GenomeNet

Database: Pfam
Entry: DUF5040
LinkDB: DUF5040
Original site: DUF5040 
#=GF ID   DUF5040
#=GF AC   PF16443.6
#=GF DE   Domain of unknown function (DUF5040)
#=GF AU   Chang Y;0000-0002-2418-3433
#=GF SE   Jackhmmer JCSG target SP16796C
#=GF GA   25.00 25.00;
#=GF TC   200.20 200.20;
#=GF NC   23.90 22.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR032221;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several uncharacterized proteins around
#=GF CC   260 residues in length and is mainly found in various
#=GF CC   Bacteroides species. The function of this family is unknown.
#=GF SQ   12
#=GS F5IZT8_9BACT/35-261       AC F5IZT8.1
#=GS A0A374AC96_9BACT/25-251   AC A0A374AC96.1
#=GS A0A1C2BUH3_9PORP/28-254   AC A0A1C2BUH3.1
#=GS A0A174RR13_9BACE/28-254   AC A0A174RR13.1
#=GS D6CYE7_9BACE/25-251       AC D6CYE7.1
#=GS F8WXC0_9BACT/25-251       AC F8WXC0.1
#=GS A0A0B5RQH7_9FLAO/195-423  AC A0A0B5RQH7.1
#=GS A0A374W751_9BACE/22-246   AC A0A374W751.1
#=GS A0A3M8EDU5_9BACT/31-257   AC A0A3M8EDU5.1
#=GS A0A1R3STK9_9BACT/38-264   AC A0A1R3STK9.1
#=GS A0A2N4SAM1_9BACT/27-253   AC A0A2N4SAM1.1
#=GS A0A2V3PL58_9BACT/44-271   AC A0A2V3PL58.1
F5IZT8_9BACT/35-261                  ....KYTILLTGASFASSNNGWFELACKQLNAKPINTAIGG.TAISDAANRMAKGELYTQEELEDIDAFVIMHVHDENVADTAGLKQNYKDYPVPFDRSNY..AAAYDYVIKRYITECYNLKFDKDSKYYGTENGKPVVIVMCTHWHDARTIFNPAIRKLGERWGFPIVEFDKYTGFSRNHLHPVTGKQYSILYAHNNETI.NGEEFGWHPDE.GQDKYIQQRMAAIFAELMEKVL.
A0A374AC96_9BACT/25-251              ....KYTILLTGASFASPQNGWFEIGCRQLDARALNRAIGG.ESIADTANRMAEGTLWNAGELDEMDALVIMQVHNRDVSATGGLKEKYTDYTTPFDRSNY..AAAFDYVIKRYQSECYALKDDPKSKYYGTKSGKPAVIVLCTDWHDARTTYNAAIRRLAARWGLPLVEFDRNIGFSKDTPNPATGTQQSLLHAQDTQTI.EGVAYGWHPQR.GQDKYIQQRMAAIFTDTMRRIL.
A0A1C2BUH3_9PORP/28-254              ..si--KILLTGASFADKGNTWFEMGCEQLGAIPLNRAKGG.EAIANTANKMNEGALYTKEELEEIDAFVIMQVHNRDVYEDSQIKPAYADYQMPIDRSNY..AAAYDYVIKRYLSDCYNLKFDKNSRYYGSLTGKPALVVLCTDWHDARTLYNESIRKLAAKWGFPLVEFDKYVGFSKNQLHPVTGAQTSLIYSTDKQMI.DGVTYGWHPLR.GRHQPVQQRMAAVFADLMHKLL.
A0A174RR13_9BACE/28-254              ....EYKILLTGASFASPQNGWFEIGCRKLNAEAINRAIGG.EAIANTANRMANGTLYSKEELENIDALVIMQVHNKDVYEELQLKDKYTDYEVPFDRSNY..AAAYDYVIKRYLTECYELRNDTTSKYYNTPYGKPAIIVLCTHWHDCRTVYNESIRKLAAKWGFPLIEFDKYIGFSKNVLHPVTGKPFSQLYSTDIQVT.EGIAYGHHPIR.GEQSYMQQRMAAIFVDSMNRIL.
D6CYE7_9BACE/25-251                  ....TYTILLSGASFAEPNNKWFEMGCRALHAIPINRAVSA.ESIAHTANKMLDGTLYTPEEFDNIDVFVLMQVHEKDVYNEANLKENYKDYKTPFDASDY..AICYDYVIKRYISDCYNQKFNPKSRYYNTPYGKPASIVLCTHWHDSRPIFNTSVRKLAEKWGFPVVEFDRYIGFSKNQKHPVTGKQYSLIYTGDSQET.HGEVFGWHPPH.GEHSFIQQRMAAIFADTLRKIL.
F8WXC0_9BACT/25-251                  ....KYTILLTGASFASSNNGWFELACKTLDATPINKAIGG.EAIADAANKFSADTLYTKQQLEDIDAFVIMHVHDEDVASENGLKENYKDYKTPFDRSNY..AAAYDYVIKHYITDCYNLKFDKNSKYYNTPSGKPAIIVLCTHWHDARIIYNSAIRKLADRWGFPVVEFDKYIGFSKNHLHPVTGKQYSILYAHNNEKV.NGVEYGWHPYN.GEDKYIQQRMAAIFTDLMKKVL.
A0A0B5RQH7_9FLAO/195-423             rtss----LMIGASFASPENSWYKNAYNRLRSYHVNYADGGgVGMNNYVNKIYRGELYTKETLDKFNHLVIYISHNLNVYNQKGVRESYLDYE-PINGNQYnsTQNWDYCLKKYSADCEAQKNNPNSKYYGTKRGKPVSVIVFTHWHDGREIYNESIRKLRSKWDFTLIELDKNIGFTKKKINPNTKRQVSLDYAVDTEVI.DGETFGWHPKRtGKELYVQDKTEEMFYNTISK--l
A0A374W751_9BACE/22-246              ..rg--NILLTGASFAVPENGWFEIGCEVLEFTPINRAVSG.QAIMQTAQAMKNGALYTTSQLDDIEALVIMHVHNQNVAKEDWLEDDYNDYTL-TDATPY..SVAYDYVIRKYKDDCKNLKDVPTSKYYGTADGKPAIIVLGTHWHDSRTTFNPAIRKLAKKWNLPLIEWDANIGFTKDVLDS-DGSQPSLKFAGDTETI.DGVKYGWHPLR.GKGQYIQKKMAEIYIAKMAEI-f
A0A3M8EDU5_9BACT/31-257              ....QYTFLLTGASFASPNNGWFEVGCRLTGATPLNRAVGG.EAIADAANRMAEGTLYSKEELEEIDALVIMQVHDRDVWGSSPLKEDYTDYNIPFDRGNY..AAAFDYVIKRYLTECYNLKFDENSKYYNTRMGKPAVIVLCTDWHDGRVTYNTSVRKLAEKWGFPVVEFDKYIGFSRNSVHPVTRQQTSLLFTGDNQQI.AGEKFGWHPEN.GQDSYIQRRMGAIFADTMRKI-f
A0A1R3STK9_9BACT/38-264              ....QYTFLLTGASFASPNNGWFEVGCQLTGATPLNRAIGG.EAIADAANRMAEGTLYSKEELEEVDALVIMQVHDRDVFGSSTLKEEYTDYEIPFDRSNY..AAAFDYVIKRYLTECYNLKFDEKSRYYNTRMGKPAVIVLCTDWHDGRVTYNTSIRKLAEKWGFPVVEFDKYIGFSKNSVHPVTKEQTSLLFTGDNQQI.AGEKFGWHPEN.GRDSYIQRRMGAIFADTMRKI-f
A0A2N4SAM1_9BACT/27-253              ...s-YTFLLTGASFASPDNGWFEIGCSLVGATPINRAIGG.EAIADAANRMNAGTLYSREELEKIDALVIMQVHDKDVCDSTQILPRYTDYRTPFDRSNY..AAAFDYVIKRYLTECYNLKFDPRSEYYNSKYGKPAVIVLCTDWHDGRVTYNTSVRRLAAKWGFPLVEFDRYIGFSRNALHPVTGQQISLLFTNDKQEI.DGQTFGWHPEN.GTNAYIQRRMGAIFADTMRRI-f
A0A2V3PL58_9BACT/44-271              ....KYTILMTGASFASYQNGWFEIGCKELHARALNKAVGA.EAIADGANRMVKGTLYSKQELEDADAFVIMHVHNMDVFEDSELKENYRDYKVPFDRSNY..AAAYDYVIKKYISDCYNLKFDKDSKYYNTQSGKPVIIVLSTHWHDARPIYNESVRLLAQKWGFPVIEFDRYIGFSKNTPHPVTKQQMSTLYADDNTETiDGVVYGWHQLR.GEDKFIQQHMAAIFVDTMKKVL.
#=GC seq_cons                        ....pYTILLTGASFASPpNGWFElGCctLsApPlNRAlGG.EAIAcsAN+MscGTLYo+EELE-IDAhVIMpVHscDVhspstLK-sYpDYphPFDRSNY..AAAaDYVIKRYlo-CYNLKFD.sSKYYsTt.GKPAlIVLCTcWHDuRshYNsSIRKLApKWGFPlVEFD+YIGFSKNplHPVTGpQhSLLausDsppI.cG.paGWHP.c.GccpYIQpRMAAIFsDoM+Kl..
//
DBGET integrated database retrieval system