIENVDSL.....T.........T.E........G..E..........TCFGNGQK......................IAVLNEA.GG.REVPIFNEL................S.AQTAYLL..............A..F.Y..R.H..RPG..L.IDMLNKMV.DD.YC.R........QIC.S..D.KG..S..VKTGARVLNSRTIL.N..VNIGPHAIVEGIYRLVNGTI.NS...CHE...H..P...TYFGPGVIAEDFIAASGATVTDATLISKCFVGQGCILGKHYSAENSVFFANCQGFHGEACSIFAGPYTVSHHKSTLLIAGYY....SFLNAGS....GSNQ.SNHMYKLGPVHQGVVERGSKTTSDSYLLWP.........A..KI..G..AFSLVM.GRHY.RNPDTSNFPFSYL.......I..E..........N.......K..D..E.......S..Y........LA.PGV.........................NL..R..S..V.G.........T...M.RDARKWPTRDK.RR.D...P..R..K..LDYITFNLLSPYLVDKMIKGKETLI.....K..LK.KI.S..G..VT........SDY.....................................................................FMYN.SVK.I........EA....K....A...LE.......RG.....IHLY...D..IGIVKFLG.NGLL..K.K.......IELA....S.F...S.S...L....EE.LRQTL....K.P..ESDT.G..K.G.EWIDMAGLIVPKEKV.LHLAEKIEQGQIQ.N.FHAMNAIFKEWHDN...YYTWAWNRSYSI.FKSA..LN.......ID......L..A.S...I.TKKQLLDFIQK.W.ENAVVS....LDKMMFEDARKEFT.LKA...QTGFGL...DGEDDV.RNIDFEQVR.GA.F..EKHPTVCDILEHIEKKKKLAAEISKK-i.....................................................................
A0A0L8V2H2_9BACT/6-660               ..............................................................................................................................................YRHLTTAEIQTLEQ.N.KNNA..QN..WNN.I...F...V.........L...E.........G...F.D.....A.........S.........RVENCRFTGE...NRI..GQLNE.TM..TF...FGK..V..EK.PCGLFNAHFH.NCTI...GD.N.....VFVNH..........V.....KN.......YIA..N..YD........IEDHVIIDNTDLL.....A.........V.E........G..L..........SNFGNGIQ......................VSVLDET.GG.RKVPIYNQL................S.AHLAYML..............A..F.Y..K.H..RKV..F.NERLEQLI.DQ.YT.E........EVK.S..E.RG..L..VGQYSQIINCREIK.N..VKIGPYTLIDGCSKLENGSI.NS...NAS...A..P...VKLGHEIIMKDFIISSGSEVTDGAIVAKCFIGQGCKLGSQYSAENSLFFANCQGFHGEACALFAGPYTVTHHKSTLLIAGMF....SFCNAGS....GSNQ.SNHMYKLGPIHHGIVERGSKTTSDSYLLWP.........A..KI..G..AFTMVM.GRHY.KNSDTSDMPFSYL.......I..E..........N.......K..D..E.......S..W........LA.PAI.........................NL..K..S..V.G.........T...I.RDVLKWPRRDK.RT.D...P..K..K..MDCVNFNLLSPFTIQKMAKGIRKLK.....E..IQ.RI.S..G..ET........TEV.....................................................................FSYN.NTK.I........KR....N....S...LL.......RG.....IDLY...H..MAIMKFIG.NSII..T.R.......LNTC....T.L...E.T...R....RD.VQCCL....R.S..DSTV.G..K.G.NWIDLAGLIAPKHAI.SELLDGVEDGSIS.Q.LNQIESIFYSLHDN...YYNYEWNWTVDF.IAKY..FD.......KS......L..E.E...M.SVEDIIQIIRE.W.QQSVVE....IDKMLYLDAKKEFR.LES...MTGFGI...DGSQKT.KQLDFENVR.GK.F..ESNDFVREILNHIDRKTALGNRVIEQL......................................................................
A0A1I7NDL1_9BACT/41-735              ..............................................................................................................................................YRQLTAYEIETLVR.N.NNTS..DN..WNH.I...L...V.........D...D.........A...F.D.....P.........G.........LVKNCHFYGL...VRI..GKLEP.YY..LE...FHN..L..RL.AVGLYNSTIC.SSDL...GD.N.....VVINQ..........V.....-N.......YLS..H..YI........IGNEVILTNVDEM.....A.........T.T........D..Y..........ARFGNGILkqgep...........eshriwLEICNEN.GG.RKVLPFEGM................L.PGDAYLW..............S..R.Y..R.D..DDL..L.MQKFMEFT.AQ.AF.D........HRR.G..Y.YG..E..VGDRTVIKSCKIIK.D..TKIGSDAYIKGANKIKNITI.NS...SAE...A..P...SQIGEGCELVNGIIGYGCRVFYGVKAVRFVMASHSSLKYGARLINSYLGNNATVSCCEVLNSLIFPAHEQHHNNSFLCAALVm.gqSNMAAGAt..iGSNH.NSR----GADGEIIAGRG---------FWPglcvslkhnS..RF..A..TFTLIAkGNYP.AEIDLR-VPFSLLv.....hE..E..........S.......E..N..R.......L..K........VM.PGYwf.....................ryNM..Y..A..L.A.........-...-.RNAWKYQDRDQ.RT.E...K..V..Q..--HLEYDFLAPDSVNEMLDALQLMA.....Y..AT.GK.A..Y..YN........H-Lhthvsdlqkvdyqkt......................................gesllqakhpvlqqmeVLYE.GLE.N........SS....R....NnifIKi.....aEG.....YQVF...R..EMIHYYGI.KNLL..P.V.......IQRL....-.-...A.E...E....ED.FSSIQ....Q.F..FKKA.C..L.E.KWENIGGQLVPKRYR.EQLIQDIHSGKIN.S.WQALHQRYQEWSKQ...YEQEKQHHAAAA.LLAL..HA.......CT......A..D.D...L.HPDLLMQWLKK.F.VHIQQW....IDEQIYLSRKKDYE.NPF...R-----...--KMVYdHEKQMEKVL.GR.L..DDNPFIVWSRQISQQYQQQAQQILQKI......................................................................
R5BL39_9BACE/43-734                  ..............................................................................................................................................WRHLTSDEIERLVK.N.DNTA..SS..WDT.I...W...V.........T...D.........E...F.I.....P.........R.........MLKNNNFYGT...VRI..GRISD.NG..LQ...FHD..L..RL.PIGITNSSIH.SCDI...GD.D.....CAIHD..........V.....-H.......YLS..H..YI........IGDRCMLFNIHEM.....S.........S.T........D..H..........AKFGNGIVkdgep...........esvrvkLHVMNET.GC.RSVYPFDGM................I.TADAYLW..............A..K.Y..R.D..DLP..L.QKRLEEMT.QS.VQ.D........HHR.G..Y.YG..T..VGSGCVIKTSEIIK.D..VKIGTGCYIKGASKLKNITI.NS...SES...E..P...TQIGENVILVNGIVGYGCRIFYGCTAVKFVIGTNCNLKYGARVIDSILGDNSTISCCEVLNNLIFPAHEQHHNNSFLIAACLl.gqSNLAAGAt..iGSNH.NSR----SNDNEVVAGRGFWPGLCSSIKHS.........C..VF..A..SFTLLAkGAYP.AEMHIR-LPFSMVs.....nN..E..........S.......E..G..C.......L..E........IM.PAFww.....................lhNM..Y..A..L.A.........-...-.RNNWKFQTRDR.RL.T...K..V..Q..--NIEFDTYAPDSMEEVLQGMELLA.....L..WT.AK.A..W..FR........SRGedcaavgfealvrkgre..................................llegpyetvaslevlgedVE--.--K.S........KR....K....V...LIrk...pwQA.....YRAY...S..EMIVHYAM.GNVL..K.Y.......FEGN....S.S...P.S...F....EY.LSG-L....S.A..A--P.R..E.K.MWVNLGGQLMKNSDV.DTIREDIVSGVLP.D.WVSIHSRYSQIWQS...YPEAKLAHSVQC.LAEL..YG.......TR......C..-.-...L.SKEDWRRALED.E.KRICRL....VSDQVYLTRLKDYE.NPF...R-----...-RATYR.NEDEMTAAI.GR.V..EDNSFVKQVASDTEKELLQIDRILN--il....................................................................
A0A2M9A6A2_9BACT/32-511              .............................................................................................................................................e-RALSPQEIETLEK.N.GNRS..SD..WSL.V...T...V.........D...M.........L...F.T.....P.........G.........RIFSSSFSGR...VHL..PAFYG.TL..LM...PGD..V..AA.PTGIYSSAIH.DCWI...E-.N.....SLIHH..........A.....-S.......LMS..N..IW........VSQGAVVQNVGSI.....V.........A.N........G..K..........SHYQIAAE......................VCVGNEM.GG.RPVRIFPDI................T.PELVKMQ..............L..F.T..K.T..DAE..T.MSAFVSQM.NA.WR.E........EVL.V..P.YG..I..VGKNAIVANTNIVR.N..SWIGEHVRIDGASKIRNTVV.LG...SLE...E..P...TYIYDGVILENSCVQEGAKLHSTALLKDSVLMRRTKIGNKAIVNSSIICPCVHIDEAEVTHSFVGPLTQMHH-HSLLIAAIWpeghGNLGYGAn..vGSNH.TSR----MPDQEIMPGLGMFFGLGSSIKFP.........A..NF..SesPYTVIS.TGVT.ASPQRLKFPFSLI.......L..P..........N.......N..P..R.......V..H.......sVS.PSLnelrp..............gwcygkNA..Y..A..V.A.........-...-.RNAYKYAIRGK.--.-...-..-..-..-------------------------.....-..--.--.-..-..--........---.....................................................................----.---.-........--....-....-...--.......--.....----...-..--------.----..-.-.......----....-.-...-.-...-....--.-----....-.-..----.-..-.-.---------------.-------------.-.--------------...------------.----..--.......--......-..-.-...-.-----------.-.------....--------------.---...------...------.---------.--.-..---------------------------gfvapeesqvlsdknailvvdalrrlqaaqiqeiyteedipglgsnylkessrhlaeiiykgflerymlm
#=GC seq_cons                        ..............................................................................................................................................aRpLospEIphLpp.p.sstu..-c..Wsp.l...h...V.........s...-.........s...F.s.....s.........p.........hl+pspFhG....lcl..Gthct..h..h.....ts..l..ph..sGlhsuslt.sssl...GD.s.....shIcs..........l......s.......alu..p..Yh........IGscshltNlspl.....t.........s.s........s..p..........upFGNGhh......................lplhNEs.GG.Rplhhassh................s.st.Aalh..............s..h.a..R.c..ctp..L.hpphcphs.cp.hh.s........ppp.u..t.hG..h..IGspshIhNsphIc.s..VhIGstshIcGus+LpNsTI.pS...s.p...s..s...spIGpGs.htssIlu.GsplhtGshh.+shlupssplptshps.sSlhhsNsphusGEshushhGPasspHHpsoLLIAuhh....ShhNAGu....GSNp.Ss+....GP.pphlhtRG.hhs.ss.lhaP.........u..+h..u..uFollh.Gcah.pc.chs.hPFShl.......h..p..........p.......p..s..p.......h..h........lh.PGh.........................Nl..h..u..l.u.........h...h.RsspKascRD+.Rp.p...p..p..p....hlpashLuP.olpchhpuhphLc.....p..lp.tt.s..t..tp........sp......................................................................hthp.phh.l........pt....s....s...lp.......cu.....hphY...c..hhlphahs.ptlh..p.h.......lpt.....t.h...t.t.........t.h.t.h.........t....t..h.s.pWhsluG.lhPpppl.pplhppIcpuplp.s.hpplpthatphtpp...Y.p.chtauhth.l.ph..ht.......hp.........t.p...h.s.t.h.phhpp.h.hpsh.h....h.p.lhpstpK-ap..s....h...............t..-hptVh.G..h..tpp.hl.....t.....................................................................................
//
DBGET integrated database retrieval system