GenomeNet

Database: Pfam
Entry: DUF5070
LinkDB: DUF5070
Original site: DUF5070 
#=GF ID   DUF5070
#=GF AC   PF16802.6
#=GF DE   Domain of unknown function (DUF5070)
#=GF AU   Eberhardt R;0000-0001-6152-1369
#=GF SE   PDB:3qh7
#=GF GA   25.00 25.00;
#=GF TC   25.00 95.30;
#=GF NC   21.80 21.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR031839;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF SQ   3
#=GS A0A0E2JC02_CHLPS/1-152  AC A0A0E2JC02.1
#=GS O84298_CHLTR/1-154      AC O84298.1
#=GS S7KIV5_9CHLA/1-116      AC S7KIV5.1
A0A0E2JC02_CHLPS/1-152             .MRFVLHLEHLRHFQNQGSILFEDLVSSNECFALEIKLKHFVESV--SKNTKDVRWRENIFRSLPQVSALVKKRRLDVFAANLVHRPRLSLVGDFWVFPGDKIVEREEDCQLLLCLSGEKIGHGVFFTGSYPTELYFPQENETALLLSFSSVGIP
O84298_CHLTR/1-154                 .MRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKEVAVVKDRHLQRWRENVHRTLPEVQMIVKRVRLDHLAAELTHRSRVALVRDLWVQKQEEIFFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFNWGAGDTAIILRFSSAGFP
S7KIV5_9CHLA/1-116                 m-------------------------------------KDFLKRV--SKNPTDVRWRENIFRSLPSVVSVVKKQRLLNYAADLVHRPRLSLVRDFWIFSGELVPTWEEDCQLFLCLSGGNCGQGVFFRDEYPASLLSLNEGETGLLLGFSSTGLP
#=GC seq_cons                      .MRhVLHLEHhRaFQNpGpILFEsLssss-ChtLEhcLKcFLKcV..SKNs+DVRWRENIFRSLPpVsulVKKpRLDsaAA-LVHRPRLSLVRDFWVFsGEcIspcEEDCQLLLCLSGEKsGaGVFFoGEYPs-LashsEGETALLLuFSSsGlP
//
DBGET integrated database retrieval system