GenomeNet

Database: Pfam
Entry: DUF747
LinkDB: DUF747
Original site: DUF747 
#=GF ID   DUF747
#=GF AC   PF05346.12
#=GF DE   Eukaryotic membrane protein family
#=GF AU   Wood V;0000-0001-6330-7526
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Murphy T;
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   Pfam-B_13582 (release 7.8)
#=GF GA   25.00 25.00;
#=GF TC   25.50 25.10;
#=GF NC   21.30 24.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   10640539
#=GF RT   Cloning and epitope mapping of a functional partial fusion
#=GF RT   receptor for human cytomegalovirus gH. 
#=GF RA   Baldwin BR, Zhang CO, Keay S; 
#=GF RL   J Gen Virol 2000;81:27-35.
#=GF RN   [2]
#=GF RM   17151244
#=GF RT   Mutation of a ubiquitously expressed mouse transmembrane protein
#=GF RT   (Tapt1) causes specific skeletal homeotic transformations. 
#=GF RA   Howell GR, Shindo M, Murray S, Gridley T, Wilson LA, Schimenti
#=GF RA   JC; 
#=GF RL   Genetics. 2007;175:699-707.
#=GF DR   INTERPRO; IPR008010;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family is a family of eukaryotic membrane proteins.  It was
#=GF CC   previously annotated as including a putative receptor for human
#=GF CC   cytomegalovirus gH [1] but this has has since been disputed [2].
#=GF CC   Analysis of the mouse Tapt1 protein (transmembrane anterior
#=GF CC   posterior transformation 1) has shown it to be involved in
#=GF CC   patterning of the vertebrate axial skeleton.
#=GF SQ   1521
#=GS A0A287N3T1_HORVV/302-401    AC A0A287N3T1.1
#=GS A0A0D9RV92_CHLSB/262-566    AC A0A0D9RV92.1
#=GS A0A1L9V1M9_ASPBC/530-954    AC A0A1L9V1M9.1
#=GS G4V1J3_NEUT9/482-911        AC G4V1J3.1
#=GS A0A212FJL3_DANPL/140-443    AC A0A212FJL3.1
#=GS Q4QIS9_LEIMA/122-495        AC Q4QIS9.1
#=GS A0A1S9DNK3_ASPOZ/565-988    AC A0A1S9DNK3.1
#=GS S7RS40_GLOTA/413-735        AC S7RS40.1
#=GS A3LUY6_PICST/104-437        AC A3LUY6.2
#=GS B9SNG4_RICCO/279-353        AC B9SNG4.1
#=GS G0V9N6_NAUCC/118-426        AC G0V9N6.1
#=GS Q4WHS2_ASPFU/514-937        AC Q4WHS2.1
#=GS A0A2Y9JLN7_ENHLU/54-358     AC A0A2Y9JLN7.1
#=GS A0A445DRJ2_ARAHY/312-462    AC A0A445DRJ2.1
#=GS G5BGC5_HETGA/89-393         AC G5BGC5.1
#=GS A0A093XFM9_9PEZI/1680-2083  AC A0A093XFM9.1
#=GS A0A287N3S5_HORVV/203-303    AC A0A287N3S5.1
#=GS A0A316W179_9BASI/578-964    AC A0A316W179.1
#=GS A0A3S3NNU5_9MAGN/301-608    AC A0A3S3NNU5.1
#=GS G9MES9_HYPVG/212-616        AC G9MES9.1
#=GS POD1_ARATH/303-611          AC F4HVJ3.1
#=GS A0A287N3L1_HORVV/313-412    AC A0A287N3L1.1
#=GS A0A287N3R0_HORVV/1-119      AC A0A287N3R0.1
#=GS A0A4D8Z8L4_SALSN/279-588    AC A0A4D8Z8L4.1
#=GS A0A165A2W6_9AGAM/156-508    AC A0A165A2W6.1
#=GS A0A1E3QWR3_9ASCO/117-453    AC A0A1E3QWR3.1
#=GS A0A151J8R8_9HYME/165-474    AC A0A151J8R8.1
#=GS A0A2D3VE27_9PEZI/407-801    AC A0A2D3VE27.1
#=GS W7N0I2_GIBM7/476-884        AC W7N0I2.1
#=GS A0A0J9XER4_GEOCN/239-626    AC A0A0J9XER4.1
#=GS A0A072UZZ6_MEDTR/287-446    AC A0A072UZZ6.1
#=GS A0A0B7ND75_9FUNG/243-659    AC A0A0B7ND75.1
#=GS A0A1S3BIB0_CUCME/316-624    AC A0A1S3BIB0.1
#=GS C1G8N7_PARBD/671-1095       AC C1G8N7.2
#=GS A0A3S4C7R7_9PEZI/463-886    AC A0A3S4C7R7.1
#=GS D0NR04_PHYIT/205-502        AC D0NR04.1
#=GS G0S8P9_CHATD/424-840        AC G0S8P9.1
#=GS A0A0A2IF76_PENEN/494-920    AC A0A0A2IF76.1
#=GS A0A2H2IEK8_CAEJA/222-574    AC A0A2H2IEK8.1
#=GS A0A1V8TQ48_9PEZI/436-839    AC A0A1V8TQ48.1
#=GS S9W727_SCHCR/236-603        AC S9W727.1
#=GS W0T7P6_KLUMD/120-432        AC W0T7P6.1
#=GS A0A1B9I6M1_9TREE/314-673    AC A0A1B9I6M1.1
#=GS A0A1I8EFG0_WUCBA/206-369    AC A0A1I8EFG0.1
#=GS A0A1Y2ATI3_9TREE/422-773    AC A0A1Y2ATI3.1
#=GS A0A3Q3GG50_9LABR/153-457    AC A0A3Q3GG50.1
#=GS A0A091HJB8_CALAN/90-406     AC A0A091HJB8.1
#=GS B8N2A9_ASPFN/565-988        AC B8N2A9.1
#=GS A0A0P7BPK6_9HYPO/980-1387   AC A0A0P7BPK6.1
#=GS TAPT1_HUMAN/155-459         AC Q6NXT6.1
#=GS A0A072UZ37_MEDTR/141-491    AC A0A072UZ37.1
#=GS I4YAU8_WALMC/1-329          AC I4YAU8.1
#=GS A0A0L8I5D7_OCTBM/156-459    AC A0A0L8I5D7.1
#=GS M7Z694_TRIUA/197-248        AC M7Z694.1
#=GS A0A2T4BRJ3_TRILO/489-893    AC A0A2T4BRJ3.1
#=GS A0A3Q2WNA6_HAPBU/146-450    AC A0A3Q2WNA6.1
#=GS A0A150G4V9_GONPE/291-520    AC A0A150G4V9.1
#=GS A0A1Y1W3U7_9FUNG/548-652    AC A0A1Y1W3U7.1
#=GS I1JXD0_SOYBN/282-590        AC I1JXD0.2
#=GS A0A199W1Y5_ANACO/325-504    AC A0A199W1Y5.1
#=GS A0A3B4WSV4_SERLL/152-456    AC A0A3B4WSV4.1
#=GS I0YRI2_COCSC/96-413         AC I0YRI2.1
#=GS A0A0D2BBG0_9EURO/470-887    AC A0A0D2BBG0.1
#=GS A0A3F3QBD6_9EURO/937-1361   AC A0A3F3QBD6.1
#=GS A0A1W2TX90_ROSNE/523-925    AC A0A1W2TX90.1
#=GS A0A3B4WI13_SERLL/163-467    AC A0A3B4WI13.1
#=GS A0A367XXM9_9ASCO/58-191     AC A0A367XXM9.1
#=GS A0A2K6PJG8_RHIRO/154-458    AC A0A2K6PJG8.1
#=GS A0A1X7RSD3_ZYMTR/407-814    AC A0A1X7RSD3.1
#=GS A0A1L8HTF0_XENLA/134-438    AC A0A1L8HTF0.1
#=GS A0A2I4G1Y6_JUGRE/387-695    AC A0A2I4G1Y6.1
#=GS A0A1D6GJ48_MAIZE/282-599    AC A0A1D6GJ48.1
#=GS A0A1M8AC97_MALS4/272-631    AC A0A1M8AC97.1
#=GS A0A087R1R7_APTFO/89-393     AC A0A087R1R7.1
#=GS A0A498HFX0_MALDO/342-541    AC A0A498HFX0.1
#=GS V7AZE8_PHAVU/273-581        AC V7AZE8.1
#=GS A0A109FBV4_9BASI/92-455     AC A0A109FBV4.1
#=GS A0A0L0S3Z8_ALLM3/1-338      AC A0A0L0S3Z8.1
#=GS A0A091UZE1_NIPNI/89-393     AC A0A091UZE1.1
#=GS B8AQN7_ORYSI/276-576        AC B8AQN7.1
#=GS A0A1S8W4W3_9FUNG/315-747    AC A0A1S8W4W3.1
#=GS A0A2K3N530_TRIPR/159-233    AC A0A2K3N530.1
#=GS A0A0W0GBZ2_9AGAR/173-532    AC A0A0W0GBZ2.1
#=GS A0A2V3J241_9FLOR/176-487    AC A0A2V3J241.1
#=GS A0A154PK23_DUFNO/420-722    AC A0A154PK23.1
#=GS A0A072PKF7_9EURO/480-899    AC A0A072PKF7.1
#=GS B7PHF4_IXOSC/54-356         AC B7PHF4.1
#=GS A0A095CDV6_CRYGR/298-401    AC A0A095CDV6.1
#=GS A0A1R3GRV6_COCAP/296-347    AC A0A1R3GRV6.1
#=GS W9WWD3_9EURO/478-895        AC W9WWD3.1
#=GS A0A1Y2BRK8_9FUNG/248-730    AC A0A1Y2BRK8.1
#=GS A0A498I6S3_MALDO/293-587    AC A0A498I6S3.1
#=GS A0A0D2H6P5_9EURO/484-901    AC A0A0D2H6P5.1
#=GS A0A3L8SV16_CHLGU/10-254     AC A0A3L8SV16.1
#=GS A0A0V0ZXU9_9BILA/126-436    AC A0A0V0ZXU9.1
#=GS S0DYW9_GIBF5/476-884        AC S0DYW9.1
#=GS A0A0D2AHR6_9EURO/475-892    AC A0A0D2AHR6.1
#=GS A0A0D2RGT0_GOSRA/292-487    AC A0A0D2RGT0.1
#=GS A0A2N5U036_9BASI/106-532    AC A0A2N5U036.1
#=GS L8G301_PSED2/488-891        AC L8G301.1
#=GS A0A395IDS6_ASPHC/506-928    AC A0A395IDS6.1
#=GS C3Y6T6_BRAFL/87-391         AC C3Y6T6.1
#=GS F1PQT8_CANLF/357-661        AC F1PQT8.2
#=GS A0A2I0MN86_COLLI/16-320     AC A0A2I0MN86.1
#=GS A0A3B3Y556_9TELE/148-452    AC A0A3B3Y556.1
#=GS A0A210QSL0_MIZYE/121-425    AC A0A210QSL0.1
#=GS G4ZK70_PHYSP/209-506        AC G4ZK70.1
#=GS A0A1E1KDY8_9HELO/536-925    AC A0A1E1KDY8.1
#=GS A0A2V1BQB4_9HELO/512-896    AC A0A2V1BQB4.1
#=GS I3N3A7_ICTTR/88-392         AC I3N3A7.2
#=GS A0A0A2KXZ6_PENIT/498-929    AC A0A0A2KXZ6.1
#=GS A0A369J834_HYPMA/239-596    AC A0A369J834.1
#=GS A0A061E9M6_THECC/291-451    AC A0A061E9M6.1
#=GS A0A151T1Y6_CAJCA/217-507    AC A0A151T1Y6.1
#=GS A0A2P7YZH0_9ASCO/187-519    AC A0A2P7YZH0.1
#=GS L2FM54_COLFN/546-954        AC L2FM54.1
#=GS A0A364L251_9EURO/491-918    AC A0A364L251.1
#=GS F0ZW42_DICPU/356-671        AC F0ZW42.1
#=GS A0A0N1INF9_PAPXU/138-448    AC A0A0N1INF9.1
#=GS A0A0L7REA6_9HYME/149-456    AC A0A0L7REA6.1
#=GS A0A0R0J9R9_SOYBN/271-470    AC A0A0R0J9R9.1
#=GS W2JJI2_PHYPR/253-550        AC W2JJI2.1
#=GS A0A0D1ZUI0_9EURO/472-889    AC A0A0D1ZUI0.1
#=GS N1Q8R6_PSEFD/201-609        AC N1Q8R6.1
#=GS G8BRY7_TETPH/151-473        AC G8BRY7.1
#=GS H2YLP4_CIOSA/230-361        AC H2YLP4.1
#=GS A0A194WXL8_9HELO/464-857    AC A0A194WXL8.1
#=GS A0A2H3F3F4_9HELO/499-616    AC A0A2H3F3F4.1
#=GS A0A2I0XJ69_9ASPA/274-587    AC A0A2I0XJ69.1
#=GS H2LUY7_ORYLA/218-522        AC H2LUY7.2
#=GS A0A3P8TR69_AMPPE/179-483    AC A0A3P8TR69.1
#=GS A0A0C3DZD2_9AGAM/161-519    AC A0A0C3DZD2.1
#=GS H2YLP4_CIOSA/83-235         AC H2YLP4.1
#=GS A0A151GVE2_9HYPO/539-946    AC A0A151GVE2.1
#=GS S8DX91_FOMPI/130-493        AC S8DX91.1
#=GS A0A2N6NQI9_BEABA/543-957    AC A0A2N6NQI9.1
#=GS A0A1S3SSN5_SALSA/153-457    AC A0A1S3SSN5.1
#=GS A0A444ZWR8_ARAHY/265-557    AC A0A444ZWR8.1
#=GS A0A0J8QSS9_COCIT/643-721    AC A0A0J8QSS9.1
#=GS A0A0R0JIG8_SOYBN/279-581    AC A0A0R0JIG8.1
#=GS A8N7H3_COPC7/231-593        AC A8N7H3.2
#=GS A0A3D8RMG8_9HELO/500-896    AC A0A3D8RMG8.1
#=GS A0A1Q3E3E0_LENED/57-436     AC A0A1Q3E3E0.1
#=GS A0A0E0GSV9_ORYNI/276-570    AC A0A0E0GSV9.1
#=GS A0A319EUF1_ASPSB/529-953    AC A0A319EUF1.1
#=GS A0A2R8QA95_DANRE/152-456    AC A0A2R8QA95.1
#=GS C5WN07_SORBI/284-592        AC C5WN07.2
#=GS A0A093QIW3_9PASS/89-393     AC A0A093QIW3.1
#=GS A0A0S7DNT9_9EURO/512-935    AC A0A0S7DNT9.1
#=GS A0A2H3JNI4_WOLCO/130-493    AC A0A2H3JNI4.1
#=GS K1RDF0_CRAGI/121-440        AC K1RDF0.1
#=GS A0A0V0TYW5_9BILA/124-434    AC A0A0V0TYW5.1
#=GS G8JNL6_ERECY/105-416        AC G8JNL6.1
#=GS A0A165TLJ9_9AGAM/230-586    AC A0A165TLJ9.1
#=GS A0A151ZI49_9MYCE/657-1001   AC A0A151ZI49.1
#=GS A0A3M0KSF1_HIRRU/208-385    AC A0A3M0KSF1.1
#=GS M1VZL3_CLAP2/564-971        AC M1VZL3.1
#=GS J9K7S7_ACYPI/105-409        AC J9K7S7.1
#=GS A0A3P6H9D0_9CEST/1-216      AC A0A3P6H9D0.1
#=GS A0A182EU65_ONCOC/13-294     AC A0A182EU65.1
#=GS A0A194WB55_9PEZI/548-962    AC A0A194WB55.1
#=GS A0A2K6PJG1_RHIRO/96-400     AC A0A2K6PJG1.1
#=GS A0A3M2S1Z7_9HYPO/504-910    AC A0A3M2S1Z7.1
#=GS A0A0D7BKJ8_9AGAR/148-471    AC A0A0D7BKJ8.1
#=GS A0A2H3HVK2_FUSOX/478-841    AC A0A2H3HVK2.1
#=GS A0A287A5J1_PIG/97-401       AC A0A287A5J1.1
#=GS A0A1R1X2D8_9FUNG/330-817    AC A0A1R1X2D8.1
#=GS A0A287N3P7_HORVV/286-385    AC A0A287N3P7.1
#=GS A0A3Q3S7X4_9TELE/148-452    AC A0A3Q3S7X4.1
#=GS M7NW34_PNEMU/219-574        AC M7NW34.1
#=GS A0A166X8J7_9AGAM/125-484    AC A0A166X8J7.1
#=GS A0A2K5XP15_MANLE/88-304     AC A0A2K5XP15.1
#=GS A0A2I2FL70_9EURO/157-581    AC A0A2I2FL70.1
#=GS E3QKI9_COLGM/525-933        AC E3QKI9.1
#=GS A0A2Z6QQC6_9GLOM/122-486    AC A0A2Z6QQC6.1
#=GS A0A1R0GND0_9FUNG/380-684    AC A0A1R0GND0.1
#=GS A0A1J7J864_9PEZI/592-925    AC A0A1J7J864.1
#=GS A0A024TUS5_9STRA/165-335    AC A0A024TUS5.1
#=GS G3PWI8_GASAC/113-417        AC G3PWI8.1
#=GS A0A1B8DWD9_9PEZI/488-891    AC A0A1B8DWD9.1
#=GS A0A3Q0KTC9_SCHMA/139-453    AC A0A3Q0KTC9.1
#=GS A0A1V9ZSK3_9STRA/170-473    AC A0A1V9ZSK3.1
#=GS A0A453H7S5_AEGTS/323-448    AC A0A453H7S5.1
#=GS A0A2P5PYG3_GOSBA/60-256     AC A0A2P5PYG3.1
#=GS A0A2U4ASQ8_TURTR/351-655    AC A0A2U4ASQ8.1
#=GS A0A0P8YMH3_DROAN/174-478    AC A0A0P8YMH3.1
#=GS A0A093Y385_9PEZI/1657-2060  AC A0A093Y385.1
#=GS A0A0V1DB82_TRIBR/126-436    AC A0A0V1DB82.1
#=GS A0A3F2XYJ6_DEKBR/187-542    AC A0A3F2XYJ6.1
#=GS S7RS40_GLOTA/356-411        AC S7RS40.1
#=GS A0A0Q9X1H0_DROWI/156-460    AC A0A0Q9X1H0.1
#=GS A0A0D2XIR8_FUSO4/478-670    AC A0A0D2XIR8.1
#=GS A0A314ZKV9_PRUYE/374-579    AC A0A314ZKV9.1
#=GS I1KCA1_SOYBN/279-587        AC I1KCA1.2
#=GS A0A182PE05_9DIPT/166-470    AC A0A182PE05.1
#=GS A0A2P4ZTT1_9HYPO/500-905    AC A0A2P4ZTT1.1
#=GS S2KAD5_MUCC1/230-629        AC S2KAD5.1
#=GS A0A267EYE3_9PLAT/119-418    AC A0A267EYE3.1
#=GS A0A2T9YUY8_9FUNG/385-857    AC A0A2T9YUY8.1
#=GS A0A0N4VBY0_ENTVE/186-498    AC A0A0N4VBY0.1
#=GS A0A4P1R2T6_LUPAN/74-528     AC A0A4P1R2T6.1
#=GS A0A1B8CIV4_9PEZI/488-891    AC A0A1B8CIV4.1
#=GS A0A177U5V5_9BASI/597-770    AC A0A177U5V5.1
#=GS A0A044UI72_ONCVO/132-405    AC A0A044UI72.1
#=GS H2XTB6_CIOIN/107-410        AC H2XTB6.1
#=GS A0A1B8D966_9PEZI/488-891    AC A0A1B8D966.1
#=GS A0A1S3SSM3_SALSA/44-348     AC A0A1S3SSM3.1
#=GS A0A3P8ZF81_ESOLU/161-465    AC A0A3P8ZF81.1
#=GS A0A0B2VLR8_TOXCA/91-392     AC A0A0B2VLR8.1
#=GS A0A3Q3VV93_MOLML/102-406    AC A0A3Q3VV93.1
#=GS A0A3N4IKI2_ASCIM/416-796    AC A0A3N4IKI2.1
#=GS A0A3Q1D1Z5_AMPOC/168-476    AC A0A3Q1D1Z5.1
#=GS A0A2P5HTY9_9PEZI/560-993    AC A0A2P5HTY9.1
#=GS A0A1R1XPR4_9FUNG/330-817    AC A0A1R1XPR4.1
#=GS Q0CJR2_ASPTN/523-947        AC Q0CJR2.1
#=GS A0A401GGB7_9APHY/219-581    AC A0A401GGB7.1
#=GS V3ZUJ8_LOTGI/90-393         AC V3ZUJ8.1
#=GS A0A1L9R6K4_ASPWE/607-1033   AC A0A1L9R6K4.1
#=GS C4M0T8_ENTHI/120-425        AC C4M0T8.1
#=GS A0A453H7S9_AEGTS/21-329     AC A0A453H7S9.1
#=GS A0A444ZWU0_ARAHY/341-547    AC A0A444ZWU0.1
#=GS W4GDR1_9STRA/142-441        AC W4GDR1.1
#=GS A0A1Y2FJ93_9FUNG/275-663    AC A0A1Y2FJ93.1
#=GS A0A0L0FQH4_9EUKA/36-342     AC A0A0L0FQH4.1
#=GS R9ARA3_WALI9/94-454         AC R9ARA3.1
#=GS A0A1S3D001_DIACI/3-162      AC A0A1S3D001.1
#=GS A0A3Q0H579_ALLSI/39-343     AC A0A3Q0H579.1
#=GS A0A194PM24_PAPXU/138-441    AC A0A194PM24.1
#=GS A0A072VA13_MEDTR/287-533    AC A0A072VA13.1
#=GS A0A2H9TFG8_9FUNG/8-50       AC A0A2H9TFG8.1
#=GS U5HJK1_USTV1/362-736        AC U5HJK1.1
#=GS A0A2T3B1M7_AMORE/356-753    AC A0A2T3B1M7.1
#=GS A0A3B4AYD1_9GOBI/148-452    AC A0A3B4AYD1.1
#=GS A0A445C2G7_ARAHY/301-380    AC A0A445C2G7.1
#=GS A0A3M6USH3_9CNID/314-491    AC A0A3M6USH3.1
#=GS A0A1J6JT76_NICAT/5-162      AC A0A1J6JT76.1
#=GS B0D1B5_LACBS/230-591        AC B0D1B5.1
#=GS E3S743_PYRTT/466-872        AC E3S743.1
#=GS C9SYQ1_VERA1/429-836        AC C9SYQ1.1
#=GS A0A2H3F3F4_9HELO/451-501    AC A0A2H3F3F4.1
#=GS A0A2P6R3I6_ROSCH/281-575    AC A0A2P6R3I6.1
#=GS E9EQG6_METRA/501-908        AC E9EQG6.2
#=GS A0A3P6P9A6_CAEEL/1-182      AC A0A3P6P9A6.1
#=GS A0A2A2J735_9BILA/244-547    AC A0A2A2J735.1
#=GS A0A364NHG8_9PLEO/555-963    AC A0A364NHG8.1
#=GS A0A3B3TRT5_9TELE/152-456    AC A0A3B3TRT5.1
#=GS C1EEN9_MICCC/111-460        AC C1EEN9.1
#=GS A0A445C2H6_ARAHY/482-638    AC A0A445C2H6.1
#=GS A0A0M8N8C3_9HYPO/5-413      AC A0A0M8N8C3.1
#=GS A0A453H7R8_AEGTS/1-286      AC A0A453H7R8.1
#=GS A0A3B4WRW5_SERLL/148-452    AC A0A3B4WRW5.1
#=GS A0A401PLA8_SCYTO/88-392     AC A0A401PLA8.1
#=GS A0A074RT21_9AGAM/229-578    AC A0A074RT21.1
#=GS A9UYW0_MONBE/129-433        AC A9UYW0.1
#=GS A0A1E3Q0D5_LIPST/135-498    AC A0A1E3Q0D5.1
#=GS A0A2D0RJD0_ICTPU/58-362     AC A0A2D0RJD0.1
#=GS K1VHZ3_TRIAC/321-633        AC K1VHZ3.1
#=GS A0A3B3SXT9_9TELE/116-420    AC A0A3B3SXT9.1
#=GS A0A024TSW5_9STRA/165-277    AC A0A024TSW5.1
#=GS F7F820_MONDO/186-490        AC F7F820.2
#=GS U7Q609_SPOS1/502-923        AC U7Q609.1
#=GS A0A2I2ZQB9_GORGO/176-480    AC A0A2I2ZQB9.1
#=GS A0A3Q4GMT9_NEOBR/146-450    AC A0A3Q4GMT9.1
#=GS M3XT23_MUSPF/54-358         AC M3XT23.1
#=GS A0A182F718_ANOAL/166-470    AC A0A182F718.1
#=GS M3HEQ5_CANMX/177-504        AC M3HEQ5.1
#=GS A0A1Y1XAV7_9FUNG/408-813    AC A0A1Y1XAV7.1
#=GS K0KHR9_WICCF/141-472        AC K0KHR9.1
#=GS A0A068YFZ9_ECHMU/127-460    AC A0A068YFZ9.1
#=GS G8ZPL3_TORDC/122-434        AC G8ZPL3.1
#=GS F1MN55_BOVIN/151-455        AC F1MN55.3
#=GS A0A1U8NDL8_GOSHI/237-545    AC A0A1U8NDL8.1
#=GS A0A182G0L7_AEDAL/178-482    AC A0A182G0L7.1
#=GS A0A0G4KV86_9PEZI/489-880    AC A0A0G4KV86.1
#=GS A0A3E2HA67_SCYLI/889-1289   AC A0A3E2HA67.1
#=GS A0A1A6A8Y0_9TREE/313-673    AC A0A1A6A8Y0.1
#=GS A0A3B3QKE0_9TELE/163-467    AC A0A3B3QKE0.1
#=GS M0T627_MUSAM/282-594        AC M0T627.1
#=GS A0A1U8B4Z9_NELNU/315-509    AC A0A1U8B4Z9.1
#=GS A0A1A9X1M6_9MUSC/129-211    AC A0A1A9X1M6.1
#=GS A0A0J9X301_GEOCN/277-610    AC A0A0J9X301.1
#=GS F2SLW9_TRIRC/564-1002       AC F2SLW9.1
#=GS A0A3B4BS61_PYGNA/152-456    AC A0A3B4BS61.1
#=GS G3I7L5_CRIGR/1-135          AC G3I7L5.1
#=GS A0A2T2P7V3_CORCC/476-882    AC A0A2T2P7V3.1
#=GS A0A1X2GDD4_9FUNG/226-628    AC A0A1X2GDD4.1
#=GS A0A0G4IS94_PLABS/83-393     AC A0A0G4IS94.1
#=GS A0A0D0E0S4_9AGAM/204-564    AC A0A0D0E0S4.1
#=GS A0A1L9PA94_ASPVE/1061-1491  AC A0A1L9PA94.1
#=GS W4GFT2_9STRA/142-430        AC W4GFT2.1
#=GS A0A0A1NSK0_RHIZD/1-362      AC A0A0A1NSK0.1
#=GS A0A3B4ESG0_9CICH/206-322    AC A0A3B4ESG0.1
#=GS D7FP16_ECTSI/732-1038       AC D7FP16.1
#=GS A0A2U9R2C7_PICKU/86-370     AC A0A2U9R2C7.1
#=GS A0A177CZ34_9PLEO/465-872    AC A0A177CZ34.1
#=GS A0A1U7LGH9_NEOID/122-482    AC A0A1U7LGH9.1
#=GS A0A383YWZ6_BALAS/14-318     AC A0A383YWZ6.1
#=GS A0A409VGR0_9AGAR/231-592    AC A0A409VGR0.1
#=GS A0A166MZG5_EXIGL/176-529    AC A0A166MZG5.1
#=GS A4H4V9_LEIBR/128-501        AC A4H4V9.2
#=GS A0A3B4TZL6_SERDU/152-456    AC A0A3B4TZL6.1
#=GS A0A1J7IRN0_LUPAN/379-584    AC A0A1J7IRN0.1
#=GS M7Z694_TRIUA/246-457        AC M7Z694.1
#=GS A0A0A1NLE6_RHIZD/1-378      AC A0A0A1NLE6.1
#=GS A0A1E5R731_HANUV/142-571    AC A0A1E5R731.1
#=GS J9JXN6_ACYPI/104-409        AC J9JXN6.1
#=GS K7ETY9_PONAB/44-348         AC K7ETY9.1
#=GS A0A3Q0HSH7_PHODC/243-551    AC A0A3Q0HSH7.1
#=GS A0A445DWK0_ARAHY/301-419    AC A0A445DWK0.1
#=GS A0A0J6Y0C6_COCIT/543-893    AC A0A0J6Y0C6.1
#=GS TAPT1_DICDI/468-787         AC Q550C1.2
#=GS A0A218Z295_9HELO/547-947    AC A0A218Z295.1
#=GS A0A423VAI2_9PEZI/90-522     AC A0A423VAI2.1
#=GS A0A074XIQ6_9PEZI/141-548    AC A0A074XIQ6.1
#=GS A0A1G4MKI5_LACFM/102-413    AC A0A1G4MKI5.1
#=GS A0A1V4JFM7_PATFA/155-459    AC A0A1V4JFM7.1
#=GS A0A166IE44_9AGAM/156-508    AC A0A166IE44.1
#=GS W2TXJ3_NECAM/94-397         AC W2TXJ3.1
#=GS A0A158PZ58_BRUMA/1-222      AC A0A158PZ58.2
#=GS A0A139HYM4_9PEZI/392-800    AC A0A139HYM4.1
#=GS A0A2K3PRM3_TRIPR/138-195    AC A0A2K3PRM3.1
#=GS A0A453H805_AEGTS/21-211     AC A0A453H805.1
#=GS A0A2T6ZPU8_TUBBO/484-864    AC A0A2T6ZPU8.1
#=GS A0A0D2GIX7_9EURO/470-888    AC A0A0D2GIX7.1
#=GS A0A1G4KHP7_9SACH/107-417    AC A0A1G4KHP7.1
#=GS A0A1S3U8I8_VIGRR/273-581    AC A0A1S3U8I8.1
#=GS S3CNK7_OPHP1/539-955        AC S3CNK7.1
#=GS A0A420HCW8_9PEZI/491-891    AC A0A420HCW8.1
#=GS A0A0D2V8I1_GOSRA/260-368    AC A0A0D2V8I1.1
#=GS A0A074XNJ7_AURPU/416-820    AC A0A074XNJ7.1
#=GS A0A0Q9X731_DROMO/161-465    AC A0A0Q9X731.1
#=GS A0A0C3GYY8_9PEZI/399-799    AC A0A0C3GYY8.1
#=GS A0A0V0Y6M2_TRIPS/124-173    AC A0A0V0Y6M2.1
#=GS G0N0K4_CAEBE/385-691        AC G0N0K4.1
#=GS A0A1X6ND26_9APHY/187-550    AC A0A1X6ND26.1
#=GS I1PIC8_ORYGL/275-583        AC I1PIC8.1
#=GS A0A0Q3JNF9_BRADI/274-582    AC A0A0Q3JNF9.1
#=GS A0A1D1UQX9_RAMVA/188-495    AC A0A1D1UQX9.1
#=GS A0A1B9GCW3_9TREE/335-694    AC A0A1B9GCW3.1
#=GS A0A1Y2FHM2_9FUNG/439-844    AC A0A1Y2FHM2.1
#=GS A0A091JFF5_EGRGA/89-393     AC A0A091JFF5.1
#=GS A0A024GSK8_9STRA/837-1065   AC A0A024GSK8.1
#=GS S8BNT2_DACHA/396-802        AC S8BNT2.1
#=GS H2PCZ0_PONAB/125-429        AC H2PCZ0.1
#=GS A0A0D0BPM7_9AGAM/200-564    AC A0A0D0BPM7.1
#=GS A0A443RW81_9ACAR/3-198      AC A0A443RW81.1
#=GS A0A397YPZ9_BRACM/279-587    AC A0A397YPZ9.1
#=GS A0A2A9M1U3_9APIC/2890-3207  AC A0A2A9M1U3.1
#=GS A0A1V6QFZ1_9EURO/494-920    AC A0A1V6QFZ1.1
#=GS A0A397U416_9GLOM/104-391    AC A0A397U416.1
#=GS A0A287N3M5_HORVV/270-502    AC A0A287N3M5.1
#=GS A0A423VWT2_9PEZI/90-522     AC A0A423VWT2.1
#=GS A0A068RSS7_9FUNG/216-605    AC A0A068RSS7.1
#=GS A0A2J5I289_9EURO/564-988    AC A0A2J5I289.1
#=GS R1DFC0_EMIHU/125-247        AC R1DFC0.1
#=GS A0A1M2VXF6_TRAPU/220-581    AC A0A1M2VXF6.1
#=GS A0A179UL79_BLAGS/554-980    AC A0A179UL79.1
#=GS A0A1V6SNK5_9EURO/484-909    AC A0A1V6SNK5.1
#=GS A0A445I6Z5_GLYSO/221-527    AC A0A445I6Z5.1
#=GS G0W6C7_NAUDC/129-438        AC G0W6C7.1
#=GS W4K7G8_9AGAM/118-510        AC W4K7G8.1
#=GS A0A1X2HQM7_SYNRA/224-607    AC A0A1X2HQM7.1
#=GS A0A0E0KI88_ORYPU/414-534    AC A0A0E0KI88.1
#=GS B6H6D7_PENRW/429-804        AC B6H6D7.1
#=GS A0A3G2S3S5_9BASI/240-591    AC A0A3G2S3S5.1
#=GS A0A096NZH3_PAPAN/155-459    AC A0A096NZH3.2
#=GS A0A182VRU2_9DIPT/572-876    AC A0A182VRU2.1
#=GS A0A3B4V7L2_SERDU/148-452    AC A0A3B4V7L2.1
#=GS A0A482VFV2_9CUCU/1-177      AC A0A482VFV2.1
#=GS F9FMG0_FUSOF/457-865        AC F9FMG0.1
#=GS A0A1Z5TB65_HORWE/439-848    AC A0A1Z5TB65.1
#=GS A0A1L9TXZ8_9EURO/1110-1540  AC A0A1L9TXZ8.1
#=GS A0A0C3S780_PHLGI/218-578    AC A0A0C3S780.1
#=GS A0A1V2L7Z8_CYBFA/120-447    AC A0A1V2L7Z8.1
#=GS A0A196SEK1_BLAHN/176-403    AC A0A196SEK1.1
#=GS A0A182XIS9_ANOQN/167-471    AC A0A182XIS9.1
#=GS F0UUA0_AJEC8/511-937        AC F0UUA0.1
#=GS A0A146F8I1_9EURO/529-953    AC A0A146F8I1.1
#=GS I3IYF3_ORENI/118-422        AC I3IYF3.1
#=GS A0A0B4LH99_DROME/166-470    AC A0A0B4LH99.1
#=GS A0A091W4G3_OPIHO/90-394     AC A0A091W4G3.1
#=GS A0A287N3T0_HORVV/301-457    AC A0A287N3T0.1
#=GS A0A095CDV6_CRYGR/399-626    AC A0A095CDV6.1
#=GS A0A3Q1I2Y6_ANATE/148-452    AC A0A3Q1I2Y6.1
#=GS G8B5I0_CANPC/247-577        AC G8B5I0.1
#=GS B2VW91_PYRTR/519-925        AC B2VW91.1
#=GS G3JCG0_CORMM/763-1173       AC G3JCG0.1
#=GS A0A251R761_PRUPE/288-523    AC A0A251R761.1
#=GS E5AES4_LEPMJ/35-441         AC E5AES4.1
#=GS A0A3B1JHW8_ASTMX/387-453    AC A0A3B1JHW8.1
#=GS A0A2A4J823_HELVI/141-444    AC A0A2A4J823.1
#=GS A0A368H075_ANCCA/156-507    AC A0A368H075.1
#=GS A0A067FBI0_CITSI/1-152      AC A0A067FBI0.1
#=GS A0A0C7MZB0_9SACH/114-427    AC A0A0C7MZB0.1
#=GS A0A2T5M7A1_9EURO/485-916    AC A0A2T5M7A1.1
#=GS A8Q818_MALGO/321-700        AC A8Q818.1
#=GS A0A1J7IRN0_LUPAN/304-383    AC A0A1J7IRN0.1
#=GS G3PY11_GASAC/113-417        AC G3PY11.1
#=GS A0A1U8BP41_NELNU/313-619    AC A0A1U8BP41.1
#=GS A0A0D3K0T4_EMIHU/1-164      AC A0A0D3K0T4.1
#=GS A0A1D6GJ47_MAIZE/282-478    AC A0A1D6GJ47.1
#=GS A0A453H804_AEGTS/292-563    AC A0A453H804.1
#=GS A0A167J9Z1_CALVF/185-520    AC A0A167J9Z1.1
#=GS E2B9V9_HARSA/158-452        AC E2B9V9.1
#=GS A0A0V1N4Q9_9BILA/124-424    AC A0A0V1N4Q9.1
#=GS W5PKF0_SHEEP/54-358         AC W5PKF0.1
#=GS A0A0F4YFM4_TALEM/350-774    AC A0A0F4YFM4.1
#=GS A0A1L8HKZ0_XENLA/136-440    AC A0A1L8HKZ0.1
#=GS A0A3Q0EG93_TARSY/54-358     AC A0A3Q0EG93.1
#=GS A0A3B4DC98_PYGNA/157-461    AC A0A3B4DC98.1
#=GS A0A0G4LAF0_9PEZI/534-941    AC A0A0G4LAF0.1
#=GS W5JUP6_ANODA/166-470        AC W5JUP6.1
#=GS A0A2G8KN22_STIJA/145-449    AC A0A2G8KN22.1
#=GS A0A3P9NMX2_POERE/163-467    AC A0A3P9NMX2.1
#=GS A0A0W4ZTZ1_PNEJ7/213-563    AC A0A0W4ZTZ1.1
#=GS A0A0L7L6X1_9NEOP/32-153     AC A0A0L7L6X1.1
#=GS A0A1S8BGD9_9PEZI/479-892    AC A0A1S8BGD9.1
#=GS A0A0P7UT22_SCLFO/152-456    AC A0A0P7UT22.1
#=GS A0A2H9TFH9_9FUNG/65-113     AC A0A2H9TFH9.1
#=GS S7W586_SPRLO/45-261         AC S7W586.1
#=GS A0A2K3QEI4_9HYPO/522-929    AC A0A2K3QEI4.1
#=GS A0A178EAI7_9PLEO/473-879    AC A0A178EAI7.1
#=GS A0A0K6G2X9_9AGAM/228-577    AC A0A0K6G2X9.1
#=GS A0A1L9VPU6_ASPGL/586-1011   AC A0A1L9VPU6.1
#=GS A0A084Q927_STAC4/487-888    AC A0A084Q927.1
#=GS A0A2D0QFX0_ICTPU/151-455    AC A0A2D0QFX0.1
#=GS A0A453H809_AEGTS/75-383     AC A0A453H809.1
#=GS A0A178ERB1_TRIRU/619-701    AC A0A178ERB1.1
#=GS A0A3L6TR03_PANMI/279-594    AC A0A3L6TR03.1
#=GS A0A061D451_BABBI/275-748    AC A0A061D451.1
#=GS A0A445L2A5_GLYSO/274-593    AC A0A445L2A5.1
#=GS A0A2C5Z6R6_9HYPO/379-820    AC A0A2C5Z6R6.1
#=GS A0A087YKU7_POEFO/163-467    AC A0A087YKU7.2
#=GS A0A2P6N0W4_9MYCE/343-641    AC A0A2P6N0W4.1
#=GS C7ZCK7_NECH7/505-913        AC C7ZCK7.1
#=GS A0A226MWH8_CALSU/67-188     AC A0A226MWH8.1
#=GS A0A226EWI0_FOLCA/102-407    AC A0A226EWI0.1
#=GS A0A3B6INW4_WHEAT/277-585    AC A0A3B6INW4.1
#=GS A0A445JZ60_GLYSO/301-486    AC A0A445JZ60.1
#=GS A0A3Q1FQP3_9TELE/163-467    AC A0A3Q1FQP3.1
#=GS A0A2J6RAV8_9HELO/431-834    AC A0A2J6RAV8.1
#=GS A0A3P8U1Z1_AMPPE/148-452    AC A0A3P8U1Z1.1
#=GS A0A0D8XWZ3_DICVI/164-451    AC A0A0D8XWZ3.1
#=GS A0A084RPV7_STACH/487-888    AC A0A084RPV7.1
#=GS A0A1W4WP78_AGRPL/150-454    AC A0A1W4WP78.1
#=GS F6WHI5_XENTR/90-394         AC F6WHI5.1
#=GS A0A0R0JBY8_SOYBN/21-331     AC A0A0R0JBY8.1
#=GS A0A162JHL1_9HYPO/542-948    AC A0A162JHL1.1
#=GS E9FXK9_DAPPU/103-406        AC E9FXK9.1
#=GS A0A0R3WMD6_HYDTA/1-164      AC A0A0R3WMD6.1
#=GS A0A179HPS7_PURLI/486-892    AC A0A179HPS7.1
#=GS A0A1V6PBM7_PENDC/483-909    AC A0A1V6PBM7.1
#=GS A0A225W063_9STRA/246-559    AC A0A225W063.1
#=GS A0A1Y3N6M4_PIRSE/101-393    AC A0A1Y3N6M4.1
#=GS A0A1B7NPG8_9EURO/542-886    AC A0A1B7NPG8.1
#=GS U9TFP3_RHIID/123-487        AC U9TFP3.1
#=GS A0A1S3EAQ2_CICAR/131-456    AC A0A1S3EAQ2.1
#=GS A0A094DRB1_9PEZI/1726-2129  AC A0A094DRB1.1
#=GS A0A0N5DQ97_TRIMR/119-424    AC A0A0N5DQ97.1
#=GS A0A067C1Q6_SAPPC/178-490    AC A0A067C1Q6.1
#=GS A0A2C9UFI2_MANES/285-593    AC A0A2C9UFI2.1
#=GS A0A498N979_LABRO/152-376    AC A0A498N979.1
#=GS A0A2P5D255_PARAD/312-601    AC A0A2P5D255.1
#=GS A0A0L0HMC3_SPIPD/211-670    AC A0A0L0HMC3.1
#=GS E2LYD6_MONPE/154-513        AC E2LYD6.1
#=GS A0A182LBX3_9DIPT/623-927    AC A0A182LBX3.1
#=GS M7TX95_BOTF1/529-921        AC M7TX95.1
#=GS A0A0D2XIR8_FUSO4/661-814    AC A0A0D2XIR8.1
#=GS A0A168JR26_CORDF/531-936    AC A0A168JR26.1
#=GS E6RE70_CRYGW/305-673        AC E6RE70.1
#=GS A0A509AQQ5_PLABA/671-1114   AC A0A509AQQ5.1
#=GS A0A177WR92_BATDL/214-624    AC A0A177WR92.1
#=GS A0A3B4U0B2_SERDU/152-456    AC A0A3B4U0B2.1
#=GS A0A453H7P0_AEGTS/1-114      AC A0A453H7P0.1
#=GS A0A395SGL7_FUSSP/480-887    AC A0A395SGL7.1
#=GS W5M5P8_LEPOC/152-456        AC W5M5P8.1
#=GS A0A3Q3A7R5_KRYMA/148-452    AC A0A3Q3A7R5.1
#=GS A0A3N4JEU3_9PEZI/493-873    AC A0A3N4JEU3.1
#=GS A0A2L2T5M7_9HYPO/478-885    AC A0A2L2T5M7.1
#=GS A0A498HFX0_MALDO/293-344    AC A0A498HFX0.1
#=GS W2QN13_PHYPN/253-550        AC W2QN13.1
#=GS A0A2A3E6F9_APICC/31-271     AC A0A2A3E6F9.1
#=GS A0A3B3U8T6_9TELE/152-456    AC A0A3B3U8T6.1
#=GS A0A183HCF8_9BILA/1-273      AC A0A183HCF8.1
#=GS J7RNQ8_KAZNA/133-457        AC J7RNQ8.1
#=GS A0A0R0JNQ4_SOYBN/279-431    AC A0A0R0JNQ4.1
#=GS A0A453H7N5_AEGTS/275-507    AC A0A453H7N5.1
#=GS T1H3U6_MEGSC/36-170         AC T1H3U6.1
#=GS A0A427Y085_9TREE/363-720    AC A0A427Y085.1
#=GS A0A0V1N550_9BILA/124-434    AC A0A0V1N550.1
#=GS A0A087XS57_POEFO/148-452    AC A0A087XS57.2
#=GS A0A2I0KSE9_PUNGR/165-368    AC A0A2I0KSE9.1
#=GS A0A0E0P0G4_ORYRU/276-570    AC A0A0E0P0G4.1
#=GS A0A2I0RY12_9PEZI/319-728    AC A0A2I0RY12.1
#=GS W9C8R8_SCLBF/528-920        AC W9C8R8.1
#=GS A0A074VNN9_9PEZI/145-552    AC A0A074VNN9.1
#=GS A0A3R7KXZ6_9STRA/1-289      AC A0A3R7KXZ6.1
#=GS A0A090L5T1_STRRB/185-487    AC A0A090L5T1.1
#=GS A0A445JZ60_GLYSO/222-303    AC A0A445JZ60.1
#=GS U3IIG2_ANAPP/200-522        AC U3IIG2.1
#=GS U5HJK2_USTV1/321-695        AC U5HJK2.1
#=GS A0A3B3Y2I6_9TELE/152-456    AC A0A3B3Y2I6.1
#=GS T1FP35_HELRO/134-438        AC T1FP35.1
#=GS A0A3P9AZB5_9CICH/152-456    AC A0A3P9AZB5.1
#=GS A0A287N3R5_HORVV/292-391    AC A0A287N3R5.1
#=GS A0A1S3SSL9_SALSA/96-400     AC A0A1S3SSL9.1
#=GS A0A3Q0CNF6_MESAU/152-456    AC A0A3Q0CNF6.1
#=GS A0A1V6TRE4_9EURO/507-933    AC A0A1V6TRE4.1
#=GS A0A2K6BJV9_MACNE/130-434    AC A0A2K6BJV9.1
#=GS A0A287N3S6_HORVV/112-420    AC A0A287N3S6.1
#=GS A0A103XT24_CYNCS/322-616    AC A0A103XT24.1
#=GS S6E8L2_ZYGB2/126-436        AC S6E8L2.1
#=GS A0A2I2GRS0_9EURO/570-995    AC A0A2I2GRS0.1
#=GS A0A484AVB3_DRONA/161-465    AC A0A484AVB3.1
#=GS A0A0S6XRN5_9FUNG/448-860    AC A0A0S6XRN5.1
#=GS A0A2K5I200_COLAP/88-392     AC A0A2K5I200.1
#=GS A0A2U9C571_SCOMX/154-458    AC A0A2U9C571.1
#=GS A0A1B0BSA4_9MUSC/161-454    AC A0A1B0BSA4.1
#=GS C5E2U6_LACTC/104-414        AC C5E2U6.1
#=GS A0A1Q5Q7P6_9EURO/494-921    AC A0A1Q5Q7P6.1
#=GS A0A445DRE1_ARAHY/1-280      AC A0A445DRE1.1
#=GS A0A067F0F4_CITSI/291-440    AC A0A067F0F4.1
#=GS W1Q9W7_OGAPD/133-472        AC W1Q9W7.1
#=GS A0A094JV28_9PEZI/1717-2120  AC A0A094JV28.1
#=GS A0A0F7VJ15_9EURO/496-922    AC A0A0F7VJ15.1
#=GS A0A3Q1HFI6_ANATE/152-456    AC A0A3Q1HFI6.1
#=GS A0A0V1LH08_9BILA/124-434    AC A0A0V1LH08.1
#=GS A0A3N4LHI0_9PEZI/201-616    AC A0A3N4LHI0.1
#=GS A0A1C7LYY3_GRIFR/185-543    AC A0A1C7LYY3.1
#=GS A0A367K9J4_9FUNG/159-551    AC A0A367K9J4.1
#=GS A0A251R768_PRUPE/288-533    AC A0A251R768.1
#=GS TAPT1_MOUSE/152-456         AC Q4VBD2.2
#=GS A0A1U8KSL5_GOSHI/313-621    AC A0A1U8KSL5.1
#=GS A0A0D2WM18_CAPO3/41-339     AC A0A0D2WM18.1
#=GS L1JTZ5_GUITC/238-559        AC L1JTZ5.1
#=GS A0A0B4IBL8_METMF/502-909    AC A0A0B4IBL8.1
#=GS K4A7C2_SETIT/284-592        AC K4A7C2.1
#=GS A0A287N3N1_HORVV/10-106     AC A0A287N3N1.1
#=GS A0A4D9A7Y5_SALSN/336-535    AC A0A4D9A7Y5.1
#=GS A0A0N4U4H4_DRAME/141-470    AC A0A0N4U4H4.1
#=GS H2RC85_PANTR/252-556        AC H2RC85.2
#=GS A0A2T2ZWB2_9PEZI/599-1031   AC A0A2T2ZWB2.1
#=GS A0A0E0D5N9_9ORYZ/414-534    AC A0A0E0D5N9.1
#=GS A0A1U8BFK2_NELNU/313-621    AC A0A1U8BFK2.1
#=GS A0A0G4J4F2_PLABS/230-540    AC A0A0G4J4F2.1
#=GS A0A445C2G7_ARAHY/443-599    AC A0A445C2G7.1
#=GS TAPT1_YEAST/143-457         AC P40085.1
#=GS A0A445L272_GLYSO/291-610    AC A0A445L272.1
#=GS A0A0D2FY22_9EURO/469-886    AC A0A0D2FY22.1
#=GS W4GFJ3_9STRA/142-432        AC W4GFJ3.1
#=GS A0A3Q3MUU5_9TELE/152-445    AC A0A3Q3MUU5.1
#=GS H3CFA3_TETNG/90-394         AC H3CFA3.1
#=GS A0A0F8TXT8_9EURO/485-916    AC A0A0F8TXT8.1
#=GS M2WYY5_GALSU/266-587        AC M2WYY5.1
#=GS A0A066X8Y0_COLSU/549-957    AC A0A066X8Y0.1
#=GS A0A1Y1YK80_9FUNG/242-619    AC A0A1Y1YK80.1
#=GS Q0UP85_PHANO/366-773        AC Q0UP85.2
#=GS A0A3P6MY96_CAEEL/223-528    AC A0A3P6MY96.1
#=GS A0A1S4BJE3_TOBAC/298-574    AC A0A1S4BJE3.1
#=GS A0A2Y9SHD4_PHYMC/351-655    AC A0A2Y9SHD4.1
#=GS A0A010QTE6_9PEZI/549-957    AC A0A010QTE6.1
#=GS A0A1E4SQP8_9ASCO/158-478    AC A0A1E4SQP8.1
#=GS L7JXX0_TRAHO/44-358         AC L7JXX0.1
#=GS A0A498N979_LABRO/370-436    AC A0A498N979.1
#=GS A0A0L0UV98_9BASI/150-613    AC A0A0L0UV98.1
#=GS F2PPB6_TRIEC/564-1002       AC F2PPB6.1
#=GS G2X610_VERDV/534-941        AC G2X610.1
#=GS A0A0P9GGQ9_RHOGW/93-395     AC A0A0P9GGQ9.1
#=GS K9G9B9_PEND2/471-897        AC K9G9B9.1
#=GS A0A177V6D5_9BASI/221-528    AC A0A177V6D5.1
#=GS M4BWT8_HYAAE/58-351         AC M4BWT8.1
#=GS A0A2G5TUA6_9PELO/220-525    AC A0A2G5TUA6.1
#=GS G7J478_MEDTR/287-582        AC G7J478.2
#=GS A0A0J7NEE7_LASNI/145-323    AC A0A0J7NEE7.1
#=GS A0A166L0P8_9AGAM/145-523    AC A0A166L0P8.1
#=GS A0A151TRH3_CAJCA/280-585    AC A0A151TRH3.1
#=GS A0A2A2J6K3_9BILA/244-522    AC A0A2A2J6K3.1
#=GS A0A091EFK5_CORBR/89-393     AC A0A091EFK5.1
#=GS A0A444ZXC7_ARAHY/265-346    AC A0A444ZXC7.1
#=GS A0A166URS8_9PEZI/598-1006   AC A0A166URS8.1
#=GS A0A3B0KEG8_DROGU/168-472    AC A0A3B0KEG8.1
#=GS A0A2T4B8P8_9HYPO/494-898    AC A0A2T4B8P8.1
#=GS A0A2P6PV73_ROSCH/1-45       AC A0A2P6PV73.1
#=GS A0A319BHJ0_ASPLB/529-953    AC A0A319BHJ0.1
#=GS A0A367XVB1_9ASCO/1-163      AC A0A367XVB1.1
#=GS H0ZHF9_TAEGU/98-402         AC H0ZHF9.1
#=GS G1XSB1_ARTOA/405-822        AC G1XSB1.1
#=GS A0A3B4BS51_PYGNA/107-411    AC A0A3B4BS51.1
#=GS A0A445L2A3_GLYSO/278-586    AC A0A445L2A3.1
#=GS A0A182XUY7_ANOST/166-470    AC A0A182XUY7.1
#=GS A0A395NYI5_TRIAR/495-899    AC A0A395NYI5.1
#=GS A0A2W1DYU3_9PLEO/466-872    AC A0A2W1DYU3.1
#=GS A0A1D5PZC7_CHICK/245-549    AC A0A1D5PZC7.2
#=GS A0A445DRJ2_ARAHY/238-319    AC A0A445DRJ2.1
#=GS A0A2B4RRL4_STYPI/289-464    AC A0A2B4RRL4.1
#=GS A0A059BF40_EUCGR/305-552    AC A0A059BF40.1
#=GS A0A2T4H5W7_FUSCU/482-889    AC A0A2T4H5W7.1
#=GS A0A182N7B8_9DIPT/591-895    AC A0A182N7B8.1
#=GS A0A177U5V5_9BASI/253-556    AC A0A177U5V5.1
#=GS A0A3Q1C047_AMPOC/168-472    AC A0A3Q1C047.1
#=GS A0A1U7UD00_TARSY/14-318     AC A0A1U7UD00.1
#=GS C5G9F4_AJEDR/554-980        AC C5G9F4.2
#=GS A0A2X0KS85_9BASI/445-772    AC A0A2X0KS85.1
#=GS A0A2J6L055_LACSA/300-608    AC A0A2J6L055.1
#=GS A0A1B0G170_GLOMM/160-453    AC A0A1B0G170.1
#=GS A0A0X8HUT4_9SACH/105-416    AC A0A0X8HUT4.1
#=GS D8SDS4_SELML/239-318        AC D8SDS4.1
#=GS A0A229YMD6_9EURO/498-921    AC A0A229YMD6.1
#=GS A0A1J9RBL2_9EURO/544-970    AC A0A1J9RBL2.1
#=GS TAPT1_CHICK/169-473         AC Q5ZLG8.2
#=GS A0A372R8A4_9GLOM/127-491    AC A0A372R8A4.1
#=GS A7RZJ0_NEMVE/93-397         AC A7RZJ0.1
#=GS A0A3Q2HJB1_HORSE/117-421    AC A0A3Q2HJB1.1
#=GS A0A3P8XJ65_ESOLU/139-443    AC A0A3P8XJ65.1
#=GS A0A445DWK0_ARAHY/436-641    AC A0A445DWK0.1
#=GS A0A0B2WPJ1_METAS/496-903    AC A0A0B2WPJ1.1
#=GS A0A180GEE0_PUCT1/277-700    AC A0A180GEE0.1
#=GS A0A2C5Y3R6_9HYPO/372-775    AC A0A2C5Y3R6.1
#=GS A0A445C2G7_ARAHY/376-431    AC A0A445C2G7.1
#=GS A0A1D8PPE9_CANAL/184-512    AC A0A1D8PPE9.1
#=GS A0A1Q3C1R6_CEPFO/231-539    AC A0A1Q3C1R6.1
#=GS Q2ULX9_ASPOR/474-897        AC Q2ULX9.1
#=GS A0A0V1PBR9_9BILA/124-434    AC A0A0V1PBR9.1
#=GS A0A2S7QUR1_9HELO/536-936    AC A0A2S7QUR1.1
#=GS W6MUE0_9ASCO/130-489        AC W6MUE0.1
#=GS G2YS88_BOTF4/545-937        AC G2YS88.1
#=GS A0A314ZKV9_PRUYE/289-377    AC A0A314ZKV9.1
#=GS A0A1E4RR24_9ASCO/73-412     AC A0A1E4RR24.1
#=GS A0A1J1IG23_9DIPT/143-447    AC A0A1J1IG23.1
#=GS A0A3B3I297_ORYLA/163-467    AC A0A3B3I297.1
#=GS A0A445I6K8_GLYSO/221-527    AC A0A445I6K8.1
#=GS A0A437AFG4_9PEZI/398-812    AC A0A437AFG4.1
#=GS G7XAN3_ASPKW/529-953        AC G7XAN3.1
#=GS H2SRK5_TAKRU/152-456        AC H2SRK5.2
#=GS K2QSG4_MACPH/480-888        AC K2QSG4.1
#=GS A0A2G3C5I6_CAPCH/286-601    AC A0A2G3C5I6.1
#=GS A0A0G4PA53_PENCA/493-919    AC A0A0G4PA53.1
#=GS W9W7W4_9EURO/478-895        AC W9W7W4.1
#=GS A0A094AAK3_9PEZI/1979-2382  AC A0A094AAK3.1
#=GS A0A445DWL3_ARAHY/301-609    AC A0A445DWL3.1
#=GS A0A2G9I5D0_9LAMI/296-605    AC A0A2G9I5D0.1
#=GS A0A369GT15_9HYPO/453-860    AC A0A369GT15.1
#=GS A0A078GUL0_BRANA/60-307     AC A0A078GUL0.1
#=GS A0A175YGC3_DAUCS/457-565    AC A0A175YGC3.1
#=GS D8QXR8_SELML/382-547        AC D8QXR8.1
#=GS A0A0M8P9I8_9EURO/494-920    AC A0A0M8P9I8.1
#=GS A0A1D2VPS1_9ASCO/139-593    AC A0A1D2VPS1.1
#=GS TAPT1_CAEEL/221-526         AC Q9U3H8.1
#=GS A0A0E0KI88_ORYPU/276-417    AC A0A0E0KI88.1
#=GS A0A1Y2ISD2_PYCCO/229-590    AC A0A1Y2ISD2.1
#=GS M5FNF0_DACPD/175-510        AC M5FNF0.1
#=GS A0A2Y9MNV6_DELLE/351-655    AC A0A2Y9MNV6.1
#=GS A0A2G8SKE5_9APHY/222-583    AC A0A2G8SKE5.1
#=GS R1DFC0_EMIHU/1-125          AC R1DFC0.1
#=GS D8TJ30_VOLCA/555-818        AC D8TJ30.1
#=GS A0A317Y2K2_9BASI/615-996    AC A0A317Y2K2.1
#=GS A0A401S7J8_CHIPU/162-466    AC A0A401S7J8.1
#=GS A0A166NP24_9HYPO/477-884    AC A0A166NP24.1
#=GS A0A1W4U8H1_DROFC/168-472    AC A0A1W4U8H1.1
#=GS A0A139ADT8_GONPJ/318-782    AC A0A139ADT8.1
#=GS A0A267DP20_9PLAT/119-418    AC A0A267DP20.1
#=GS A0A1U8KXF6_GOSHI/284-592    AC A0A1U8KXF6.1
#=GS A0A139WNU1_TRICA/144-447    AC A0A139WNU1.1
#=GS A0A2S6BQ20_9PEZI/393-802    AC A0A2S6BQ20.1
#=GS A0A0V0RQZ4_9BILA/125-435    AC A0A0V0RQZ4.1
#=GS A0A0K3CN28_RHOTO/159-534    AC A0A0K3CN28.1
#=GS W9YJW6_9EURO/162-579        AC W9YJW6.1
#=GS E5SIM5_TRISP/125-435        AC E5SIM5.1
#=GS A0A197JM32_9FUNG/90-454     AC A0A197JM32.1
#=GS A0A3Q3VUI1_MOLML/189-493    AC A0A3Q3VUI1.1
#=GS A0A060Y8V4_ONCMY/264-568    AC A0A060Y8V4.1
#=GS U4U998_DENPD/1-293          AC U4U998.1
#=GS A0A1S3RQY5_SALSA/153-457    AC A0A1S3RQY5.1
#=GS R0JZW8_ANAPL/89-393         AC R0JZW8.1
#=GS A0A182EL57_ONCOC/1-87       AC A0A182EL57.1
#=GS A0A0E0D5N9_9ORYZ/276-417    AC A0A0E0D5N9.1
#=GS A0A2Y9R332_TRIMA/54-358     AC A0A2Y9R332.1
#=GS A0A395MKX8_9HYPO/462-873    AC A0A395MKX8.1
#=GS A0A1V6V8X2_9EURO/491-917    AC A0A1V6V8X2.1
#=GS A0A0D2W2C9_GOSRA/289-597    AC A0A0D2W2C9.1
#=GS A0A1I7V2U4_9PELO/220-526    AC A0A1I7V2U4.1
#=GS A0A3P8ZKI0_ESOLU/143-447    AC A0A3P8ZKI0.1
#=GS A0A1G4IPC7_9SACH/111-426    AC A0A1G4IPC7.1
#=GS A0A2I1H914_9GLOM/123-487    AC A0A2I1H914.1
#=GS A0A2I0MN63_COLLI/54-358     AC A0A2I0MN63.1
#=GS A0A162I2P5_9HYPO/461-868    AC A0A162I2P5.1
#=GS A0A1J1IG34_9DIPT/143-447    AC A0A1J1IG34.1
#=GS TAPT1_DROME/166-470         AC Q9VED0.2
#=GS A0A226PTS6_COLVI/168-492    AC A0A226PTS6.1
#=GS G7E7U8_MIXOS/226-585        AC G7E7U8.1
#=GS A0A3P8RBB2_ASTCA/146-450    AC A0A3P8RBB2.1
#=GS A1CEM5_ASPCL/539-963        AC A1CEM5.1
#=GS M9M5Q7_PSEA3/502-882        AC M9M5Q7.1
#=GS G1NIZ6_MELGA/89-392         AC G1NIZ6.2
#=GS H3F4D2_PRIPA/307-402        AC H3F4D2.2
#=GS M4CJ86_BRARP/48-507         AC M4CJ86.1
#=GS H9GIW9_ANOCA/90-398         AC H9GIW9.1
#=GS R7Z261_CONA1/470-880        AC R7Z261.1
#=GS H2AQ75_KAZAF/48-364         AC H2AQ75.1
#=GS A0A2K1ZGU0_POPTR/13-98      AC A0A2K1ZGU0.1
#=GS D8QCJ7_SCHCM/127-486        AC D8QCJ7.1
#=GS L0P8A3_PNEJ8/53-280         AC L0P8A3.1
#=GS A0A218VCB3_9PASE/62-366     AC A0A218VCB3.1
#=GS A0A3M0KSF1_HIRRU/159-209    AC A0A3M0KSF1.1
#=GS A0A1E4RY44_CYBJN/119-448    AC A0A1E4RY44.1
#=GS A0A3M2TGT2_9EURO/605-920    AC A0A3M2TGT2.1
#=GS A0A1X0NLV9_9TRYP/83-423     AC A0A1X0NLV9.1
#=GS A0A421J4J3_9ASCO/192-525    AC A0A421J4J3.1
#=GS A0A2H0ZYQ8_CANAR/187-519    AC A0A2H0ZYQ8.1
#=GS A0A1E3B243_9EURO/585-1011   AC A0A1E3B243.1
#=GS A0A2K5DGU9_AOTNA/100-404    AC A0A2K5DGU9.1
#=GS A0A2R6S6D0_9APHY/207-568    AC A0A2R6S6D0.1
#=GS L2GWR7_VAVCU/43-383         AC L2GWR7.1
#=GS A0A2K3N9T5_TRIPR/87-144     AC A0A2K3N9T5.1
#=GS A0A2H3TAC0_FUSOX/478-886    AC A0A2H3TAC0.1
#=GS A0A453H862_AEGTS/275-465    AC A0A453H862.1
#=GS A0A317VZF5_9EURO/513-937    AC A0A317VZF5.1
#=GS A0A2S4PZK9_9PEZI/372-770    AC A0A2S4PZK9.1
#=GS A0A2Y9JW02_ENHLU/157-461    AC A0A2Y9JW02.1
#=GS A0A183SQJ9_SCHSO/54-224     AC A0A183SQJ9.1
#=GS A0A3B3TZ77_9TELE/148-452    AC A0A3B3TZ77.1
#=GS A0A0H2S9F5_9AGAM/192-554    AC A0A0H2S9F5.1
#=GS E9E0F2_METAQ/497-904        AC E9E0F2.1
#=GS A6RA74_AJECN/475-868        AC A6RA74.1
#=GS A0A158P1S1_ATTCE/165-474    AC A0A158P1S1.1
#=GS K8EBA9_9CHLO/243-569        AC K8EBA9.1
#=GS A0A2X0MHN0_9BASI/435-762    AC A0A2X0MHN0.1
#=GS A0A317X032_9EURO/521-945    AC A0A317X032.1
#=GS A0A2U3YBG9_LEPWE/54-358     AC A0A2U3YBG9.1
#=GS A0A0A1T4C7_9HYPO/457-859    AC A0A0A1T4C7.1
#=GS A0A195CMC2_9HYME/163-472    AC A0A195CMC2.1
#=GS A0A194RR59_PAPMA/138-441    AC A0A194RR59.1
#=GS H1V0A5_COLHI/551-943        AC H1V0A5.1
#=GS A0A078JIU2_BRANA/97-186     AC A0A078JIU2.1
#=GS L8X2Z5_THACA/247-543        AC L8X2Z5.1
#=GS A0A2P6VBG3_9CHLO/339-639    AC A0A2P6VBG3.1
#=GS A0A3B5Q6P1_XIPMA/163-467    AC A0A3B5Q6P1.1
#=GS A0A2H3ZCW5_PHODC/279-587    AC A0A2H3ZCW5.1
#=GS A0A3B6HWK6_WHEAT/278-590    AC A0A3B6HWK6.1
#=GS A0A2J8DL32_VERDA/485-892    AC A0A2J8DL32.1
#=GS A0A427YTQ2_9TREE/302-661    AC A0A427YTQ2.1
#=GS A0A1S3QNB1_SALSA/149-453    AC A0A1S3QNB1.1
#=GS A0A3B4ELA1_PYGNA/168-472    AC A0A3B4ELA1.1
#=GS A5E520_LODEL/220-589        AC A5E520.1
#=GS A0A2S4KQG0_9HYPO/489-896    AC A0A2S4KQG0.1
#=GS A0A3Q7SQU6_VULVU/206-510    AC A0A3Q7SQU6.1
#=GS A0A2B4RRL4_STYPI/457-622    AC A0A2B4RRL4.1
#=GS A0A445DRE4_ARAHY/362-484    AC A0A445DRE4.1
#=GS G3TWX5_LOXAF/123-427        AC G3TWX5.1
#=GS A0A026WF75_OOCBI/165-473    AC A0A026WF75.1
#=GS A0A0D2PW95_GOSRA/292-489    AC A0A0D2PW95.1
#=GS A0A0D2U1P9_GOSRA/75-186     AC A0A0D2U1P9.1
#=GS A0A0M3QXT6_DROBS/168-472    AC A0A0M3QXT6.1
#=GS A0A024GSK8_9STRA/790-842    AC A0A024GSK8.1
#=GS A0A371I5T1_MUCPR/268-563    AC A0A371I5T1.1
#=GS W3WWI1_PESFW/570-974        AC W3WWI1.1
#=GS C5FQI9_ARTOC/567-652        AC C5FQI9.1
#=GS A0A445DRE6_ARAHY/238-319    AC A0A445DRE6.1
#=GS A0A1Y2WZR3_9PEZI/657-1060   AC A0A1Y2WZR3.1
#=GS A0A0D2W6A9_GOSRA/75-127     AC A0A0D2W6A9.1
#=GS C4R7Y0_KOMPG/114-449        AC C4R7Y0.1
#=GS A0A1V9X190_9ACAR/169-474    AC A0A1V9X190.1
#=GS G8YCC6_PICSO/163-499        AC G8YCC6.1
#=GS A0A0D1XQD8_EXOME/477-893    AC A0A0D1XQD8.1
#=GS K7KEM9_SOYBN/6-118          AC K7KEM9.1
#=GS A0A183SQJ9_SCHSO/248-451    AC A0A183SQJ9.1
#=GS L8H383_ACACA/130-221        AC L8H383.1
#=GS B6JWW8_SCHJY/235-600        AC B6JWW8.1
#=GS D4A533_RAT/196-500          AC D4A533.3
#=GS A0A1E5RVH1_9ASCO/278-607    AC A0A1E5RVH1.1
#=GS V5EQZ4_KALBG/302-680        AC V5EQZ4.1
#=GS H3AFJ5_LATCH/185-489        AC H3AFJ5.1
#=GS A0A498N4X3_LABRO/160-464    AC A0A498N4X3.1
#=GS J9D332_EDHAE/39-284         AC J9D332.1
#=GS V7CMA9_PHAVU/43-483         AC V7CMA9.1
#=GS A0A162C7G9_9CRUS/21-311     AC A0A162C7G9.1
#=GS A0A088A3F2_APIME/21-329     AC A0A088A3F2.1
#=GS A0A1S2ZDZ3_ERIEU/44-348     AC A0A1S2ZDZ3.1
#=GS A0A0L7LUM8_9NEOP/1-64       AC A0A0L7LUM8.1
#=GS A0A015M3Y8_RHIIW/123-487    AC A0A015M3Y8.1
#=GS A0A3Q3A6T5_KRYMA/163-467    AC A0A3Q3A6T5.1
#=GS A0A1V1TVI2_9FUNG/511-913    AC A0A1V1TVI2.1
#=GS A0A2R8M519_CALJA/49-353     AC A0A2R8M519.1
#=GS M2THH4_COCSN/476-884        AC M2THH4.1
#=GS D8QXR8_SELML/239-392        AC D8QXR8.1
#=GS A7TLS6_VANPO/141-451        AC A7TLS6.1
#=GS A0A286UG91_9AGAM/220-573    AC A0A286UG91.1
#=GS A0A3P6NNU2_CAEEL/13-318     AC A0A3P6NNU2.1
#=GS A0A067N257_9AGAM/207-571    AC A0A067N257.1
#=GS A0A3N2QAQ3_9PEZI/572-976    AC A0A3N2QAQ3.1
#=GS A0A2H2YX04_9HYPO/492-896    AC A0A2H2YX04.1
#=GS A0A183REH7_9TREM/55-190     AC A0A183REH7.1
#=GS G3YCG9_ASPNA/442-866        AC G3YCG9.1
#=GS A0A444ZXC7_ARAHY/341-553    AC A0A444ZXC7.1
#=GS V2XXY8_MONRO/173-532        AC V2XXY8.1
#=GS E4V4I9_ARTGP/537-975        AC E4V4I9.1
#=GS A0A1D2MT20_ORCCI/113-436    AC A0A1D2MT20.1
#=GS V4W5L9_9ROSI/273-581        AC V4W5L9.1
#=GS A0A3B3CZ74_ORYME/147-451    AC A0A3B3CZ74.1
#=GS Q4CN10_TRYCC/84-424         AC Q4CN10.1
#=GS A0A182HTI7_ANOAR/167-471    AC A0A182HTI7.1
#=GS A0A2K6SPX3_SAIBB/88-392     AC A0A2K6SPX3.1
#=GS B9HVS7_POPTR/265-576        AC B9HVS7.2
#=GS A0A251S7C2_HELAN/1-155      AC A0A251S7C2.1
#=GS A7EA34_SCLS1/527-919        AC A7EA34.1
#=GS D8SDS4_SELML/316-519        AC D8SDS4.1
#=GS D3BE11_POLPP/476-792        AC D3BE11.1
#=GS A0A498S696_ACAVI/146-430    AC A0A498S696.1
#=GS A0A165FMA5_XYLHT/634-1073   AC A0A165FMA5.1
#=GS A0A195BST9_9HYME/165-474    AC A0A195BST9.1
#=GS A0A2K3NNP2_TRIPR/292-561    AC A0A2K3NNP2.1
#=GS A0A1S3BIA2_CUCME/321-561    AC A0A1S3BIA2.1
#=GS G1S3I8_NOMLE/155-459        AC G1S3I8.1
#=GS A0A369RWZ9_9METZ/105-409    AC A0A369RWZ9.1
#=GS A0A3Q1EGN0_9TELE/44-348     AC A0A3Q1EGN0.1
#=GS A0A0L9TKY7_PHAAN/225-535    AC A0A0L9TKY7.1
#=GS L8GCZ0_ACACA/110-422        AC L8GCZ0.1
#=GS A0A2X0MHN0_9BASI/363-416    AC A0A2X0MHN0.1
#=GS A0A103XDJ6_CYNCS/306-589    AC A0A103XDJ6.1
#=GS A0A2T3Z1A0_9HYPO/398-803    AC A0A2T3Z1A0.1
#=GS A0A1J6KDN8_NICAT/298-407    AC A0A1J6KDN8.1
#=GS C1MYN9_MICPC/272-624        AC C1MYN9.1
#=GS A0A3B3B9H4_ORYME/164-468    AC A0A3B3B9H4.1
#=GS A0A0D2T7D6_GOSRA/292-600    AC A0A0D2T7D6.1
#=GS A0A433SUB7_ELYCH/159-462    AC A0A433SUB7.1
#=GS A0A1R3HPV5_9ROSI/858-1122   AC A0A1R3HPV5.1
#=GS A0A182LRS0_9DIPT/607-911    AC A0A182LRS0.1
#=GS A0A2T7C261_9POAL/282-550    AC A0A2T7C261.1
#=GS A0A2T9YEH5_9FUNG/68-349     AC A0A2T9YEH5.1
#=GS A0A1R3GRV6_COCAP/345-508    AC A0A1R3GRV6.1
#=GS A0A3Q3FG59_KRYMA/152-456    AC A0A3Q3FG59.1
#=GS A0A316YPE6_9BASI/1251-1712  AC A0A316YPE6.1
#=GS B6Q571_TALMQ/499-926        AC B6Q571.1
#=GS A0A1D6GJ52_MAIZE/50-205     AC A0A1D6GJ52.1
#=GS A0A0R0J9R9_SOYBN/222-274    AC A0A0R0J9R9.1
#=GS A0A3P8PNH6_ASTCA/163-467    AC A0A3P8PNH6.1
#=GS A0A0C3FGI1_9AGAM/203-562    AC A0A0C3FGI1.1
#=GS A0A318ZCA2_9EURO/457-879    AC A0A318ZCA2.1
#=GS A0A484FG81_COLOR/562-971    AC A0A484FG81.1
#=GS A0A452EHE5_CAPHI/153-457    AC A0A452EHE5.1
#=GS A0A0D2TU93_GOSRA/260-430    AC A0A0D2TU93.1
#=GS A0A0G2FXB7_9PEZI/302-734    AC A0A0G2FXB7.1
#=GS D8T8N1_SELML/47-115         AC D8T8N1.1
#=GS A0A135TZ09_9PEZI/551-959    AC A0A135TZ09.1
#=GS A0A1S3UIS3_VIGRR/231-541    AC A0A1S3UIS3.1
#=GS A0A1S3DSK9_DIACI/1-64       AC A0A1S3DSK9.2
#=GS A0A162MAE4_9HYPO/548-962    AC A0A162MAE4.1
#=GS G3STD1_LOXAF/155-459        AC G3STD1.1
#=GS A0A1J1IJH6_9DIPT/143-447    AC A0A1J1IJH6.1
#=GS A0A2I0ABD1_9ASPA/262-570    AC A0A2I0ABD1.1
#=GS A0A370IRP9_VENIN/466-875    AC A0A370IRP9.1
#=GS A0A319ERS4_9EURO/992-1416   AC A0A319ERS4.1
#=GS A0A453H819_AEGTS/317-599    AC A0A453H819.1
#=GS A0A0R3QSW3_9BILA/146-447    AC A0A0R3QSW3.1
#=GS A0A2R8ZVE8_PANPA/44-348     AC A0A2R8ZVE8.1
#=GS TAPT1_SCHPO/218-585         AC O60067.1
#=GS A0A1J8PKV1_9AGAM/200-560    AC A0A1J8PKV1.1
#=GS A0A383W2J8_TETOB/348-650    AC A0A383W2J8.1
#=GS K5VKP1_AGABU/261-633        AC K5VKP1.1
#=GS A0A3Q2E5I3_CYPVA/152-456    AC A0A3Q2E5I3.1
#=GS H3AFJ6_LATCH/90-394         AC H3AFJ6.1
#=GS A0A2H3E7I1_ARMGA/132-454    AC A0A2H3E7I1.1
#=GS A0A1B8ETS6_9PEZI/488-891    AC A0A1B8ETS6.1
#=GS Q4N5K5_THEPA/220-616        AC Q4N5K5.1
#=GS A0A2I4CW75_9TELE/175-479    AC A0A2I4CW75.1
#=GS A0A367IT69_RHIST/1-277      AC A0A367IT69.1
#=GS A0A1B8B6E1_FUSPO/482-889    AC A0A1B8B6E1.1
#=GS A4HT53_LEIIN/122-495        AC A4HT53.1
#=GS A0A3P6T4J1_LITSI/156-457    AC A0A3P6T4J1.1
#=GS A0A094CXS1_9PEZI/1680-2083  AC A0A094CXS1.1
#=GS A0A0R3PZC3_ANGCS/84-386     AC A0A0R3PZC3.2
#=GS A0A3R7LZL4_PENVA/120-424    AC A0A3R7LZL4.1
#=GS Q4D3C1_TRYCC/83-424         AC Q4D3C1.1
#=GS A0A2K3N530_TRIPR/98-155     AC A0A2K3N530.1
#=GS V5FIJ5_BYSSN/1057-1481      AC V5FIJ5.1
#=GS F7GLW1_MACMU/152-456        AC F7GLW1.2
#=GS L0AUB2_THEEQ/247-534        AC L0AUB2.1
#=GS E1ZIC5_CHLVA/337-659        AC E1ZIC5.1
#=GS R7UFJ2_CAPTE/81-385         AC R7UFJ2.1
#=GS A0A1F8AGK9_9EURO/565-988    AC A0A1F8AGK9.1
#=GS A0A0R3X5Y4_HYDTA/203-361    AC A0A0R3X5Y4.1
#=GS K5W5E4_PHACS/144-552        AC K5W5E4.1
#=GS B9SNG4_RICCO/349-514        AC B9SNG4.1
#=GS A0A1Z5S588_SORBI/284-562    AC A0A1Z5S588.1
#=GS A0A2A3E6F9_APICC/274-381    AC A0A2A3E6F9.1
#=GS A0A1A0HC97_9ASCO/162-494    AC A0A1A0HC97.1
#=GS Q5CR82_CRYPI/386-659        AC Q5CR82.1
#=GS A0A067R697_ZOONE/163-467    AC A0A067R697.1
#=GS A0A0L6WNH6_9AGAR/151-505    AC A0A0L6WNH6.1
#=GS A0A093VJS0_TALMA/499-926    AC A0A093VJS0.1
#=GS A0A0V0WWV2_9BILA/126-436    AC A0A0V0WWV2.1
#=GS A0A384BPL3_URSMA/201-505    AC A0A384BPL3.1
#=GS A0A453H7Q1_AEGTS/317-442    AC A0A453H7Q1.1
#=GS C6HDH6_AJECH/553-979        AC C6HDH6.1
#=GS A0A2P5QIS0_GOSBA/315-519    AC A0A2P5QIS0.1
#=GS A0A2K5U6Y6_MACFA/155-459    AC A0A2K5U6Y6.1
#=GS A0A0R3UKG9_9CEST/1100-1151  AC A0A0R3UKG9.1
#=GS A0A0J7NEE7_LASNI/96-146     AC A0A0J7NEE7.1
#=GS A0A087SYC8_9ARAC/200-504    AC A0A087SYC8.1
#=GS A0A151XAR5_9HYME/164-473    AC A0A151XAR5.1
#=GS A0A1J7J864_9PEZI/537-595    AC A0A1J7J864.1
#=GS A0A2G5BJL7_COERN/117-473    AC A0A2G5BJL7.1
#=GS A0A3P8ZE42_ESOLU/172-476    AC A0A3P8ZE42.1
#=GS A0A1G4AT58_9PEZI/531-933    AC A0A1G4AT58.1
#=GS A0A1A9XP71_GLOFF/161-454    AC A0A1A9XP71.1
#=GS A1DFL4_NEOFI/513-936        AC A1DFL4.1
#=GS W6QH02_PENRF/496-922        AC W6QH02.1
#=GS A0A0D3FN92_9ORYZ/239-358    AC A0A0D3FN92.1
#=GS X0B9S9_FUSOX/478-886        AC X0B9S9.1
#=GS M2T7C6_COCH5/476-884        AC M2T7C6.1
#=GS A0A2T7P8J4_POMCA/181-487    AC A0A2T7P8J4.1
#=GS A0A1A6HWX8_NEOLE/76-229     AC A0A1A6HWX8.1
#=GS A0A3Q0H6F8_ALLSI/54-358     AC A0A3Q0H6F8.1
#=GS A2QVY3_ASPNC/462-796        AC A2QVY3.1
#=GS A0A3Q3MG84_9TELE/152-456    AC A0A3Q3MG84.1
#=GS A0A2K5S1T9_CEBCA/155-459    AC A0A2K5S1T9.1
#=GS C5DZT0_ZYGRC/125-436        AC C5DZT0.1
#=GS A0A2R6PGM9_ACTCH/287-595    AC A0A2R6PGM9.1
#=GS A0A3Q2US03_HAPBU/163-467    AC A0A3Q2US03.1
#=GS G9NXB2_HYPAI/384-789        AC G9NXB2.1
#=GS A0A3B6IMX4_WHEAT/277-589    AC A0A3B6IMX4.1
#=GS A0A0D2S7D4_GOSRA/260-568    AC A0A0D2S7D4.1
#=GS A0A017SE39_9EURO/582-1007   AC A0A017SE39.1
#=GS B9QQM1_TOXGV/3109-3802      AC B9QQM1.1
#=GS A0A445DRE6_ARAHY/314-545    AC A0A445DRE6.1
#=GS A0A1B9GID5_9TREE/333-693    AC A0A1B9GID5.1
#=GS F8PW85_SERL3/176-539        AC F8PW85.1
#=GS A0A1A9ZXY0_GLOPL/160-453    AC A0A1A9ZXY0.1
#=GS A0A3P8V256_CYNSE/96-403     AC A0A3P8V256.1
#=GS A0A067NKL1_PLEOS/220-571    AC A0A067NKL1.1
#=GS A0A0F0ICW3_ASPPU/565-988    AC A0A0F0ICW3.1
#=GS A0A1C7NUL0_9FUNG/204-600    AC A0A1C7NUL0.1
#=GS A0A075AZH2_ROZAC/61-330     AC A0A075AZH2.1
#=GS A0A3B3QKI9_9TELE/125-429    AC A0A3B3QKI9.1
#=GS TAPT1_DANRE/152-456         AC A2BIE7.1
#=GS A0A2S5B8D8_9BASI/262-639    AC A0A2S5B8D8.1
#=GS A0A2B7WS12_9EURO/650-1076   AC A0A2B7WS12.1
#=GS A0A158PZ59_BRUMA/146-447    AC A0A158PZ59.1
#=GS A0A0D3CYU2_BRAOL/68-552     AC A0A0D3CYU2.1
#=GS A0A444STQ4_ARMVU/1-58       AC A0A444STQ4.1
#=GS J5JQE5_BEAB2/543-957        AC J5JQE5.1
#=GS A0A2P5Q340_GOSBA/324-607    AC A0A2P5Q340.1
#=GS T0S0B9_SAPDV/176-482        AC T0S0B9.1
#=GS A0A0A0K3C5_CUCSA/321-615    AC A0A0A0K3C5.1
#=GS N1RS43_FUSC4/478-886        AC N1RS43.1
#=GS A0A1E3HX17_9TREE/332-701    AC A0A1E3HX17.1
#=GS A0A1S3RSN3_SALSA/164-468    AC A0A1S3RSN3.1
#=GS A0A061EAC1_THECC/291-452    AC A0A061EAC1.1
#=GS A0A1V6YLY6_PENNA/507-933    AC A0A1V6YLY6.1
#=GS L0P8A3_PNEJ8/2-58           AC L0P8A3.1
#=GS A0A2B7ZCP2_9EURO/547-973    AC A0A2B7ZCP2.1
#=GS G4MWS1_MAGO7/581-1015       AC G4MWS1.1
#=GS H0WWF7_OTOGA/89-393         AC H0WWF7.1
#=GS A0A099YZX4_TINGU/90-394     AC A0A099YZX4.1
#=GS A0A267DBY9_9PLAT/118-417    AC A0A267DBY9.1
#=GS W9J2Y9_9HYPO/478-886        AC W9J2Y9.1
#=GS A0A087STH3_AUXPR/268-475    AC A0A087STH3.1
#=GS A0A1E3IF52_9TREE/325-687    AC A0A1E3IF52.1
#=GS A0A3N4L7V5_9PEZI/410-795    AC A0A3N4L7V5.1
#=GS A0A0L7L6I2_9NEOP/114-212    AC A0A0L7L6I2.1
#=GS A0A366S6N7_9HYPO/450-861    AC A0A366S6N7.1
#=GS A0A0Q3XBK0_AMAAE/164-468    AC A0A0Q3XBK0.1
#=GS L0AW66_THEEQ/1-125          AC L0AW66.1
#=GS A0A0B7F7S6_THACB/230-579    AC A0A0B7F7S6.1
#=GS A0A094AIX8_9PEZI/488-891    AC A0A094AIX8.1
#=GS A0A367KS32_RHIST/1-254      AC A0A367KS32.1
#=GS W4YUP1_STRPU/195-379        AC W4YUP1.1
#=GS A0A2K0WKB7_GIBNY/476-884    AC A0A2K0WKB7.1
#=GS Q2GR67_CHAGB/495-920        AC Q2GR67.1
#=GS A0A1U8MPK8_GOSHI/281-589    AC A0A1U8MPK8.1
#=GS A0A1C1CYR3_9EURO/477-894    AC A0A1C1CYR3.1
#=GS L9L184_TUPCH/154-217        AC L9L184.1
#=GS D5GNW5_TUBMM/490-870        AC D5GNW5.1
#=GS E2ASN6_CAMFO/163-472        AC E2ASN6.1
#=GS A0A3P8UW21_CYNSE/146-450    AC A0A3P8UW21.1
#=GS G1L4J5_AILME/156-460        AC G1L4J5.1
#=GS A0A2I0MN69_COLLI/1-285      AC A0A2I0MN69.1
#=GS A0A395SNE9_9HYPO/483-890    AC A0A395SNE9.1
#=GS A0A0J0XJ04_9TREE/258-619    AC A0A0J0XJ04.1
#=GS A0A086T9R5_ACRC1/477-885    AC A0A086T9R5.1
#=GS A0A165GY39_9BASI/274-609    AC A0A165GY39.1
#=GS F4P670_BATDJ/255-687        AC F4P670.1
#=GS A0A091FM17_9AVES/89-393     AC A0A091FM17.1
#=GS A0A2X0KS85_9BASI/373-426    AC A0A2X0KS85.1
#=GS S3DGM3_GLAL2/520-921        AC S3DGM3.1
#=GS A0A182THH8_9DIPT/576-880    AC A0A182THH8.1
#=GS A0A1Y1IF30_KLENI/486-583    AC A0A1Y1IF30.1
#=GS A0A168NYU8_ABSGL/1-389      AC A0A168NYU8.1
#=GS A0A0G4G921_VITBC/812-1256   AC A0A0G4G921.1
#=GS A0A1J9SAI6_9PEZI/478-900    AC A0A1J9SAI6.1
#=GS A0A2C6AM20_9HYPO/1-386      AC A0A2C6AM20.1
#=GS F7BL21_ORNAN/1-285          AC F7BL21.2
#=GS A0A445DRE4_ARAHY/238-319    AC A0A445DRE4.1
#=GS A0A0H1BI03_9EURO/553-979    AC A0A0H1BI03.1
#=GS J3KIL7_COCIM/671-1093       AC J3KIL7.2
#=GS A0A0N5C6P3_STREA/183-484    AC A0A0N5C6P3.1
#=GS A0A3D8S4I9_9EURO/477-907    AC A0A3D8S4I9.1
#=GS A0A167PY50_9PEZI/1-296      AC A0A167PY50.1
#=GS A0A0C2X031_9AGAM/92-440     AC A0A0C2X031.1
#=GS A0A2D0RI93_ICTPU/157-461    AC A0A2D0RI93.1
#=GS A0A3B1K9R5_ASTMX/307-435    AC A0A3B1K9R5.1
#=GS A0A3B4Z6A2_9TELE/168-472    AC A0A3B4Z6A2.1
#=GS A0A0E9NCF7_SAICN/272-616    AC A0A0E9NCF7.1
#=GS F6ZYT5_HORSE/235-539        AC F6ZYT5.2
#=GS A0A1I7VSL7_LOALO/146-447    AC A0A1I7VSL7.1
#=GS A0A452J7W9_CHICK/237-541    AC A0A452J7W9.1
#=GS M4A0F5_XIPMA/148-452        AC M4A0F5.1
#=GS D7KW85_ARALL/299-607        AC D7KW85.1
#=GS A0A161ZHW4_DAUCS/275-588    AC A0A161ZHW4.1
#=GS A0A3B4GBM0_9CICH/146-450    AC A0A3B4GBM0.1
#=GS A0A1I8EFG0_WUCBA/146-209    AC A0A1I8EFG0.1
#=GS A0A267FSS7_9PLAT/116-415    AC A0A267FSS7.1
#=GS U3K3R5_FICAL/152-456        AC U3K3R5.1
#=GS A0A369H332_9HYPO/441-848    AC A0A369H332.1
#=GS A0A2G7GBT7_9EURO/736-917    AC A0A2G7GBT7.1
#=GS B2AQE7_PODAN/492-916        AC B2AQE7.1
#=GS A0A3L6S9P1_PANMI/282-599    AC A0A3L6S9P1.1
#=GS H3F4D2_PRIPA/179-281        AC H3F4D2.2
#=GS A0A165RQL3_9APHY/96-459     AC A0A165RQL3.1
#=GS A0A250X4M8_9CHLO/313-618    AC A0A250X4M8.1
#=GS A0A0D2U2W4_GOSRA/42-92      AC A0A0D2U2W4.1
#=GS C4Y6A7_CLAL4/175-506        AC C4Y6A7.1
#=GS A0A482R1N9_9EURY/30-273     AC A0A482R1N9.1
#=GS L5K442_PTEAL/117-421        AC L5K442.1
#=GS I1BX13_RHIO9/169-532        AC I1BX13.1
#=GS A0A0J8U954_COCIT/532-882    AC A0A0J8U954.1
#=GS A0A1Y2HLX6_9FUNG/395-748    AC A0A1Y2HLX6.1
#=GS A0A0C9XXK2_9AGAR/231-581    AC A0A0C9XXK2.1
#=GS A0A287N3N7_HORVV/293-594    AC A0A287N3N7.1
#=GS A0A3Q0H550_ALLSI/62-366     AC A0A3Q0H550.1
#=GS A4S7Q1_OSTLU/127-454        AC A4S7Q1.1
#=GS A0A2J7Q4K3_9NEOP/159-462    AC A0A2J7Q4K3.1
#=GS A0A1G4K7E4_9SACH/112-425    AC A0A1G4K7E4.1
#=GS A0A3Q2E171_CYPVA/147-451    AC A0A3Q2E171.1
#=GS A0A0W8CRD7_PHYNI/241-538    AC A0A0W8CRD7.1
#=GS A0A2K3N9T5_TRIPR/146-205    AC A0A2K3N9T5.1
#=GS A0A1S3BHQ5_CUCME/321-629    AC A0A1S3BHQ5.1
#=GS A8X094_CAEBR/391-696        AC A8X094.2
#=GS A0A2K3JKQ6_TRIPR/1-78       AC A0A2K3JKQ6.1
#=GS A0A3Q1H2Q1_9TELE/152-456    AC A0A3Q1H2Q1.1
#=GS A0A0D1ZWD9_9PEZI/483-888    AC A0A0D1ZWD9.1
#=GS A0A067Q279_9AGAM/211-624    AC A0A067Q279.1
#=GS A0A3P8S1F2_AMPPE/120-380    AC A0A3P8S1F2.1
#=GS A0A0D2KDD7_9CHLO/1-97       AC A0A0D2KDD7.1
#=GS A0A420H8C3_9PEZI/484-882    AC A0A420H8C3.1
#=GS A0A199W282_ANACO/26-183     AC A0A199W282.1
#=GS A0A0K0FKE5_STRVS/183-484    AC A0A0K0FKE5.1
#=GS E7A1Y2_SPORE/404-782        AC E7A1Y2.1
#=GS W9QI48_9ROSA/313-563        AC W9QI48.1
#=GS A0A2B7XHR2_9EURO/547-973    AC A0A2B7XHR2.1
#=GS A0A0L0D5J8_THETB/39-368     AC A0A0L0D5J8.1
#=GS I2G0J0_USTH4/391-769        AC I2G0J0.1
#=GS A0A2R8QPH0_DANRE/152-456    AC A0A2R8QPH0.1
#=GS A0A1X7R8B1_9SACH/107-415    AC A0A1X7R8B1.1
#=GS M2PMA5_CERS8/229-590        AC M2PMA5.1
#=GS A0A3Q0JAM5_DIACI/102-294    AC A0A3Q0JAM5.1
#=GS A0A3P8PNZ4_ASTCA/152-456    AC A0A3P8PNZ4.1
#=GS M7SSI2_EUTLA/2-245          AC M7SSI2.1
#=GS A0A0D1YZE3_9EURO/470-887    AC A0A0D1YZE3.1
#=GS A0A2K6EF02_PROCO/155-459    AC A0A2K6EF02.1
#=GS A0A453H7P6_AEGTS/21-293     AC A0A453H7P6.1
#=GS R4XBK6_TAPDE/212-550        AC R4XBK6.1
#=GS A0A2A3E727_APICC/146-454    AC A0A2A3E727.1
#=GS A0A2H3EP48_9HELO/547-947    AC A0A2H3EP48.1
#=GS A0A165CAT5_EXIGL/176-529    AC A0A165CAT5.1
#=GS A0A1S4EQC2_DIACI/4-297      AC A0A1S4EQC2.2
#=GS A0A1D6GJ53_MAIZE/282-590    AC A0A1D6GJ53.1
#=GS A0A1S3RQY2_SALSA/68-372     AC A0A1S3RQY2.1
#=GS A0A3M6V9N5_9STRA/252-549    AC A0A3M6V9N5.1
#=GS A0A2A9P7Y4_9HYPO/436-844    AC A0A2A9P7Y4.1
#=GS E0VJ71_PEDHC/127-430        AC E0VJ71.1
#=GS A0A3Q4H4Z5_NEOBR/152-456    AC A0A3Q4H4Z5.1
#=GS A0A2G7GBT7_9EURO/559-694    AC A0A2G7GBT7.1
#=GS Q0DP48_ORYSJ/276-512        AC Q0DP48.1
#=GS V4KMI3_EUTSA/307-596        AC V4KMI3.1
#=GS A0A0L0SPU6_ALLM3/1-196      AC A0A0L0SPU6.1
#=GS A0A077YXD2_TRITR/124-429    AC A0A077YXD2.1
#=GS A0A061EGB1_THECC/291-599    AC A0A061EGB1.1
#=GS A0A1Y2UAE3_9PEZI/526-930    AC A0A1Y2UAE3.1
#=GS A0A060SNR6_PYCCI/229-274    AC A0A060SNR6.1
#=GS G3URQ2_MELGA/1-216          AC G3URQ2.1
#=GS A0A0F7SCG0_9BASI/120-500    AC A0A0F7SCG0.1
#=GS A0A0D3FN92_9ORYZ/100-241    AC A0A0D3FN92.1
#=GS A0A317WBB2_ASPEC/530-954    AC A0A317WBB2.1
#=GS A0A251S6U9_HELAN/313-421    AC A0A251S6U9.1
#=GS C5M961_CANTT/192-519        AC C5M961.1
#=GS A0A0D1DYG2_USTMA/398-778    AC A0A0D1DYG2.1
#=GS K7GAM8_PELSI/173-477        AC K7GAM8.1
#=GS M7BPV8_CHEMY/90-394         AC M7BPV8.1
#=GS A0A1L0DKC0_9ASCO/176-507    AC A0A1L0DKC0.1
#=GS A0A1L9X1H1_ASPAC/426-848    AC A0A1L9X1H1.1
#=GS B6AIH9_CRYMR/644-748        AC B6AIH9.1
#=GS A0A137NPW1_CONC2/173-547    AC A0A137NPW1.1
#=GS A0A096PA44_OSTTA/185-512    AC A0A096PA44.1
#=GS A0A238FHE6_9BASI/362-736    AC A0A238FHE6.1
#=GS R0GDB4_9BRAS/300-608        AC R0GDB4.1
#=GS G2QUX5_THITE/487-909        AC G2QUX5.1
#=GS A0A1I8MPQ2_MUSDO/172-476    AC A0A1I8MPQ2.1
#=GS A0A420YN07_9PEZI/548-963    AC A0A420YN07.1
#=GS A0A0V1H723_9BILA/124-434    AC A0A0V1H723.1
#=GS A0A0N1ISY9_9HYME/145-452    AC A0A0N1ISY9.1
#=GS C4JG33_UNCRE/638-888        AC C4JG33.1
#=GS A0A0A0APF6_CHAVO/89-393     AC A0A0A0APF6.1
#=GS A0A2H3CEC0_9AGAR/145-467    AC A0A2H3CEC0.1
#=GS A0D6Z3_PARTE/78-390         AC A0D6Z3.1
#=GS A0A1U8KWK3_GOSHI/289-597    AC A0A1U8KWK3.1
#=GS A0A2V0PG51_9CHLO/343-645    AC A0A2V0PG51.1
#=GS A0A370TNQ5_9PEZI/525-926    AC A0A370TNQ5.1
#=GS A0A2G5IB26_CERBT/394-803    AC A0A2G5IB26.1
#=GS A0A1Y2DRE9_9PEZI/433-838    AC A0A1Y2DRE9.1
#=GS W4YUP1_STRPU/109-204        AC W4YUP1.1
#=GS A0A2T7C1U2_9POAL/282-590    AC A0A2T7C1U2.1
#=GS A0A136IU40_9PEZI/529-937    AC A0A136IU40.1
#=GS A0A2C5WT44_9PEZI/619-1024   AC A0A2C5WT44.1
#=GS A0A3P9BLH4_9CICH/146-450    AC A0A3P9BLH4.1
#=GS A0A384L4U9_PLAKH/679-1177   AC A0A384L4U9.1
#=GS M5XAV8_PRUPE/288-596        AC M5XAV8.1
#=GS A0A084W347_ANOSI/166-470    AC A0A084W347.1
#=GS L8H121_ACACA/167-284        AC L8H121.1
#=GS A0A0K9NSB0_ZOSMR/239-532    AC A0A0K9NSB0.1
#=GS A0A3Q7GVV0_SOLLC/300-412    AC A0A3Q7GVV0.1
#=GS A0A445L2B7_GLYSO/274-584    AC A0A445L2B7.1
#=GS W5L0W7_ASTMX/155-451        AC W5L0W7.2
#=GS A0A445LB82_GLYSO/6-118      AC A0A445LB82.1
#=GS A0A1E4T8B0_9ASCO/69-421     AC A0A1E4T8B0.1
#=GS A0A1A6HWX8_NEOLE/1-78       AC A0A1A6HWX8.1
#=GS A0A3Q1CQ90_AMPOC/148-452    AC A0A3Q1CQ90.1
#=GS A0A093Z262_9PEZI/1932-2335  AC A0A093Z262.1
#=GS A0A0M8MM77_9BASI/284-643    AC A0A0M8MM77.1
#=GS A0A2A9NWF6_9AGAR/150-509    AC A0A2A9NWF6.1
#=GS A0A194YHX8_SORBI/8-69       AC A0A194YHX8.1
#=GS B9HJJ0_POPTR/14-142         AC B9HJJ0.1
#=GS A0A0K8LS94_9EURO/513-936    AC A0A0K8LS94.1
#=GS A0A3B3WDZ2_9TELE/152-456    AC A0A3B3WDZ2.1
#=GS F7IIH9_CALJA/211-515        AC F7IIH9.2
#=GS A0A340WQG0_LIPVE/154-458    AC A0A340WQG0.1
#=GS D2V2R2_NAEGR/345-728        AC D2V2R2.1
#=GS A0A2H9TFG8_9FUNG/47-132     AC A0A2H9TFG8.1
#=GS A0A445DRE4_ARAHY/313-367    AC A0A445DRE4.1
#=GS K7L2M7_SOYBN/222-532        AC K7L2M7.1
#=GS A0A1Z5TGF3_HORWE/410-819    AC A0A1Z5TGF3.1
#=GS A0A177DP47_ALTAL/503-908    AC A0A177DP47.1
#=GS A0A1X2I6A6_9FUNG/325-739    AC A0A1X2I6A6.1
#=GS E9CX55_COCPS/664-874        AC E9CX55.1
#=GS A0A371CX58_9APHY/223-584    AC A0A371CX58.1
#=GS N1JPK4_BLUG1/405-739        AC N1JPK4.1
#=GS M3ZIR8_XIPMA/152-456        AC M3ZIR8.2
#=GS A0A2V1E732_9PLEO/451-862    AC A0A2V1E732.1
#=GS A0A1E3PQT3_9ASCO/329-749    AC A0A1E3PQT3.1
#=GS A0A0U1LLY1_TALIS/488-911    AC A0A0U1LLY1.1
#=GS A0A284QL84_9AGAR/145-467    AC A0A284QL84.1
#=GS A0A2K5NM89_CERAT/155-459    AC A0A2K5NM89.1
#=GS A0A1S3RSC6_SALSA/57-361     AC A0A1S3RSC6.1
#=GS A0A3B4ZVT6_9TELE/148-452    AC A0A3B4ZVT6.1
#=GS A0A175WGL4_9PEZI/497-915    AC A0A175WGL4.1
#=GS A0A087VWE0_ECHMU/6-105      AC A0A087VWE0.1
#=GS A0A3B6HY90_WHEAT/278-586    AC A0A3B6HY90.1
#=GS L9L184_TUPCH/60-161         AC L9L184.1
#=GS S7ZYK2_PENO1/494-920        AC S7ZYK2.1
#=GS A0A287N3S1_HORVV/283-382    AC A0A287N3S1.1
#=GS A0A0R3W8P9_TAEAS/1199-1532  AC A0A0R3W8P9.2
#=GS A0A0N1HP48_9EURO/433-851    AC A0A0N1HP48.1
#=GS B8LV51_TALSN/464-891        AC B8LV51.1
#=GS A0A437AE58_9PEZI/427-841    AC A0A437AE58.1
#=GS A0A0D2WJL5_CAPO3/373-680    AC A0A0D2WJL5.1
#=GS A0A1S3GYH5_LINUN/131-435    AC A0A1S3GYH5.1
#=GS A0A1L9SSN9_9EURO/461-898    AC A0A1L9SSN9.1
#=GS C5FQI9_ARTOC/646-942        AC C5FQI9.1
#=GS Q6CG72_YARLI/122-503        AC Q6CG72.1
#=GS A0A0P1BR89_9BASI/578-964    AC A0A0P1BR89.1
#=GS A5DKK3_PICGU/212-544        AC A5DKK3.2
#=GS A0A1A9X1M6_9MUSC/207-412    AC A0A1A9X1M6.1
#=GS A0A2A9MPC3_9APIC/14-84      AC A0A2A9MPC3.1
#=GS A0A2V5H8J9_9EURO/568-990    AC A0A2V5H8J9.1
#=GS A0A260ZQP0_9PELO/363-644    AC A0A260ZQP0.1
#=GS A0A0S3QZQ1_PHAAN/225-536    AC A0A0S3QZQ1.1
#=GS W6Z5L0_COCMI/476-884        AC W6Z5L0.1
#=GS A0A2K1JP08_PHYPA/473-780    AC A0A2K1JP08.1
#=GS A0A493TY62_ANAPP/192-496    AC A0A493TY62.1
#=GS A0A0D9YYS3_9ORYZ/267-561    AC A0A0D9YYS3.1
#=GS A0A316UST4_9BASI/133-543    AC A0A316UST4.1
#=GS A0A3Q0R7E7_AMPCI/146-450    AC A0A3Q0R7E7.1
#=GS A0A2D0RJZ8_ICTPU/156-460    AC A0A2D0RJZ8.1
#=GS A0A2H3WYY0_PHODC/279-587    AC A0A2H3WYY0.1
#=GS A0A0K9QYP0_SPIOL/261-569    AC A0A0K9QYP0.1
#=GS A0A439DES5_9PEZI/511-913    AC A0A439DES5.1
#=GS A0A3B4ESG0_9CICH/126-209    AC A0A3B4ESG0.1
#=GS A0A0Q9WEX1_DROVI/161-465    AC A0A0Q9WEX1.1
#=GS A0A0L0BWQ4_LUCCU/161-465    AC A0A0L0BWQ4.1
#=GS A0A0D2C6I3_9EURO/471-888    AC A0A0D2C6I3.1
#=GS A0A059BFN3_EUCGR/305-612    AC A0A059BFN3.1
#=GS A0A443RSS8_9ACAR/93-155     AC A0A443RSS8.1
#=GS A0A0D2H1G9_9EURO/476-893    AC A0A0D2H1G9.1
#=GS C1GRQ5_PARBA/552-976        AC C1GRQ5.2
#=GS A0A397K0G1_9GLOM/144-510    AC A0A397K0G1.1
#=GS A0A074SW51_HAMHA/100-410    AC A0A074SW51.1
#=GS A0A3M9Y7P3_9PEZI/534-941    AC A0A3M9Y7P3.1
#=GS A0A165BE51_9APHY/218-574    AC A0A165BE51.1
#=GS R7QSC7_CHOCR/149-468        AC R7QSC7.1
#=GS A0A1Y2GGC5_9FUNG/346-779    AC A0A1Y2GGC5.1
#=GS A0A179GAL6_METCM/494-901    AC A0A179GAL6.1
#=GS A0A3Q3G9G6_9LABR/164-468    AC A0A3Q3G9G6.1
#=GS A0A0N4Y272_NIPBR/165-468    AC A0A0N4Y272.1
#=GS A0A0D2M9S7_9AGAR/221-582    AC A0A0D2M9S7.1
#=GS A0A368UL61_SOYBN/209-512    AC A0A368UL61.1
#=GS A0A4Y0BVG4_ANOFN/164-468    AC A0A4Y0BVG4.1
#=GS B7FUS5_PHATC/343-653        AC B7FUS5.1
#=GS A0A3P8TVK4_AMPPE/168-472    AC A0A3P8TVK4.1
#=GS A0A1F5L852_9EURO/509-935    AC A0A1F5L852.1
#=GS A0A061E8K2_THECC/249-557    AC A0A061E8K2.1
#=GS A0A1Y1V4M8_9FUNG/441-846    AC A0A1Y1V4M8.1
#=GS A0A0F9XH05_TRIHA/490-894    AC A0A0F9XH05.1
#=GS A0A0J8QSS9_COCIT/719-1015   AC A0A0J8QSS9.1
#=GS A0A3M7R5V6_BRAPC/1-235      AC A0A3M7R5V6.1
#=GS H0Y985_HUMAN/1-74           AC H0Y985.1
#=GS A0A091D116_FUKDA/54-358     AC A0A091D116.1
#=GS A0A1D6GJ54_MAIZE/1-223      AC A0A1D6GJ54.1
#=GS A0A0L0SDI2_ALLM3/154-496    AC A0A0L0SDI2.1
#=GS A0A0C3PNQ3_PISTI/204-560    AC A0A0C3PNQ3.1
#=GS A0A1D6GJ50_MAIZE/55-363     AC A0A1D6GJ50.1
#=GS E7F5M9_DANRE/157-461        AC E7F5M9.1
#=GS A0A2U3ZR90_ODORO/157-461    AC A0A2U3ZR90.1
#=GS A0A383YXK1_BALAS/54-358     AC A0A383YXK1.1
#=GS A0A1Q5TD96_9EURO/496-922    AC A0A1Q5TD96.1
#=GS A0A2K3E187_CHLRE/400-711    AC A0A2K3E187.1
#=GS Q7QCR6_ANOGA/167-471        AC Q7QCR6.4
#=GS H3HCB3_PHYRM/42-339         AC H3HCB3.1
#=GS A0A1S3QL38_SALSA/1-129      AC A0A1S3QL38.1
#=GS A0A401KM67_ASPAW/529-953    AC A0A401KM67.1
#=GS B8C420_THAPS/834-1158       AC B8C420.1
#=GS A0A1L7WHM6_9HELO/514-922    AC A0A1L7WHM6.1
#=GS F9X9K7_ZYMTI/143-550        AC F9X9K7.1
#=GS A0A1D6GJ51_MAIZE/21-329     AC A0A1D6GJ51.1
#=GS A0A067L241_JATCU/301-609    AC A0A067L241.1
#=GS T1KZU0_TETUR/215-519        AC T1KZU0.1
#=GS F4RP39_MELLP/327-721        AC F4RP39.1
#=GS H3D684_TETNG/112-415        AC H3D684.1
#=GS A0A182V7M5_ANOME/167-471    AC A0A182V7M5.1
#=GS A0A199W1Y5_ANACO/267-327    AC A0A199W1Y5.1
#=GS A0A443HY34_BYSSP/614-1038   AC A0A443HY34.1
#=GS A0A2I4G1Z0_JUGRE/325-633    AC A0A2I4G1Z0.1
#=GS A0A1L9N0X5_ASPTC/529-953    AC A0A1L9N0X5.1
#=GS A0A452RSQ5_URSAM/121-425    AC A0A452RSQ5.1
#=GS A0A3Q3SGM3_9TELE/163-467    AC A0A3Q3SGM3.1
#=GS A0A168MM25_MUCCL/194-553    AC A0A168MM25.1
#=GS A0A287N3R2_HORVV/287-386    AC A0A287N3R2.1
#=GS C8VKH8_EMENI/477-907        AC C8VKH8.1
#=GS A0A093I839_DRYPU/89-394     AC A0A093I839.1
#=GS A0A0C2Y6F0_HEBCY/224-585    AC A0A0C2Y6F0.1
#=GS M2Y0B2_GALSU/266-571        AC M2Y0B2.1
#=GS G4T9P0_SERID/11-312         AC G4T9P0.1
#=GS A0A182JZ09_9DIPT/166-470    AC A0A182JZ09.1
#=GS W2RTU2_9EURO/439-853        AC W2RTU2.1
#=GS A0A139IHZ9_9PEZI/406-814    AC A0A139IHZ9.1
#=GS A0A0F4GWW3_9PEZI/404-812    AC A0A0F4GWW3.1
#=GS A0A2G4T149_RHIZD/157-549    AC A0A2G4T149.1
#=GS H6C3J5_EXODN/483-900        AC H6C3J5.1
#=GS A0A063BKG3_USTVR/519-927    AC A0A063BKG3.1
#=GS G8YES7_PICSO/163-499        AC G8YES7.1
#=GS A0A067SVS3_GALM3/228-586    AC A0A067SVS3.1
#=GS A0A0C9MSK8_9FUNG/230-629    AC A0A0C9MSK8.1
#=GS J3LS73_ORYBR/283-591        AC J3LS73.1
#=GS W7XGT0_TETTS/538-866        AC W7XGT0.1
#=GS A0A2U9BMV0_SCOMX/148-452    AC A0A2U9BMV0.1
#=GS A0A1B8G6I7_9PEZI/488-891    AC A0A1B8G6I7.1
#=GS J4H5J9_9APHY/801-1687       AC J4H5J9.1
#=GS A0A183WVW6_TRIRE/19-73      AC A0A183WVW6.1
#=GS A0A1Y1ZE17_9PLEO/501-917    AC A0A1Y1ZE17.1
#=GS A0A3Q1BGK3_AMPOC/148-430    AC A0A3Q1BGK3.1
#=GS A0A3Q1BWN3_AMPOC/179-483    AC A0A3Q1BWN3.1
#=GS A0A3P9MSC4_POERE/148-452    AC A0A3P9MSC4.1
#=GS A0A0R3S2K0_9BILA/160-461    AC A0A0R3S2K0.1
#=GS I3L7J1_PIG/154-458          AC I3L7J1.2
#=GS A0A2V1AQC4_9ASCO/187-519    AC A0A2V1AQC4.1
#=GS A0A1Q8RS07_9PEZI/543-950    AC A0A1Q8RS07.1
#=GS A0A2P6RQS2_ROSCH/16-187     AC A0A2P6RQS2.1
#=GS A0A2H3IAQ5_9EURO/499-926    AC A0A2H3IAQ5.1
#=GS A0A3B6JDS4_WHEAT/274-582    AC A0A3B6JDS4.1
#=GS A0A0L1J5T9_ASPNO/470-893    AC A0A0L1J5T9.1
#=GS A0A3B3IM75_ORYLA/152-449    AC A0A3B3IM75.1
#=GS A0A158QCL1_HYMDI/1191-1520  AC A0A158QCL1.1
#=GS F4PQP1_CAVFA/574-793        AC F4PQP1.1
#=GS G0RU33_HYPJQ/376-780        AC G0RU33.1
#=GS A0A1B9IS53_9TREE/330-690    AC A0A1B9IS53.1
#=GS A0A150VI68_9PEZI/451-861    AC A0A150VI68.1
#=GS A0A061E8Q1_THECC/291-530    AC A0A061E8Q1.1
#=GS A0A0U5G0G1_9EURO/476-905    AC A0A0U5G0G1.1
#=GS A0A0A2VXT3_BEABA/543-957    AC A0A0A2VXT3.1
#=GS J3P5X4_GAGT3/442-864        AC J3P5X4.1
#=GS A0A183RP39_9TREM/62-203     AC A0A183RP39.1
#=GS A0A178B9L3_9PLEO/427-836    AC A0A178B9L3.1
#=GS A0A402F9Y0_9SAUR/269-573    AC A0A402F9Y0.1
#=GS A0A3Q3GDW0_9LABR/153-457    AC A0A3Q3GDW0.1
#=GS A0A2P8Z0X7_BLAGE/1-115      AC A0A2P8Z0X7.1
#=GS A0A0D9VY82_9ORYZ/287-573    AC A0A0D9VY82.1
#=GS Q5KCU1_CRYNJ/304-672        AC Q5KCU1.2
#=GS A0A0R0KH46_SOYBN/282-440    AC A0A0R0KH46.1
#=GS A0A182J9C8_9DIPT/166-470    AC A0A182J9C8.1
#=GS G3ATW5_SPAPN/144-460        AC G3ATW5.1
#=GS A0A2B7Y0B6_9EURO/545-973    AC A0A2B7Y0B6.1
#=GS A0A2V5HTN5_9EURO/538-960    AC A0A2V5HTN5.1
#=GS A0A0C3MIH3_9AGAM/110-481    AC A0A0C3MIH3.1
#=GS N4TQU8_FUSC1/478-886        AC N4TQU8.1
#=GS A0A226MWH8_CALSU/18-69      AC A0A226MWH8.1
#=GS A0A409XIG9_PSICY/231-592    AC A0A409XIG9.1
#=GS M3VWI9_FELCA/156-460        AC M3VWI9.3
#=GS A0A2K6JMK2_RHIBE/88-392     AC A0A2K6JMK2.1
#=GS D8S9L2_SELML/47-101         AC D8S9L2.1
#=GS A0A428Q645_9HYPO/487-893    AC A0A428Q645.1
#=GS G1PDL5_MYOLU/89-393         AC G1PDL5.1
#=GS Q753Z6_ASHGO/106-416        AC Q753Z6.2
#=GS A0A4D9A7Y5_SALSN/287-338    AC A0A4D9A7Y5.1
#=GS A0A3Q3NLL3_9LABR/148-452    AC A0A3Q3NLL3.1
#=GS A0A1U7W0U7_NICSY/298-606    AC A0A1U7W0U7.1
#=GS A0A397SHN4_9GLOM/91-452     AC A0A397SHN4.1
#=GS A0A1R3RX43_ASPC5/526-950    AC A0A1R3RX43.1
#=GS A0A0D9P670_METAN/501-908    AC A0A0D9P670.1
#=GS A0A1J9P6H9_9EURO/547-973    AC A0A1J9P6H9.1
#=GS A0A0C2XAG7_AMAMU/146-505    AC A0A0C2XAG7.1
#=GS W1NEH6_AMBTC/307-382        AC W1NEH6.1
#=GS A0A367JQM9_9FUNG/163-555    AC A0A367JQM9.1
#=GS I3JV10_ORENI/126-430        AC I3JV10.1
#=GS A0A316U075_9BASI/125-513    AC A0A316U075.1
#=GS J4CCU4_THEOR/97-497         AC J4CCU4.1
#=GS A0A2A2J719_9BILA/244-547    AC A0A2A2J719.1
#=GS A0A0M9F296_FUSLA/480-887    AC A0A0M9F296.1
#=GS A0A0V0Y6I8_TRIPS/187-388    AC A0A0V0Y6I8.1
#=GS A0A1I8PN54_STOCA/157-461    AC A0A1I8PN54.1
#=GS A0A317SX53_9PEZI/268-648    AC A0A317SX53.1
#=GS A0A0P1B5A8_PLAHL/230-527    AC A0A0P1B5A8.1
#=GS A0A3S4RAI0_9ACAR/95-399     AC A0A3S4RAI0.1
#=GS A0A3A2ZAL5_9EURO/580-1004   AC A0A3A2ZAL5.1
#=GS A0A068UD26_COFCA/298-615    AC A0A068UD26.1
#=GS A0A074YKM4_AURSE/420-828    AC A0A074YKM4.1
#=GS A0A3B1K9R5_ASTMX/158-312    AC A0A3B1K9R5.1
#=GS A5K7K8_PLAVS/700-1245       AC A5K7K8.1
#=GS A0A1X7VSL9_AMPQE/107-411    AC A0A1X7VSL9.1
#=GS A0A329SDJ3_9STRA/241-538    AC A0A329SDJ3.1
#=GS T1HNN3_RHOPR/105-289        AC T1HNN3.1
#=GS A0A3Q2US43_HAPBU/152-456    AC A0A3Q2US43.1
#=GS A0A1Y1UFV9_9TREE/315-675    AC A0A1Y1UFV9.1
#=GS A0A1E3NNY9_9ASCO/185-539    AC A0A1E3NNY9.1
#=GS Q6BL97_DEBHA/185-520        AC Q6BL97.2
#=GS A0A0K0ETG6_STRER/131-433    AC A0A0K0ETG6.1
#=GS Q7S6C7_NEUCR/509-944        AC Q7S6C7.3
#=GS A0A1E3P5K6_WICAA/136-468    AC A0A1E3P5K6.1
#=GS A0A3B1JJJ5_ASTMX/169-473    AC A0A3B1JJJ5.1
#=GS A0A2I0KSE9_PUNGR/75-161     AC A0A2I0KSE9.1
#=GS G1SH46_RABIT/89-394         AC G1SH46.1
#=GS A0A0C2WNV1_9AGAM/1-107      AC A0A0C2WNV1.1
#=GS A0A3B4AGR4_9GOBI/159-462    AC A0A3B4AGR4.1
#=GS A0A1U8ATL6_NELNU/315-623    AC A0A1U8ATL6.1
#=GS A0A0L6VB28_9BASI/601-1051   AC A0A0L6VB28.1
#=GS G3X184_SARHA/89-393         AC G3X184.1
#=GS D7T8I0_VITVI/302-614        AC D7T8I0.1
#=GS A0A0S3RFI4_PHAAN/273-581    AC A0A0S3RFI4.1
#=GS H9JPQ7_BOMMO/1-207          AC H9JPQ7.1
#=GS A0A2J6PXT9_9HELO/487-890    AC A0A2J6PXT9.1
#=GS A0A1D6GJ49_MAIZE/282-398    AC A0A1D6GJ49.1
#=GS A0A445KB90_GLYSO/279-587    AC A0A445KB90.1
#=GS A0A421JWN0_9ASCO/164-481    AC A0A421JWN0.1
#=GS R9P8J3_PSEHS/547-927        AC R9P8J3.1
#=GS A0A2N1J7N0_9BASI/251-621    AC A0A2N1J7N0.1
#=GS A0A2U3WP86_ODORO/157-461    AC A0A2U3WP86.1
#=GS A0A2P6QQC0_ROSCH/3-58       AC A0A2P6QQC0.1
#=GS A0A2I1CL93_9EURO/514-937    AC A0A2I1CL93.1
#=GS A0A2P7YE21_9PEZI/437-839    AC A0A2P7YE21.1
#=GS A0A409W7B4_9AGAR/231-594    AC A0A409W7B4.1
#=GS A0A3B1JHW8_ASTMX/169-394    AC A0A3B1JHW8.1
#=GS A0A1Y2D476_9BASI/266-628    AC A0A1Y2D476.1
#=GS A0A151P9T6_ALLMI/169-473    AC A0A151P9T6.1
#=GS A0A100IJ27_ASPNG/529-953    AC A0A100IJ27.1
#=GS A0A1V6PVN0_9EURO/507-933    AC A0A1V6PVN0.1
#=GS A0A365NK90_GIBIN/476-884    AC A0A365NK90.1
#=GS A0A182PZY7_9DIPT/166-470    AC A0A182PZY7.1
#=GS B6AIH9_CRYMR/335-605        AC B6AIH9.1
#=GS A0A117NL14_9EURO/494-920    AC A0A117NL14.1
#=GS A0A482WJJ6_LAOST/154-458    AC A0A482WJJ6.1
#=GS A0A444ZWU0_ARAHY/265-346    AC A0A444ZWU0.1
#=GS A0A371EH33_MUCPR/330-611    AC A0A371EH33.1
#=GS A0A1B7NH41_9AGAM/126-486    AC A0A1B7NH41.1
#=GS A0A2I4C6P8_9TELE/148-452    AC A0A2I4C6P8.1
#=GS G3BBL9_CANTC/182-515        AC G3BBL9.1
#=GS N1Q538_DOTSN/194-602        AC N1Q538.1
#=GS A0A2C9M797_BIOGL/163-466    AC A0A2C9M797.1
#=GS A0A137QUE8_9AGAR/265-637    AC A0A137QUE8.1
#=GS A0A453H857_AEGTS/130-193    AC A0A453H857.1
#=GS A0A178ZZN9_9EURO/476-893    AC A0A178ZZN9.1
#=GS A0A3B3B8C0_ORYME/153-457    AC A0A3B3B8C0.1
#=GS A0A0N4TYC0_BRUPA/146-447    AC A0A0N4TYC0.1
#=GS F7W8V7_SORMK/513-952        AC F7W8V7.1
#=GS A0A319D1R4_9EURO/437-859    AC A0A319D1R4.1
#=GS A0A0D2V8J2_GOSRA/97-405     AC A0A0D2V8J2.1
#=GS Q6CK87_KLULA/123-431        AC Q6CK87.1
#=GS V7CPU5_PHAVU/219-529        AC V7CPU5.1
#=GS A0A175YGC3_DAUCS/408-460    AC A0A175YGC3.1
#=GS Q4UDY6_THEAN/219-612        AC Q4UDY6.1
#=GS A0A183JJB5_9TREM/6-95       AC A0A183JJB5.1
#=GS A0A316V3Z4_9BASI/87-451     AC A0A316V3Z4.1
#=GS I2GX06_TETBL/111-421        AC I2GX06.1
#=GS A0A2Y9JMP0_ENHLU/54-358     AC A0A2Y9JMP0.1
#=GS A0A0N5ASC9_9BILA/169-470    AC A0A0N5ASC9.1
#=GS A0A194VE55_9PEZI/551-965    AC A0A194VE55.1
#=GS F4W6N3_ACREC/165-474        AC F4W6N3.1
#=GS A0A195EQD6_9HYME/166-473    AC A0A195EQD6.1
#=GS A0A183PAC9_9TREM/19-169     AC A0A183PAC9.1
#=GS A0A2J6TR25_9HELO/367-769    AC A0A2J6TR25.1
#=GS A0A482VVL3_9CUCU/146-244    AC A0A482VVL3.1
#=GS A0A0N5CJM6_THECL/145-456    AC A0A0N5CJM6.1
#=GS K1WML6_MARBU/543-941        AC K1WML6.1
#=GS A0A1S2YBG8_CICAR/315-623    AC A0A1S2YBG8.1
#=GS B3S355_TRIAD/1-218          AC B3S355.1
#=GS A0A2N3NFV2_9PEZI/514-941    AC A0A2N3NFV2.1
#=GS Q6FQE6_CANGA/124-433        AC Q6FQE6.1
#=GS G3PWJ0_GASAC/1-203          AC G3PWJ0.1
#=GS A0A178ERB1_TRIRU/698-1010   AC A0A178ERB1.1
#=GS A0A0K0DGF7_ANGCA/99-402     AC A0A0K0DGF7.1
#=GS A0A2T4A1A2_TRIHA/379-783    AC A0A2T4A1A2.1
#=GS A0A167R3C1_PHYB8/217-616    AC A0A167R3C1.1
#=GS E3KBM7_PUCGT/287-709        AC E3KBM7.2
#=GS A0A0D9YYS2_9ORYZ/276-570    AC A0A0D9YYS2.1
#=GS Q582A2_TRYB2/164-503        AC Q582A2.1
#=GS A0A0V0VQ63_9BILA/124-434    AC A0A0V0VQ63.1
#=GS A0A287N3R7_HORVV/285-384    AC A0A287N3R7.1
#=GS A0A251IW47_MANES/290-598    AC A0A251IW47.1
#=GS A0A177V6D5_9BASI/577-746    AC A0A177V6D5.1
#=GS H0VB09_CAVPO/235-539        AC H0VB09.2
#=GS A0A3P8UX56_CYNSE/105-403    AC A0A3P8UX56.1
#=GS A7AU13_BABBO/259-724        AC A7AU13.1
#=GS A0A3B3QLN5_9TELE/152-456    AC A0A3B3QLN5.1
#=GS A0A135LGR7_PENPA/479-905    AC A0A135LGR7.1
#=GS A0A1S3EKZ5_DIPOR/54-358     AC A0A1S3EKZ5.1
#=GS A0A1Y1IL65_KLENI/1-202      AC A0A1Y1IL65.1
#=GS A0A022QN69_ERYGU/280-588    AC A0A022QN69.1
#=GS A0A395GSL1_9EURO/526-950    AC A0A395GSL1.1
#=GS A0A060SNR6_PYCCI/272-533    AC A0A060SNR6.1
#=GS G3R827_GORGO/150-454        AC G3R827.1
#=GS W1NEH6_AMBTC/378-592        AC W1NEH6.1
#=GS A0A1S3XAN3_TOBAC/12-320     AC A0A1S3XAN3.1
#=GS A0A094ET08_9PEZI/488-891    AC A0A094ET08.1
#=GS A0A2G5E9V9_AQUCA/343-651    AC A0A2G5E9V9.1
#=GS A0A3P9NMV2_POERE/152-456    AC A0A3P9NMV2.1
#=GS A0A060W4V1_ONCMY/153-457    AC A0A060W4V1.1
#=GS A0A428R3R8_9HYPO/504-910    AC A0A428R3R8.1
#=GS A0A3S2L3L0_CHISP/136-439    AC A0A3S2L3L0.1
#=GS A0A2U1N8L5_ARTAN/255-563    AC A0A2U1N8L5.1
#=GS A0A3Q7WB59_URSAR/157-461    AC A0A3Q7WB59.1
#=GS G2Q087_MYCTT/498-919        AC G2Q087.1
#=GS A0A158QHH9_HYMNN/1227-1580  AC A0A158QHH9.1
#=GS H0Y985_HUMAN/73-208         AC H0Y985.1
#=GS A0A3B3B9M1_ORYME/153-457    AC A0A3B3B9M1.1
#=GS H2USE8_TAKRU/148-452        AC H2USE8.2
#=GS A0A0D2VFN8_GOSRA/75-126     AC A0A0D2VFN8.1
#=GS A0A0K9Q5R7_ZOSMR/309-614    AC A0A0K9Q5R7.1
#=GS A0A1E4TTC9_PACTA/148-506    AC A0A1E4TTC9.1
#=GS A0A0N4ZS18_PARTI/185-487    AC A0A0N4ZS18.1
#=GS A0A3Q0H9V5_ALLSI/29-333     AC A0A3Q0H9V5.1
#=GS A0A2K1QGE7_9PEZI/436-835    AC A0A2K1QGE7.1
#=GS A0A428UAT5_9HYPO/504-910    AC A0A428UAT5.1
#=GS A0A066WI69_TILAU/108-489    AC A0A066WI69.1
#=GS A0A0C9YSW7_9AGAM/136-495    AC A0A0C9YSW7.1
#=GS A0A3B3IHI6_ORYLA/152-456    AC A0A3B3IHI6.1
#=GS A0A1A9V983_GLOAU/169-462    AC A0A1A9V983.1
#=GS A0A059IZR3_TRIIM/564-1002   AC A0A059IZR3.1
#=GS R0J534_SETT2/473-880        AC R0J534.1
#=GS A0A093JNV3_STRCA/89-393     AC A0A093JNV3.1
#=GS A0A2H5PW56_CITUN/273-575    AC A0A2H5PW56.1
#=GS A0A2K3PRM3_TRIPR/197-256    AC A0A2K3PRM3.1
#=GS A0A445DRE0_ARAHY/238-530    AC A0A445DRE0.1
#=GS A0A287N3R1_HORVV/291-599    AC A0A287N3R1.1
#=GS A0A445JYS1_GLYSO/222-532    AC A0A445JYS1.1
#=GS K7L2M8_SOYBN/93-403         AC K7L2M8.1
#=GS A0A3Q0SHW2_AMPCI/165-469    AC A0A3Q0SHW2.1
#=GS E3MF59_CAERE/363-668        AC E3MF59.1
#=GS W6V161_ECHGR/127-460        AC W6V161.1
#=GS T0KIH2_COLGC/550-958        AC T0KIH2.1
#=GS A0A0L0HN29_SPIPD/413-872    AC A0A0L0HN29.1
#=GS A0A1V8V094_9PEZI/436-839    AC A0A1V8V094.1
#=GS A0A1V6NAF3_9EURO/494-920    AC A0A1V6NAF3.1
#=GS A0A058ZGA1_FONAL/168-519    AC A0A058ZGA1.1
#=GS A0A2T9ZCT9_9FUNG/367-851    AC A0A2T9ZCT9.1
#=GS Q5CR83_CRYPI/2-95           AC Q5CR83.1
#=GS A0A163J0F6_DIDRA/466-872    AC A0A163J0F6.1
#=GS A0A1Y2WI68_9PEZI/457-861    AC A0A1Y2WI68.1
#=GS A0A423VYA8_9PEZI/535-949    AC A0A423VYA8.1
#=GS A0A024TSW1_9STRA/165-464    AC A0A024TSW1.1
#=GS A0A1V6S1X1_9EURO/504-930    AC A0A1V6S1X1.1
#=GS C0NS88_AJECG/511-937        AC C0NS88.1
#=GS A0A016UHP4_9BILA/157-510    AC A0A016UHP4.1
#=GS D4ALW7_ARTBC/556-994        AC D4ALW7.1
#=GS A0A3B4DBW5_PYGNA/151-440    AC A0A3B4DBW5.1
#=GS A0A183MPC1_9TREM/147-438    AC A0A183MPC1.1
#=GS A0A287N3L0_HORVV/284-592    AC A0A287N3L0.1
#=GS A0A0D3CXY5_BRAOL/60-307     AC A0A0D3CXY5.1
#=GS A0A316ZD58_9BASI/90-479     AC A0A316ZD58.1
#=GS A0A0L0N3T3_9HYPO/778-1185   AC A0A0L0N3T3.1
#=GS Q7RIF6_PLAYO/710-1151       AC Q7RIF6.1
#=GS A0A094FW50_9PEZI/1726-2129  AC A0A094FW50.1
#=GS A0A2I4G1X4_JUGRE/377-685    AC A0A2I4G1X4.1
#=GS N1QLK5_SPHMS/376-786        AC N1QLK5.1
#=GS A0A2P5BXY7_TREOI/309-612    AC A0A2P5BXY7.1
#=GS A0A1V9Y9K0_9STRA/186-499    AC A0A1V9Y9K0.1
#=GS R1EHZ4_BOTPV/1-175          AC R1EHZ4.1
#=GS F2TX98_SALR5/235-537        AC F2TX98.1
#=GS A0A0L0FW48_9EUKA/391-690    AC A0A0L0FW48.1
#=GS A0A1V8TJ72_9PEZI/435-838    AC A0A1V8TJ72.1
#=GS A0A0L0SU77_ALLM3/1-338      AC A0A0L0SU77.1
#=GS C0H483_PLAF7/785-1268       AC C0H483.1
#=GS A0A2P6U0H9_CHLSO/359-673    AC A0A2P6U0H9.1
#=GS A0A445C2H6_ARAHY/301-470    AC A0A445C2H6.1
#=GS K7JA83_NASVI/105-483        AC K7JA83.1
#=GS A0A1C3YJ44_GIBZE/484-891    AC A0A1C3YJ44.1
#=GS A0A1W4X088_AGRPL/101-405    AC A0A1W4X088.1
#=GS W9Z0N2_9EURO/482-899        AC W9Z0N2.1
#=GS A0A1Y2AQA9_9FUNG/463-868    AC A0A1Y2AQA9.1
#=GS A0A0L9UD97_PHAAN/273-581    AC A0A0L9UD97.1
#=GS L8H5I3_ACACA/1-195          AC L8H5I3.1
#=GS A0A2S7QT65_9HELO/536-908    AC A0A2S7QT65.1
#=GS A0A162P0E7_9PEZI/600-1008   AC A0A162P0E7.1
#=GS A0A453H816_AEGTS/318-626    AC A0A453H816.1
#=GS A0A3B1JQ59_ASTMX/158-462    AC A0A3B1JQ59.1
A0A287N3T1_HORVV/302-401               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................G-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------lstcstdrvtfellrflldgaiavlaf............................................................................................................................................
A0A0D9RV92_CHLSB/262-566               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLVSLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A1L9V1M9_ASPBC/530-954               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.II.AT..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLLC..........A....DVVERFQ.....LW.LMLTIIASRNLVEtgafnilgslsfslggytstgtnstpls...............................................tpprtassilpqaftivpssiiasfsqvNTY.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FItallphqpsstaveattlsaihsqyvpapmpspp......................................................pltlrnfiptstayagaffrqllantmpspaqsvYI.FTIV.LI.LTGFVVLLILKLLLGMVLLAYARSRYK.......................................................................................................................................................................
G4V1J3_NEUT9/482-911                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SHYNKADLLQGAV.VI.FS..S.IALMS....L.DA......SR.MYHSIR...AQ..SAIKLYTIYNLLEV.................GDRLLSALGQDI.FECLFSNET.................................LSRDSL.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGI.FCLA.....L....V..YN.........ILHA....VI.L.....F....YQVIALNV.AV..NSY.S..NTLLTLLMSNQFVEIKS...........AVFKRFEKENTF.QMAC..........A....DIVERFQ.....LW.IMLLIIAMRNVVEvgglsvpgagsedagp......................................................................ssfplhtasilpasftiLPN.WLWSG..EVLSPLAVVI..ASE.MVVDWIKHAY....VNKFN..NIK..P.N.F.YSRIL.DIL..............CKDYYTN--------.......................................................---------.---LTRRLGLPLLPLSCLFI.RASF......QIYNM.FVavhvppplppstqtslsvesatpspamlaaldhldkkirialgravygypf....................gesgglgdnvygpasaptgdtpeaaglathiwhsvskwlpewkwtsddviaFL.TMIT.VF.LLIFLVLLIFKLLLGMFLLRYSRDRY-a......................................................................................................................................................................
A0A212FJL3_DANPL/140-443               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKPAETCDVLKGSI.LL.VC..S.ILMCY....I.DT......NM.MYHLVK...SQ..SVMKLYIFYNMLEV.................GDRLFSAFGQDT.IDALFWTAT.................................E---P-.-....................-............................................................................................................................................................................................................................................................................................................................................R................................................DRKREHLG.LIPH.LIFA.....I....I..YV.........FLHS....LL.V.....L....FQATTLNV.AF..NSN.N..KSLLIIMMSNNFVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERLH.....LS.VLLFIVVLQTMKE......................................................................................................yMWK.EERFW..ILAPDCVLVL..TFE.VIIDWVKHAF....ITRFN..EIP..Y.G.V.YREYT.VSL..............AYDVAQTRQKY----.......................................................----AFSDH.SDLVARRMGFIPLPLGVVIT.RVLV......HAVKI.DG..........................................................................................................................-L.AAIL.LI.FIAYLCLISIRILISIVILGKAC----dli....................................................................................................................................................................
Q4QIS9_LEIMA/122-495                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wrr---CELRDIITLLV.LT.IT..L.GSYWV....A.DLattqlySY.LYHAVR...RT..SFIKVVMIFSILDV.................ADKILSSFSQDS.LEVLYAAVDdeyayrc..................ahrcqtkpA-----.-....................-............................................................................................................................................................................................................................................................................................................................................Agdtpmnraafgga.....................cagrddagyanarqHTPPSRWL.LAGS.AIAA.....C....I..ST.........SCHS....LS.L.....L....LHVVTLNV.AI..NAE.G..NSLLALLVGNNFTELKS...........VVLKKNTPESLQ.SVCA..........L....DALERMQ.....YV.VFFLVMLLHHMHE.......................................................................................................---.-RFTD..FAVADVFVIL..CVE.VAIDFVKHLF....VFRFN..GIP..P.S.M.FRAYS.QLA..............LLDLSCETVLWRLPSlevvasgsgs...................................gvatrmeeaaELLTPAFGF.APKNVKRNGFDAIAYAALLL.WSCE......RVAGY.LL..........................................................................................................................-W.QAPL.VC.VLLVLILALLKLMLSSIVYGMCAR---ft.....................................................................................................................................................................
A0A1S9DNK3_ASPOZ/565-988               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.AVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VVHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALLSLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfignlgssftsqststnstpls................................................tpprtmssilpqsftivpssiiasfshvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.V.I.YKRFL.DIL..............TKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallpqhpsstavestslssiyshyvpapipspp......................................................pltlrtivpasaahmnaffqqllantmpspaqsvYI.FTVV.LI.LTGYVVLLIVKLLLGMVLLAYARSRYR.......................................................................................................................................................................
S7RS40_GLOTA/413-735                   ....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................tvlyftdfqt--------------.--.--..-.-----....-.--......--.------...--..------------QI.................ADRLLASIGQDI.LDCLFSRPT.................................LAPSS-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RKSKTFR.PLSF.FLLA.....V....L..YV.........VLHT....LT.L.....T....YQTISLNV.AV..NSY.D..YSLLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLIIVAFRNLLElsgsavdwsgeegipmp....................................................................ksfllpkrvsrwlpwgwrWVR.GSVIG..TISYPVLTVL..ASE.TLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CGDLKGGWVRP----.......................................................GRKHSYVDQ.SPLVARRLGFAALPLANLAI.IIGS......QCFFL.LQsqlqstsv.........................................................................................................aawqgetarVV.KWAV.LG.LLFWVCAVVVKIIIGINLLSYASKRQ-a......................................................................................................................................................................
A3LUY6_PICST/104-437                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................liv-----KKDIITLTI.VS.FS..I.VVLSSk..sL.DI......SR.MYHEVR...GE..THIKLYVMFGVLEV.................AEKLCSSLGQDI.LNILYNIPL.................................D---S-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KGSQIPK.FAVF.FLLS.....I....I..YL.........SLHA....YI.L.....I....SQTVSLNV.AA..NSY.S..NALMTLLLSNQFSELKS...........SVFKKSDREGLF.QIAM..........A....DLTERFQ.....LL.FMLGIIALRNLLQlnsnhi..........................................................................................glipnswKSW.NTWFG..AIFGPGIVVI..GSE.ILVDWLKHCY....ISKFN..KVR..P.R.V.YRNFV.YVL..............SLDFLQVFKLGPNNQ.......................................................LEANDLTDY.I-VLTRRIGLPLLASVVCSL.RMTM......SDLKR.VFvfpiv...............................................................................................................asytysIL.ASGA.LI.VATFLTLILIRLILGLVILKMASSTK-a......................................................................................................................................................................
B9SNG4_RICCO/279-353                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--ASELSDIGCFIV.LT.SG..V.ALLEH....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGGDV.LQTLFNSAE.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------aqa....................................................................................................................................................................
G0V9N6_NAUCC/118-426                   .....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................mertykers----------LLFL.II.AS..S.IILCK....S.DT......SI.IYHKIK...RQ..STMKLYMLFNVLEM.................GDKMLASMGQSL.LAVVLSRKG.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-YRRKTYN.RIVL.IFLG.....V....V..YI.........IAHG....YV.L.....L....YQTVALNV.AV..NSY.S..NSLLTLLLSMQFAEIKS...........SVLKKFDKEGLF.QITI..........A....DAVERFK.....LL.LILMIITVRNIATnpval............................................................................................ssisinKTS.SAVAN..FLSGPFISVI..GSE.IIVDWIKHAY....ITKFN..RIR..P.Q.I.YDKFF.FIT..............YKDHSES--------.......................................................---------.LRKFQDRLGLTLPTFVVVFI.VMVL......PTLLQ.VLrft...................................................................................................................ssfrFL.QSLL.IM.ALVFCLLIVVKLVLHAILRQWEQR---iqr....................................................................................................................................................................
Q4WHS2_ASPFU/514-937                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....T..YT.........VLHA....TS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgtlssslssrststnstpls................................................tpprssssilpqsftffpsslissfshvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallphqpsstavestslasihshyvpspipsap......................................................pltlrtilpvsaahasaffrrvlanampspaqsvYI.FTIV.LI.LTAFILLLILKLLLGMLLLVYSRSRY-r......................................................................................................................................................................
A0A2Y9JLN7_ENHLU/54-358                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.TAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYLGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A445DRJ2_ARAHY/312-462               ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................akfhpeme--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....IQAITLSA.CM..VAH.N..NALPAMLVSNNFAEIKS...........YVFKGYNKDNVR.SLVY..........F....DSIERFH.....IS.ALILFVLAQNILE.......................................................................................................-AE.GSWLG..SFLINILLVF..LCE.MAIDIIKHSF....IAKFN..NIK..P.I.A.FSEFL.EAL..............CKQVIRVLTP-----.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------vyaanlpynpfpwr.........................................................................................................................................................
G5BGC5_HETGA/89-393                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IS..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................I-.LSYA.CV.TLFYFGLISLKILNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A093XFM9_9PEZI/1680-2083             ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLSAVGQDI.LECLVSDET.................................LERGSD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FVLT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsaggaad...................................................................tlrnatiplrssiipnsfKII.PSWSG..EVLSPFLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FIathfppplastatsislessataspattaameh.......................................................ldilirkalgrstygtdplvertwqifdsddiisFI.AMAA.FF.LGAFLALLSCKLVLGMLLLRYSRRRY-e......................................................................................................................................................................
A0A287N3S5_HORVV/203-303               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................G-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------lstcstdrvtfellrflldgaiavlafd...........................................................................................................................................
A0A316W179_9BASI/578-964               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-HSSHKCDLLKAAL.IV.LS..C.YILSR....VtDA......SK.MYHSVR...GQ..DFVKLSVIFNVLEI.................ADRLCCSFGQDL.LDSLFSRAT.................................LARRKD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RQPYLR.PTGF.FLLS.....L....A..YI.........LAHT....FV.L.....F....YQLVTLNV.AI..MSY.D..NALLTLLISNQFVEIKG...........SVFKKFEKENLF.QLTC..........A....DIVERFQ.....LG.LMLSAIALRNLIEisgisasieg..................................................................................gtgplptsftvFPS.LNMLE..TIIVPVAIVL..ASE.CIVDWLKHAF....ITKFN..HIR..P.A.V.YGRFM.DVL..............CRDLVAG--PGSAQG.......................................................SRKHNFVDQ.SPIVSRRLGFAALPLACLLI.RITS......QILGM.LRdtshfdecaaphasqsgfklvygigl......................................................................argaarmlgahdpegaaneiaatiarSA.AWAL.TV.VIGWVFLVGLKLLLGLNLVSYASHRY-a......................................................................................................................................................................
A0A3S3NNU5_9MAGN/301-608               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ca---AELSDFGCFIV.LA.SG..V.TLLQA....T.DI......SL.IYHIIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGGDV.LQVLFNSAE.................................GVASCA.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMAFELMR.FILD.QTIA.....V....L..AI.........LLHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFSEIKS...........NVFKRVSKENIH.SLAY..........Y....DTVERFH.....IT.AFVLFVLAQNILE.......................................................................................................-AD.GPWFG..SFLNNALLVY..VCE.MLIDVIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQTLNI--------.......................................................--------Q.SEEGRKSLTFVPLAPACVVI.RVLT......PIYAA.HLpygp..................................................................................................................lpwrLF.WIFI.LS.ALTYAMLVILKIIVGMGLRLHATWY--vs.....................................................................................................................................................................
G9MES9_HYPVG/212-616                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGAV.II.CS..S.LVLMK....L.DA......SR.MYHLIR...AQ..SAIKLYVVYNILEV.................GDKLLSALGQDI.LECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FVLA.....L....I..YC.........VLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDSLF.QLTC..........A....DIVERFQ.....LW.IMLLIIGMRNIVEvgglsvpgagmndapt......................................................................naapvhspsilphsftvLPS.WVMSG..EVLSPFLIVV..GSE.MLVDSIKHAY....VTKFN..NMK..P.K.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFTAP.S--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsahipmplpistqtsltkasatpsspamiaalnrf...................................................dslirdslgratygypydhplnsrpwykwtsddaiaAI.TMVV.VF.FIIFLVLLILKLLLGMILLKYARNRY-a......................................................................................................................................................................
POD1_ARATH/303-611                     ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--ASELSDLACFLV.LA.TG..T.ILLGR....T.DI......SL.IYHMIR...GQ..STIKLYVVYNILEI.................FDRLCQSFCGDV.FGALFSSAK................................gL-SISP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................KLRFSTWR.FVSD.LALT.....M....A..AS.........ILHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........SVFKRFSKDNIH.GLVY..........A....DSIERFH.....IS.AFLVSVLAQNILE.......................................................................................................-SE.GAWFG..NFIYNATTVF..FCE.MMIDIIKHSF....LAKFN..DIK..P.I.A.YSEFL.QAL..............CEQTLNIRPED----.......................................................---------.---RKTNLTFVPLAPACVVI.RVLT......PVYAA.HLpysp..................................................................................................................lpwrML.WMVI.LF.VITYIMLTSLKVLIGMGLRKHATWY--in.....................................................................................................................................................................
A0A287N3L1_HORVV/313-412               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................G-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------lstcstdrvtfellrflldgaiavlaf............................................................................................................................................
A0A287N3R0_HORVV/1-119                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..-CE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQPDDRQKDltfip............................................lapacvV--SQHVQM.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------scsytanlyvpntllmskvfivcvgnscadssvchppscwavylenildpalvs.................................................................................................................
A0A4D8Z8L4_SALSN/279-588               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSPELSDFGCFIA.LI.IG..V.TLLQQ....A.DI......SL.IYHMIR...GQ..GIIKLYVVYNVLEV.................FDKLCQSFGGDV.MQALFNSAD.................................GLANCS.P....................E............................................................................................................................................................................................................................................................................................................................................N................................................-MQFWMWR.FVSD.EALA.....V....A..AS........dILLI....TI.H.....T....CIAITLST.CI..VAH.N..NALFAMLVSNNFAEIKS...........NVFKRYSKDNVQ.SLVY..........F....DSVERFH.....IT.AFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLSNALVVY..ICE.VMIDIIKHSF....ISKFN..GLK..P.T.A.FSEFL.EDL..............CKQTLNMQTE-----.......................................................---------.--NSNKNLTFVPLAPACVVI.RVLR......PVYAA.HLpynp..................................................................................................................lpwrLF.WMLV.LS.GMTFVMLASLKMMIGMGLRKHATWYV-k......................................................................................................................................................................
A0A165A2W6_9AGAM/156-508               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-ATTQKADIIRFLL.FL.VP..I.ALLFP...hV.DV......SK.IYHTIR...GQ..ETIKLYVIFNALEI.................ADRLLISFGQDL.LDSLFSRST.................................LVQLPR.H....................-............................................................................................................................................................................................................................................................................................................................................I................................................SLLPLRLG.PVVL.LLLA.....L....I..YT.........ICHS....LV.L.....V....YQLTSLNV.AI..NSY.D..HSLLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFQ.....LA.LMLMIIAFRNLVElagsefdg......................................................................................svlpqsfrwLHG.NSITW..TILSPVMTVL..LSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYN.DVL..............CRDLVTSPAF-TRRG.......................................................SQKNPSVDH.SPLVARRLGFASLPLAVIIV.LVTC......QAVPF.IAppssqnwst........................................................................................................lsasawittAL.KWFV.LC.AAFWFCLVVIKIILGIQLMNYAASR--ap.....................................................................................................................................................................
A0A1E3QWR3_9ASCO/117-453               .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................tknlq------NDCISTGL.IW.AS.lH.ILFCQ....L.DL......SK.IYHGIR...GE..AAIKLYVIFGVLEV.................ADKLCSSLGQDI.LSILFNYDLwd............................medA---FR.D....................K............................................................................................................................................................................................................................................................................................................................................R................................................KFCVQTLK.FMGF.FAGA.....V....V..YV.........VIHS....SI.L.....I....YQTISLNV.AV..NSY.S..NALPTLLLSLQFAEIKS...........TVFKKFERESLF.QVTV..........A....DLVERFH.....LF.IMLTIIVLRNLCQlnissstsl....................................................................................glipsswlsaNSP.YQWLN..VVVSPMLVAM..GSE.VGVDWLKHSY....ITKFN..RIR..P.R.V.YKRFL.YVI..............SLDFITMTFKNNK--.......................................................AAGDDYLVI.Y--LNKRLGLPLVSLLVLFL.RMTM......PLVAS.LG..........................................................................................................................SW.YGYL.VApAVIFALVLFAKLILSICLLRWANSI--nr.....................................................................................................................................................................
A0A151J8R8_9HYME/165-474               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEVCDLLKGIV.VV.GC..W.AATWK....V.DT......SM.MYHLVK...SQ..SVIKLYIFYNMLEV.................GDRLFSAFGQDT.IDALLWTAT.................................EPRSRS.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................STRTKHFG.TLPH.LLFA.....V....T..YV.........LLHS....IL.V.....L....FQATTLNV.AI..NSS.N..KALLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........A....DVRERFH.....LI.MLLLAVSLQTMKE......................................................................................................yAWH.SDRLA..VLLPDCVTLL..LAE.VLVDWVKHAF....ITRFN..ELP..S.T.V.YRDYT.VSL..............AYDMAQTRRE-----.......................................................---TAFSDP.SDLVARRMGFIPLPLGVAMA.RVLC......TTLTP.SA..........................................................................................................................RP.ANII.LL.LLAYLVLVSLRILNSLIILGKACD---ims....................................................................................................................................................................
A0A2D3VE27_9PEZI/407-801               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLQGLL.IV.CS..C.TILMY....F.DA......SR.MYHSIR...GQ..SAIKLYVIYNMLEV.................FDRLFSAIGQDI.LECLFSKET.................................LERNEA.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLR.PLLM.FILA.....L....V..YN.........VIHA....TA.L.....F....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DIVERFQ.....LW.LMLIVIACRNIVEvgggetpavpfsasg.........................................................................asvplvsgftipkafNVL.PTWTG..EVLGPFLIVL..GSE.ALVDWCKHAY....IGKFN..NIK..P.N.I.YSRFL.DVL..............AKDYYSH--------.......................................................----AFADQ.N--LTKRFGLPVIPLSCLFI.RACM......QTYHM.FLaihmplpipssatsisdpasssplttaalqhi..........................................................dqvfrqalgrstfgagsnhvgyryydfddfiaLA.TMVM.FF.LAIYLVCLASKLVLGIGLLNFARRRYK.......................................................................................................................................................................
W7N0I2_GIBM7/476-884                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....V..YC.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNVVEvgglsvpgagsesyde......................................................................tsvphhspsilphsftvLPS.WLMSG..EVLSPFFIVI..GSE.MLVDTIKHAY....VTKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTKRLGLAVIPLSCLFI.RASV......QTYHM.LLsthlpmpmpmpipqstqtslseesatpsspamiaaln...............................................rfdslirdslgratygypygsplnsrpwyswtsddfiaAI.TMVV.VF.FIAFLVLLILKLLLGMILLKYSRNRY-t......................................................................................................................................................................
A0A0J9XER4_GEOCN/239-626               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ipr---SRKTDIIKGFM.FI.VL..V.LLLMQ....L.DT......SK.IYHNIR...GQ..SALKLYFMFNVLEI.................ADKLLSAIGQGI.LESLFSHET.................................LSRHYN.K....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SAFMYYR.PLFY.AFMA.....I....L..YS.........ALHS....VV.I.....L....YQLITLNV.AV..NSY.S..NALLTLLLSNQFSEIKS...........AVFKKFERENLF.QMTC..........A....DITERFQ.....LT.TMLFIIGLRNVVEvsntg............................................................................................ivprswSGW.NRWLG..ALVGPMIVVV..GSE.ICVDWLKHAY....IAKFN..NIR..P.R.V.YKKFL.DVL..............TFDYSRN--------.......................................................----SFSDD.T--LIKRIGIPIFPLASVFF.RMLL......QSYAM.LAeqqaslsdfaspaiaksvfspndltpsgvipaglksf...............................................sfggkeftipqvlrsvfeigklqiisyiglfqtdviyqYL.QMAF.VF.LLVYTMLFFVKLVLGLMLLKYSSNRR-r......................................................................................................................................................................
A0A072UZZ6_MEDTR/287-446               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMELSDLGCFII.MS.FG..V.ILLQR....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTSFHSAE.................................GLASCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMRFWLWR.FVCD.QALA.....V....V..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSKDNVQ.SLVY..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------feser..................................................................................................................................................................
A0A0B7ND75_9FUNG/243-659               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKSSQKCDLLKGFL.II.IT..C.IMMCS....L.DP......SR.IYHSIR...GQ..AVLKLYVVFNVLEI.................CDKLCCSVGVDI.LDALFSKST.................................LGNAEQ.Gigga............ayakR............................................................................................................................................................................................................................................................................................................................................Qlkpmtl....................................fvlaagYMGKLVCS.SECR.FIL-.....T....I..KA.........VVHT....TV.L.....F....FQMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKKFEKENLF.QLTC..........A....DIVERFQ.....QC.AFLFIITLRNVIElsesgpssi....................................................................................lpstfvplfkLPA.TTSLN..TLMTPVVMVI..ASE.LMVDWLKHAF....ITKFN..QIR..P.T.I.YGKYI.DVL..............CKDLVIGSPG--RIS.......................................................GRHHAFVDQ.SPVVSRRIGFPVLPLACLHV.RMMQ......QILPM.MFmshnnqtantsaaasmitnsllnylinnqgm............................................................vnqvlpariqlvvlsmvkggwlengldqlfrFI.TWTL.VV.TVLAVILLALKVVVGINLLGFAYKRY-t......................................................................................................................................................................
A0A1S3BIB0_CUCME/316-624               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--SAELSDFGCFLI.MA.CG..V.ALLEW....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLFQSFGGDV.LQTLFNSAE.................................GLANCP.P....................E............................................................................................................................................................................................................................................................................................................................................N................................................-VGFWIGR.FISD.QVLA.....V....A..AS.........IIHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSKGNIH.NLVY..........F....DSIERFH.....IL.AFLLFVLAQNILE.......................................................................................................-AE.GPWFG..SFLYNALMVF..ICE.MLIDIIKHSF....LAKFN..DIK..P.I.A.YSEFL.EDL..............CKQALNMQD------.......................................................---------.-EDAKKNLTFIPVAPACVVI.RVLT......PVYAA.LLpfnp..................................................................................................................lpwrFV.SVPL.LL.GVTYVMLVSLKILVGISLQKYATWY--id.....................................................................................................................................................................
C1G8N7_PARBD/671-1095                  ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDHKADILKGLL.MI.FT..C.LVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFWL.FIIA.....L....I..YT.........VIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgifssgsglslfassspstspnnts..................................................fvtpprtassilpqaftilpssilsslSKV.NSLLP..HVLGPFLVVL..GSE.MIVDWLKHAY....INKFN..NTR..P.S.M.YGRFI.DVL..............AKDYYTN--------.......................................................----AFADQ.N--LNRRLGLPVIPLACLFF.RVSV......QTYQM.FLtswlpqtqpflppsnttsltsihdhyspspspspsl..................................................lfpfqpletafsltkisplfqtlishatpspatfipI-.FTAI.LI.LLLYLTLLFSKLVLGIILLSYARSRYK.......................................................................................................................................................................
A0A3S4C7R7_9PEZI/463-886               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGAM.II.CS..S.IALMN....L.DA......SR.MYHFIR...AQ..SAIKLYAIYNLLEV.................GDRLLSALGQDV.FECLFSTET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVML.PLGM.FLLA.....L....V..YN.........VLHS....VI.L.....F....YQVIALNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKENTF.QLTC..........A....DVVERFQ.....LW.IMLIIIGMRNVVEvgglsvpgagsedsgp......................................................................ssiplhtssilpasftiLPS.WLWSG..EVLSPFIVVI..GSE.MVVDWIKHAY....VNKFN..NIK..P.S.F.YGRVL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLPLLPLSCLFI.RASV......QIYNM.FLathlptplppstqtslsvesatpspamlaaldrldnlirtalgrs................................vfgypfadqlssssswsdngtaetaggashwpwrwwrftsddaiaAL.TMVV.VF.LLLFLVLLVVKLVLGMALLRYARDRY-a......................................................................................................................................................................
D0NR04_PHYIT/205-502                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RTHFYDLMVAVI.IA.VG..T.TVLGY....V.DM......SR.VYHAIR...GQ..AMIKLYVLFTMIEI.................FDRLFSSLGQDV.LDSLYYTAK.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YHPRRVTR.MFLD.FAVA.....I....T..YV.........VLHA....LL.L.....F....AQVVTLNV.AV..NSS.N..TSLLTLLISNNFAELKS...........SVFKKFEEQNLF.QISC..........S....DIVERFK.....LL.TIIGLILLQSSTG.......................................................................................................---.-----..DVAWGTAMVW..VAE.MVIDWLKHAF....ITKFN..QLP..P.T.M.YSKFI.TIL..............CRDLTGWKSE-----.......................................................---DTILDH.THHVSKRLGLMSLPLACVVL.RMVS......KALVE.APie......................................................................................................................laSP.GGIL.VT.VAFFLCLAAFKALLSLVLMIYACKS--gr.....................................................................................................................................................................
G0S8P9_CHATD/424-840                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TTFHKADLLQGAI.IL.CS..S.IALMN....L.DA......SR.MYHFIR...AQ..SAIKLYAIYNLLEV.................SDRLLSALGQDV.LECLLSTET.................................LSRNPH.S....................-............................................................................................................................................................................................................................................................................................................................................-................................................-GRSRVML.PLGM.FILA.....L....V..YN.........ILHS....VI.L.....F....YQVIALNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKENTF.QLAC..........A....DIVERFQ.....LW.VMLTIIGMRNVVEvgglsvpgagsedgps.......................................................................sfplhtssilpasftiLPS.WIWSG..EVLSPFFVVI..GSE.MVVDWIKHAY....VNKFN..NIK..P.S.F.YGRIL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLPLLPLSCLFI.RASI......QTYNM.FLathlptplppstqtslsvesatpspamiaaldrldniirna.......................................lgravygappyldpsspesfasetsllsriftlrltsddaiaAL.TFLT.VF.LLLFLILLLCKLLLGMLLLRYSRNI--ya.....................................................................................................................................................................
A0A0A2IF76_PENEN/494-920               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILTGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIIR.PFWL.FLVA.....L....V..YT.........VSHA....LS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFRKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgnlglgssfpgqsstitnstpl.............................................stpprtassilpqaftlfpssilssfnsvNSF.IPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NNR..P.A.I.YGRFL.DVL..............AKDYYTN--------.......................................................----AFGEQ.N--LTRRIGLPVIPLSCLFF.RVSV......QTYQM.FLaalipqhpsstamgatsltsihnsyapspvpsap......................................................pltfatllpasaahvsalfrtllenaipspaqsvHI.FTGI.LL.LTGFIVLLILKLLLGMALLAFARSRYR.......................................................................................................................................................................
A0A2H2IEK8_CAEJA/222-574               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wt--STETCDFLKVVI.IL.CG..S.MLIRE....I.DS......SF.LYHQVR...SQ..GVIKLYIFYNMLEV.................ADRLFSSLGQVN.PDFVIFLFNwdvskrpra..............rqsmsftcflQ-----.-....................-............................................................................................................................................................................................................................................................................................................................................Qdifdall.................................wttnsekrFSLGYLLR.TAGH.LIVA.....I....L..YA.........TLHS....FL.V.....I....LQATTLNV.AF..NSH.N..QTVLAIMMSNNFVELKG...........SVFKKFAKANLF.QMAC..........-....----RFQf...sLA.ISRRIWWFRCKAYgpnapgmad....................................................................................ylpysmanshKLM.TQKLS..NKPPFQIMVV..GCE.YFVDWLKHAF....ITKFN..EIN..A.E.V.YKDFT.ITI..............AFDVIRSRDQ-----.......................................................---SAFSDY.SDQVSRRMGFIPIPLSIMII.RVLS......QTFSL.DN..........................................................................................................................-W.GSIV.VF.AIGWLLVFAVKICNGVIMLGKACQH--vk.....................................................................................................................................................................
A0A1V8TQ48_9PEZI/436-839               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLQGAL.II.IS..C.LILLR....F.DA......SR.MYHSIR...GQ..AAIKLYVIYNVLEV.................FDRLFSALGQDI.LECLFSKET.................................LERSSD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIIR.PFWM.FMLA.....L....V..YN.........VVHA....TA.L.....L....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLLVIALRNIVEvggitasfnaltstsan....................................................................sadstafpskasiiprafTLT.PRWTG..EVLGPFLIVL..GSE.MLVDWLKHAY....ITKFN..NVK..P.A.I.YGRFL.DVL..............AKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVIPLSCLFI.RASM......QTYSM.FIathiplimpstatsvsledattatssatmaaieh......................................................idhifrraigrssfgtgsetstaalpwslddaiaLA.TMAI.FF.LVLYLILLAFKLVLGMALLSFSRRRY-v......................................................................................................................................................................
S9W727_SCHCR/236-603                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fpk---SRKIDLIKVSL.LL.ST..S.ILIRR....L.DV......SR.LYHVIR...AQ..ASIRFYVLYNVLEI.................ADRLCGALGQDV.LDCLFADYN.................................LSFHFL.E....................-............................................................................................................................................................................................................................................................................................................................................-................................................--LSGWLR.FFYY.YFIS.....L....A..YM.........VLHT....LV.L.....L....YQIVTLNV.TV..NSY.S..NAVLALLMSNQMVEIKG...........SVFKKFEKENLF.QLTC..........S....DIVERFQ.....IT.VMATVIFLRNLTEmytts.............................................................................................sldapLIT.FDRLK..TLMAPFVWVI..GSE.LFVDWLKHAF....IIKFN..YFK..P.S.I.YGRFT.DVL..............CHDYVASGGR-----.......................................................-PAQTVTGK.SQHVARRMGLPVLPLVCVFI.RTSM......QTWNM.FRsthsmkqeiaksigmllptkdnyi.........................................................................yylpkgqtqvyniekepswesiflsWL.QGKA.GI.AVLFFILLMLKLILGMALLSFAQSRY-r......................................................................................................................................................................
W0T7P6_KLUMD/120-432                   ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lhkv-----RQELLALAM.VA.FP..C.VILNY....L.DT......SR.IYHRIK...GQ..NAIKLYMIFQVLEM.................AEKLLSSIGIDL.FSILMLRDS.................................VQRSK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................------KE.MVIL.YTTC.....C....L..CL.........TLHA....LI.Y.....I....YEMLALNV.AV..NSY.S..NSLWTLLLSMQFSELKS...........AVFKRIDKEGLF.QMTI..........A....DVVERFQ.....LI.IFLMVIAVRNFVVagknwsdv.......................................................................................lphswtvnSTQ.SLLLG..VFIGPIITVI..GSE.LVVDWIKHAY....IIKFN..RIR..A.H.V.YERYL.QII..............SKDMKYN--------.......................................................----GGIR-.---FQRRLGLPFPPLVASFI.VLVW......PAVKQ.TLrn.....................................................................................................................nnkWW.LTAL.MT.IIGFIWLLFIKLTLQIILVKWSRHM--qk.....................................................................................................................................................................
A0A1B9I6M1_9TREE/314-673               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pla----HQHSILRALL.LL.IP..T.IILLG...aT.DS......SK.MYHSVR...GQ..DTIKLYVIFNALEI.................ADRLCCAFGQDV.LDTLFARETls.............................psI--RKS.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................GRKRQQAR.PVFF.FALS.....L....G..YV.........LAHT....LI.F.....F....YMLVSLNV.AI..NSY.D..YTLLSLLISNQFVEIKG...........SVFKKFEKENLF.QIMC..........A....DIVERFQ.....LS.LMLSVIALRNMIEmsgsei..........................................................................................aflpksfIRG.KNLVD..SILSPVLFVI..VSE.MVVDWLKHAF....ITKFN..HVR..A.S.V.YERFT.DVL..............AKDVLLAGTSANGRNrr...................................................rgRNHQVLLDQ.SPLVARRLGFASIPLACLVL.RVSA......QAIGM.LStsshseeslag...................................................................................................ltlgdwawtilkWM.SWTG.VG.LCAWGCLVFLKVILGLALLSFSATRQ-e......................................................................................................................................................................
A0A1I8EFG0_WUCBA/206-369               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....-QATTLNV.AF..NSH.T..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMSC..........S....DVRERFH.....IF.TLLAVVVVRNMMA......................................................................................................vNWK.FEHFM..EMLPDLALVT..IAE.IIVDWLKHAF....ITKFN..EIP..A.E.V.YQDFT.ITI..............AFDVIRSRDEK----.......................................................----AFSDY.SDQVSRRM------------.----......-----.--..........................................................................................................................--.----.--.---------------------------vngivvlgkacghvkryrel...................................................................................................................................................
A0A1Y2ATI3_9TREE/422-773               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pt--RSQIHALIRLAL.LV.IP..T.GILLA....VtDA......SK.MYHSVR...GQ..DTIKLYVIFNALEI.................ADRLCCAFGQDV.LDTLFARNT.................................LAPRGK.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RKRHQAR.PVFF.FMLA.....L....C..YV.........LTHT....VI.F.....F....YMLVSLNV.AI..NSY.D..YTLLSLLISNQFVEIKG...........SVFKKFEKENLF.QIMC..........A....DIVERFQ.....LG.LMLTVIALRNMIEmsgsei..........................................................................................ailpksfMRG.KSLVD..SILSPVLFVI..VSE.MVVDWLKHAF....ITKFN..HVR..A.S.V.YGRFT.DVL..............AKDVLLAGQAR-PKG.......................................................RKHPILLDQ.SPLVARRLGFASIPLACLVI.RVGA......QAVGM.LTtashstdeipg...................................................................................................vskaawawwavkWT.AGIG.VG.LSAWGCLVALKVLLGLSLLSYSALR--qe.....................................................................................................................................................................
A0A3Q3GG50_9LABR/153-457               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDMLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FIMA.....V....F..YV.........FLHS....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMLSNNFVEIKG...........SVFKKFGKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fLWK.PDHMW..VMFPDVFMVI..SSE.ILVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAALLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGLVSLKVLNSIVLLGKSC----iyvk...................................................................................................................................................................
A0A091HJB8_CALAN/90-406                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.VTPLI.CWI..............FFQVYSEYRASLAFDlv...................................................ssRQKNAYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
B8N2A9_ASPFN/565-988                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.AVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VVHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALLSLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfignlgssftsqststnstpls................................................tpprtmssilpqsftivpssiiasfshvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.V.I.YKRFL.DIL..............TKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallpqhpsstavestslssiyshyvpapipspp......................................................pltlrtivpasaahmnaffqqllantmpspaqsvYI.FTVV.LI.LTGYVVLLIVKLLLGMVLLAYARSRYR.......................................................................................................................................................................
A0A0P7BPK6_9HYPO/980-1387              .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGSV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLM.PLGM.FLLA.....L....A..YC.........CLHS....IS.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLLIIGMRNVVEvgglsvpgagsepgfdet...................................................................sgalplhnpsilphsftvLPS.WLMSG..EVLSPFLIVI..GSE.MLVDAIKHAY....VTKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsthlpmplpettqtslseesavpsspaviaalnrf...................................................dsrirdslgratygypygsplnsrpwyswtsddviaAV.TMIV.VF.FIAFLVLLIIKLLLGMVLLKYARNR--fa.....................................................................................................................................................................
TAPT1_HUMAN/155-459                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A072UZ37_MEDTR/141-491               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STIELSDFGCFII.VA.CG..I.TVLQQ....I.DI......SL.IYHIIR...GQ..ATIKLYVIYNVLEI.................FDKLCQSFNGDV.LQMLFHSAE.................................GLARC-.-....................-............................................................................................................................................................................................................................................................................................................................................P................................................PETQSMRF.WIWR.FISD.....-....-..--.........----....--.Q.....V....LAAITLSA.CI..VAH.Y..NALPALLVSNNFSEIKS...........YVFKGFKKDNVH.SMMY..........F....DSIERFH.....IS.TFILFVLAQNILE.......................................................................................................-AE.GPWFQ..GFLINALSVY..LCE.VAIDIIKHSF....IAKFN..DIT..P.T.A.YSEFL.EAL..............CKQTLHMQSEDAKKNlk...................................................fvPLAPACVAK.SSLKIKRLPFMAVACIVMLF.VLYR......TLKYQ.YK..........................................................................................................................--.----.--.---------------------------qeeirysthfeelkglprgiihttsdfelrplwlrsrskvsvytkrnllavavgikqkynvdamvqkfltgnftiil..........................................................................................
I4YAU8_WALMC/1-329                     ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ml------------LF.LL.TS..A.FLLIY....T.EP......SR.MYHGVR...GQ..DNVKLYVIFNALEI.................ADKLCCSIGQDI.LDSLFSRTR.................................L-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--TQKPST.TPIY.LALA.....V....I..YA.........VAHS....LV.F.....L....YQLVALNV.AV..NSY.D..NALLTLLLSNQFVEIKG...........SVFKRFDKSSLF.QITC..........A....DIVERFQ.....LM.LMLTIIACRNLIElsgsnf..........................................................................................aflprafIRS.NTQLE..TIFSPVVIVI..LSE.MAVDWLKHAF....ITKFM..HIR..P.S.I.YGRFV.DIL..............AGDLVSTTKK-----.......................................................--IGAPVDL.APKASRRLGFAAIPLGAFVV.RVAV......QALGM.LSdsssidecatlp..................................................................................................psalqrgavvmqWF.VWLL.VC.VVGWLVLLAIKLLLGIRLSAFAHHRQ-a......................................................................................................................................................................
A0A0L8I5D7_OCTBM/156-459               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LEPSQTCDILKGII.IV.LS..C.FILNY....L.DI......SM.MYHIIR...GQ..AVLKLYVFYNIVEL.................ADKLFIGIGQDF.LDSLFWSAT.................................---EPR.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RKREHIG.VLGH.LILA.....I....F..YV.........ILHS....IL.I.....L....VQATILNV.AF..NSH.N..KSLLIIMMSNNFVEIKI...........NVFKRVDKKNLF.QISC..........S....DARERFQ.....YI.ILLFIVFVRNMAE......................................................................................................fSWN.PEHIS..VILPDAVMIL..LAE.VVVDWLKHAF....ISKFN..EIS..K.E.V.YADFS.LIL..............AQDMVSSRQTQ----.......................................................----AFTDH.SDLLSRRMGFTPLPLACILY.QVCV......RSFKV.HG..........................................................................................................................-Y.LGFA.VL.VMVYLCLTSTKVLNTMLLLGRANK---li.....................................................................................................................................................................
M7Z694_TRIUA/197-248                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLE-.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------sl.....................................................................................................................................................................
A0A2T4BRJ3_TRILO/489-893               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STFHKADLLQGAV.II.CS..S.LVLMK....L.DA......SR.MYHLIR...AQ..SAIKLYVVYNILEV.................GDKLLSALGQDI.LECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FVLA.....L....I..YC.........VLHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDSLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNIVEvgglsvpgagmnddpt......................................................................kaapmhspsilphsftvLPS.WVMSG..EVLSPFLIVV..GSE.MLVDTIKHAY....VTKFN..NMK..P.K.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFTTP.A--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsahvampfpistqtslteasatpsspamiaalnrf...................................................dslirdslgratygypydhplnsrpwykwtsddviaAV.TMVV.VF.FIIFLVLLIIKLLLGMVLLKYARNRY-a......................................................................................................................................................................
A0A3Q2WNA6_HAPBU/146-450               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.ADHLW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
A0A150G4V9_GONPE/291-520               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lsg---SQLYDMVCLGL.LC.CA..T.AVLRA....V.RP......GS.IYYWLKd.iTS..EFLKMSVLSTAFDM.................LDKILSNFGNDV.LEALSGTCT.................................Q--WLA.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-GRKRGLQ.LAAD.AGVA.....G....A..LI.........TLHA....LT.L.....M....CQALILAV.AL..NSS.R..NGLVALLIANNFVEIKS...........TVFKKWDSTRIW.ALVC..........A....DAVERFH.....LV.VVLSFVVVEEMDS.......................................................................................................AAS.WAPPP..DYLRVCGLMA..AAE.LVIDVVKHAV....LGKFN..DVR..P.G.I.YREFH.QVG..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------twdgv..................................................................................................................................................................
A0A1Y1W3U7_9FUNG/548-652               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPIQLFDFYRGLL.LI.VT..C.AMLCR....I.DA......AQ.MYHSIR...AQ..SSLKLYFIFSALDI.................FDRLLSSYGHDV.LDALQSTVT.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................D................................................PRSQRWRS.GLGY.YALA.....Q....G..YM.........FVHT....LV.L.....F....YQFV----.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------.......................................................................................................................................................................
I1JXD0_SOYBN/282-590                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMEVSDFGCFLI.LS.SG..V.VLLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTLFLSAE.................................GLANCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................SMRFWIWR.FISD.QALA.....V....A..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRYSKDNVH.SLVY..........F....DSVERFH.....IS.SFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLINILLVY..VCE.MIIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNMQTE-----.......................................................---------.--SAKKNLTFVPLAPACVVI.RVLT......PVYTA.NLppnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKVLIGMGLQKHATWY--vn.....................................................................................................................................................................
A0A199W1Y5_ANACO/325-504               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fv--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..-A.........LVHA....FV.L.....L....VQAITLAT.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIVERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GTWFE..SFLINALLVY..LCE.VLIDAIKHSF....LAKFN..EIK..P.I.A.YSEFL.EDL..............CKQYLNEKPEERRQDlt..................................................fipL--------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------apacvvsfssansgvrdpsslrsvpleni..........................................................................................................................................
A0A3B4WSV4_SERLL/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.ADHLW..VLFPDVFMVV..TSE.VAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
I0YRI2_COCSC/96-413                    ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lhg---DQLFDMLCVFI.FG.AT..I.AFLRF....L.PA......GT.IYFWLKd.lTQ..EFLKLHVVHGAVEI.................FDKISCAFVVDA.LDALSGTCG.................................LYLSTS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RRWHLAQ.LGAD.LAVT.....L....A..LV.........LFHS....VV.L.....I....CQFMTFSV.AM..NSKrS..NALIALLIASNFVEIKG...........TVFKRFDPTKLF.VLVG..........Q....DVTERFH.....LL.LSLLFVVVEEMDN.......................................................................................................SGS.PRPSP..ELLRCCGYIF..GAE.ILIDITKHAV....LSKLN..DIR..P.A.V.YQRFM.RDV..............CEKAKG---------.......................................................-------GQ.SHTAHRVVAFEPYAPAALFL.RIAV......TALIV.SRseqplmq...........................................................................................................agwrgpwqVV.SLGA.YC.IAAWVAVFVAKAALGFSLRGIAL----hflr...................................................................................................................................................................
A0A0D2BBG0_9EURO/470-887               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILRGLL.IL.ST..C.LILLR....L.DA......SR.MYHWVR...GQ..AAIKLYVIYNILEV.................CDRLFSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKVLR.PFWL.FVLA.....L....I..YT.........VIHS....IA.L.....F....YQVITLNV.AV..NSY.S..NALITLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLVIIAARNIVEtgglssglsvfmsassptasapsssnssv.............................................plttalpprsassilpssftllpavvdsiTSY.APAVS..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYQM.FMaawvpssapssstslasihedysaarsal...............................................................plttsaaisrtvddiirsiptfitkssivtHM.TTVL.MA.LLLFLILLACKLVLGMLLLAFARSRY-h......................................................................................................................................................................
A0A3F3QBD6_9EURO/937-1361              .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.II.AT..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLLC..........A....DVVERFQ.....LW.LMLTIIASRNLVEtgafnalgslsfslggytstgtnstpls...............................................tpprtsssilpqaftivpssiiasfsqvNTY.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FItallpqqpsstaveattlsaihsqyvpapmpspp......................................................pltlrnfiptstayagaffrqllantmpspaqsvYI.FTIV.LI.LTGFVVLLILKLLLGMVLLAYARSRYK.......................................................................................................................................................................
A0A1W2TX90_ROSNE/523-925               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSYHKADLLQGAL.LI.CS..F.VALSG....L.DA......SR.MYHFIR...AQ..SSMKLYVIYNILEV.................GDRLLSAIGQDI.LECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PFGM.FILS.....L....I..YN.........VIHT....WC.L.....F....YQVITLNV.AV..NSY.S..NSLLPLLISNQFVEIKG...........SVFKKVEKENLF.QLTC..........S....DVVERFQ.....TC.IILLIIGMRNVVEvgglsvvgtgseldggs....................................................................lktgplhttsilpasfkvLPT.WLQSG..EVLSPFIVVI..GVE.MLVDWIKHAY....INKFN..NVK..P.T.I.YRRML.DIL..............CKDYYTN--------.......................................................----AFSAP.S--LTRRLGLPLLPLSCLFI.RASF......QVYHM.FLathipspipttttdlsaesstpssaamiaafeq.......................................................ldtlirhalgravyphessqdqpwwsfssddmiaLL.AMVV.FF.FLTWIVLLIVKLLLGMLLLRYSHRRY-a......................................................................................................................................................................
A0A3B4WI13_SERLL/163-467               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.ADHLW..VLFPDVFMVV..TSE.VAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A367XXM9_9ASCO/58-191                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................rli-----KKDVITLSV.VL.LS..I.IVLSNr..kL.DI......SR.MYHDVR...GQ..ADIKLYVMFGVLEC.................AEKLCSSLGQDI.LNILYQTSP.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SRKTAR.FVVF.YFLS.....I....F..YL.........SFHA....YI.L.....I....YQTVSLNV.AA..NSY.S..NALLTLLLSNQFAELKG...........SVSK--------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------i......................................................................................................................................................................
A0A2K6PJG8_RHIRO/154-458               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A1X7RSD3_ZYMTR/407-814               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLQGLL.II.CS..C.VILMW....F.DA......SR.MYHSIR...GQ..AAIKLYVIYNVIEV.................FDRLLSAIGQDI.LECLFSKET.................................LERDTD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PLGM.FLVA.....L....I..YN.........VVHA....TA.F.....F....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DVVERFQ.....LW.LMLLIIALRNIVEvgglsisitsalggggspmd..............................................................afssngtgiplvsgfvipkafTIF.PKWTG..EVLGPFLIVL..GSE.ALVDWCKHAY....INKFN..NIK..P.N.I.YGRFL.DVL..............AKDYYSH--------.......................................................----AFSDQ.N--LTKRLGLPVLPLSCLFI.RACM......QTYHM.FLathmpvpipsagtsiaeppastpvttaalqhid........................................................qvfrralgrssfgagnsggpssiaswniddfiaLA.TMVI.VF.LAVYLIMLALKLVLGMALLSYARGRY-n......................................................................................................................................................................
A0A1L8HTF0_XENLA/134-438               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGVI.LV.IC..Y.FIMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHLG.VIPH.FFMA.....V....L..YV.........ILHA....IL.I.....L....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFELVSSRQKN----.......................................................----ACTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSVKL.QG..........................................................................................................................-I.LDYT.CV.ILFYFGLITLKVLNSIVLLGKSSQ---yik....................................................................................................................................................................
A0A2I4G1Y6_JUGRE/387-695               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELSDFGCLLI.MA.CG..V.TLLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLSQNFNGDV.LQTLFNSAD................................gL-ASCP.P....................-............................................................................................................................................................................................................................................................................................................................................G................................................NMRFWLWR.FLFD.LALA.....T....A..AS.........IVHS....FI.L.....L....AQAITLST.VI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRLSKDNIH.SLVY..........F....DSVERFH.....IS.AFMLFVLAQNILE.......................................................................................................-AE.GPWFE..SFVFNALMVF..ICE.MAIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLDI--------.......................................................--------Q.NEGAKKNLTFVPLAPACVVI.RVLT......PVYAA.YLpysp..................................................................................................................lqwrLF.CILL.LS.MMTYIMLTSLKVMIGMGLKKYATWY--vn.....................................................................................................................................................................
A0A1D6GJ48_MAIZE/282-599               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSACS.T....................D............................................................................................................................................................................................................................................................................................................................................N................................................-VTFELMR.FILD.EAIAvvafdI....L..FC.........RLHQ....LI.F.....LlvtvAQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IM.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASLVF..LCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKPD-----.......................................................---------.--DRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrIF.WILL.WS.VLTYFMLAIFKIIVGLILRCLANW---yvn....................................................................................................................................................................
A0A1M8AC97_MALS4/272-631               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ln--VSNKCDILQGLL.VI.QT..C.YLLSR....IaDA......SK.MYHSVR...GQ..DVVKLSVIFSVLEI.................SDRLCASFGQDV.LDSLFSRRT.................................LARRSN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SQPYVR.MLGY.YVLS.....L....A..YI.........VFHT....FV.L.....L....YELVTLNV.AI..NSY.D..NALLTLLLSNQFVEIKT...........TVFKRFEKENLF.QLTC..........A....DIVERFQ.....LS.VLLAAIGVRNLIEvagassmsgsg.................................................................................tlgplptsfdlYPY.VNVVF..RTINPVLTVL..LSE.VLVDWLKHAF....ITKQN..HIR..P.A.V.YGRYM.DVL..............CRDLLPPQAATAMDGh.....................................................eQRQSSLVDQ.TPLATRRLGLAVLPLVCVTV.RLAF......QIVDM.LLpsrdeldlvt......................................................................................................sqrvldqvvfAA.TACL.VV.IASWIALVVLKILLGVHLVNFATKRY-a......................................................................................................................................................................
A0A087R1R7_APTFO/89-393                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A498HFX0_MALDO/342-541               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................e--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--AITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........SVFKRFSKDNIH.SLVY..........F....DSVERFH.....IS.AFLLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLSNALLVY..VCE.MIIDIIKHSF....IAKFN..NIK..P.I.A.YSEFL.EDL..............CKQTLNI--------.......................................................--------Q.SEASKKNLTFIPLAPACVVI.RVLT......PVYAA.HLpysp..................................................................................................................lpwkQF.WTLV.LF.AMTYVMLTSLKVLIGMGLQKHAGW---yvn....................................................................................................................................................................
V7AZE8_PHAVU/273-581                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMEISDFGCFLI.MT.CG..V.VLLQR....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTLFLSAE.................................GLANCP.H....................-............................................................................................................................................................................................................................................................................................................................................E................................................SIRFWIWR.FVSD.QALA.....V....V..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSMDNVH.SLVY..........F....DSVERFH.....IS.SFILFVLAQNILE.......................................................................................................-AE.GPWFQ..SFLINILLVY..VCE.MVIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNMQT------.......................................................---------.-EGAKKNLTFVPLAPACVVI.RVLT......PVYSA.NLpnnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKVLIGMGLQKHATWY--vd.....................................................................................................................................................................
A0A109FBV4_9BASI/92-455                ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lr--LSHKCDLTKAAI.LI.GT..L.SILHH....ItDA......SK.MYHGVR...GQ..DTVKLYVLFNVLEI.................ADRLCCSFGQDL.QDSLFSRHT.................................FARRND.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SHPHVR.PLVL.FGLN.....L....A..YV.........VAHS....LV.L.....F....YQLVTLNV.AI..NSY.S..NAILTLLMSNQFVEIKG...........SVFKKFEKENLF.QLTY..........-....-IVERFQ.....LG.IMLFVIALRNLIFeissaatstg...................................................................................paltvttaaqWLQ.AIPLR..AIFSPAVIVL..MSE.CLVDWLKHAF....ITKFN..HLR..P.G.V.YGRFI.DVL..............CKDLVVGGSSA----.......................................................TSDTAYVDQ.SPYVARRLGFAALPLGCLVV.RIIS......QACEM.LVdesvdnettagfgkgss........................................................................................sphlgslsqvwlgqlgeWL.AMGS.IA.FFAWTCLVAIKLLIGVNLRAFASER--wa.....................................................................................................................................................................
A0A0L0S3Z8_ALLM3/1-338                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m-------DVYRFVI.LV.SA..V.TILLR....I.DP......SH.TYHFIR...GQ..SMIKLYVIFNLLEV.................CDRLCCSFGMDI.LDSLFARVS.................................PAPMGS.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................MAKPNRLP.LILH.VVVA.....V....G..YV.........VLHA....--.-.....-....--VITLNV.TI..NSH.N..NALVSLIISNQFIEVKS...........TVFKRFEVEPLF.QITC..........S....DMVERMN.....LG.VLLTLNVVRNYLElanntdvtgswvvtvpvlwwtgggawlwqsaanlttaasdwldatdfarlarhvldyltastwgeitlpftdqlwpatqvvsdwvgtapttvewhwqtwswmaPAW.VGLVW..TVIQPALLMA..SSE.VAVDWIKHAF....ISKFN..NHK.vA.E.V.YHRYR.YVL..............CLELSDS--------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------iavaptpaqaesv..........................................................................................................................................................
A0A091UZE1_NIPNI/89-393                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
B8AQN7_ORYSI/276-576                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................NATFELMR.FILD.EAI-.....-....-..--.........---A....VL.A.....F....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IT.SFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASLVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKTD-----.......................................................---------.--DRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrVF.WILL.WS.VLTYFMLAVFKILVGLVLRCLATWY--vn.....................................................................................................................................................................
A0A1S8W4W3_9FUNG/315-747               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKPAQKTDLIKGAL.VS.IC..T.YILQY....F.DA......SR.LYHSVR...GQ..ALIKLYVIFNVLEI.................CDKLCSAFGHDI.LDSLFSLSH.................................SRQRSR.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-AATRRIN.RFTH.FIIA.....V....M..YI.........FAHS....LI.L.....F....YQVMTLNV.AV..NSF.D..NALMTLLLSNQFVEIKG...........SVFKRFERENLF.QLSC..........S....DIVERFQ.....LS.IFLIIIGIRNFIElvggaailsypayiykiydslspyswcmdivsf.....................................frsekflvepekiggvlwllgvnmiqliettmkSKE.FKLAE..KVLAPIIIVY..ITE.ILVDWLKHAF....ITKFN..GIS..P.S.V.YERYR.DSL..............CRDLLGETKKAPAVTd....................................................deTMKMASVDR.SPIVARRIGFVSIPLSCLVI.RVTI......QTLQM.ITihrtpqdkfkpdvfadrsgddgiv.........................................................................gwqipftfptwlnsdgltvlfgsssII.NSLL.WI.IPIYLLLIVFKLILGLQLLHMAKT---sle....................................................................................................................................................................
A0A2K3N530_TRIPR/159-233               .................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................qqkdlqdvplkrk--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----HTLSVY..LCE.VAIDVIKHSF....IAKFN..NIT..P.I.A.YSEFL.EAL..............CKQTLHTQTEDSKKN.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------fkfvplapa..............................................................................................................................................................
A0A0W0GBZ2_9AGAR/173-532               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRTLL.LT.VS..I.AILTP....LtDA......SK.IYHFIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEPLSH.R....................-............................................................................................................................................................................................................................................................................................................................................V................................................PVTTSTFR.PIIF.FLLA.....T....I..YN.........VAHS....IV.M.....V....YQLISLNV.AV..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFS.....LA.LMLSVVAFRNLIElsgsefdfae..................................................................................ggfvlpksfgwFRG.NNVLW..TISYPVLTVM..VSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFASLPLAVLAI.LIGS......QSISL.LFslppdsttrs.....................................................................................................mldftdkeitrFL.TWVA.MG.ILFWLCFVVIKIIIGVNLVSYATRRR-a......................................................................................................................................................................
A0A2V3J241_9FLOR/176-487               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................twa------VDTLHLTL.LI.IT..S.LSLRF....F.DI......SW.IYHNIR...GQ..SVIKLYVVFNVIEI.................FDRLCSSFGVDI.LDSLGWTTAsavqf......................ytrqhtD-----.-....................-............................................................................................................................................................................................................................................................................................................................................Tnssai......................................raralQGLVLVSR.VAFD.YTFA.....L....I..YI.........MIHA....TL.L.....L....TWVVTLNV.AI..NTQ.N..NALLTLLVSNNFVELKG...........AVFKSFKVQNLF.QIAC..........S....DAVERFQ.....LC.VFLVVMLIVTNAD.......................................................................................................---.----E..KLFTTFFVIV..VCE.VIVDWVKHAF....VTKFN..RIS..P.N.V.YRQFV.LVI..............CDDIARSKSQS----.......................................................-VVRSIGGS.--GISKRIGFVCLPLAALFT.RMSI......GPFLG.LP..........................................................................................................................--.--KV.GM.LALWSSLVAIKTAVSISLIGHSWRRT-r......................................................................................................................................................................
A0A154PK23_DUFNO/420-722               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-RPAEICDLLKGFL.VI.CC..W.IATWK....V.DT......SM.MYHLVK...SQ..SVIKLYIFYNMLEV.................GDRLFSAFGQDT.IDALLWTAT.................................EPRSKT.Q....................-............................................................................................................................................................................................................................................................................................................................................-................................................-ARSQHLG.TLPH.LLFA.....V....T..YV.........LLHS....IL.V.....L....FQATTLNV.AI..NSS.N..KALLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........A....DIRERFH.....MM.MLLFAVTLQTMKE......................................................................................................yAWK.PERLI..VLLPDCIMLL..LAE.VLVDWVKHAF....ITRFN..ELP..S.T.V.YRDYT.ISL..............AYDMTQPRQE-----.......................................................---TAFSDQ.SDLVARRMGFIPLPLGVAIG.RITP......SPKA-.--..........................................................................................................................--.ANII.LL.LLAYLILIAVRILISLIILGKACD---ii.....................................................................................................................................................................
A0A072PKF7_9EURO/480-899               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADMLKGLL.II.CT..C.LILLR....L.DA......SR.MYHWIR...GQ..AAIKLYVIYNLLEV.................CDRLFSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKVLR.PLWL.FILA.....L....T..YT.........VIHS....TA.L.....F....FQVITLNV.AV..NSY.S..NALITLLMSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLVIIASRNIVEtgallprlgsaaftpsfsgspsattgvngs...........................................asiaqatppnsassilprsftlvpaivesiTSY.VPAVS..QVLGPFLIVL..GSE.MLVDWIKHAY....INKFN..NTR..P.E.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLLI.RASV......QTYQM.FMaawvpstpptsstslasihaqystsrsni...............................................................ptttgaaisktvddiiraipavitgsrlvtHM.TTVL.TF.LLIFLVLLACKLVLGMLLLAFARSRYR.......................................................................................................................................................................
B7PHF4_IXOSC/54-356                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAEICDLLKGII.LV.AV..C.FLVSY....V.DT......SM.LYHIVK...SQ..SVIKLYIFFNMLEV.................ADKLFSSFGQDI.LDALFWTAT.................................EP---R.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKREHLG.VLPH.LALA.....V....G..YV.........CILS....AV.-.....-....TAATTLNV.AI..NSQ.N..KALLTIMMSNNFVELKG...........MVFKKFEKNNLF.QMSC..........S....DVRERFH.....YV.ILLFVVILQTMKE......................................................................................................ySWQ.EEQFW..TLLPDCMMVM..LAE.VLVDWVKHAF....VTRFN..EIS..Y.E.V.YKEYI.TSL..............AYDLASSKLK-----.......................................................---NAYSDH.SDLISRRMGFIPLPLGALLL.RIIG......ASVQV.RG..........................................................................................................................-S.MGLL.IG.FLVYLCLTALKVLINLLLMGRAC----tlie...................................................................................................................................................................
A0A095CDV6_CRYGR/298-401               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pia----HLNSILRMLL.LM.IP.tG.VLLVS....T.DA......SK.MYHTVR...GQ..DTIKLYVIFNALEI.................GDRLCCAFGQDV.LDTLFARETls.............................psV--RKR.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................GRKRQQAR.PVFF.FALS.....L....G..YV.........S---....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------v......................................................................................................................................................................
A0A1R3GRV6_COCAP/296-347               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELCDFGCFVV.LA.CG..V.LLLER....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLE-.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------ai.....................................................................................................................................................................
W9WWD3_9EURO/478-895                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADMLKGLL.II.CT..C.LILLR....L.DA......SR.MYHWIR...GQ..AAIKLYVIYNLLEV.................CDRLFSAIGQDV.LECLFSKEA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKVLR.PFWL.FVLA.....L....T..YT.........VIHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLVIIASRNIVEtgglsagltafarastataspplitnssi.............................................pftsalpprsvssilpksftllpaavstiTSY.APAVS..QVLGPFLAVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLLI.RATV......QTYQM.FMaawvppsspssstslasihehysaarstm...............................................................pmttstaisktvddiikaipaaitsssvvtHM.TTIL.LF.LLFFLILLACKLVLGMLLLAFARSRYR.......................................................................................................................................................................
A0A1Y2BRK8_9FUNG/248-730               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STSQKCDLMKGLL.VA.IC..C.YMLEN....V.DG......SR.LYHSVR...GQ..STIKLYVIFNLLEI.................CDKLCSAFGHDV.LDSLFSRTS.................................SSTTPA.L....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SLRRIN.RVTH.FSLA.....L....L..YV.........FVHS....MV.L.....F....YQVMALNV.AI..NSY.N..NALLSLLLSNQFIEIKG...........SVFKKFERENLF.QLSC..........S....DIVERFQ.....LS.VFLVIISVRNLVEltgatattaasyspffgltftgtlntllnviittsekfihiitt..............etpqhffhtlftttlptalesvtttiqsllptltsldvwltdlltHPS.SDMVQ..TLLYPVLAVL..GTE.LLVDWLKHAF....ITKFN..QLK..V.SvV.YKKYR.ETL..............CRDLIMGEMDGAAGEa....................................................stVASSGYVDK.SPSVARRIGFVSVPLACLVV.RVVV......QTVRM.LClgeqecwkagdagggagwnlewfgfgvydsmtwfvge...............................................vstcvvgngewqcfedvfghlwseretvkvwvlergavVA.GVLG.KL.LGLYFVLLAIKLVVGFNLIKMARRRM-h......................................................................................................................................................................
A0A498I6S3_MALDO/293-587               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELCDFGCFTI.MA.CG..V.TLLEQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNPDV.LQTLFNSAD.................................GLASCP.P....................-............................................................................................................................................................................................................................................................................................................................................-................................................---ENMRF.WVWR.FICD.....Q....-..--.........----....--.-.....A....LAAITLST.CI..VAH.N..NALWALLVSNNFSEIKS...........NVFKRYSKDNIH.SLVY..........F....DSVERFH.....IS.AFVLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLANALIVY..VCE.MIIDIVKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNI--------.......................................................--------Q.SEGSKKNLTFIPLAPACVVI.RVLT......PVYAA.HLpysp..................................................................................................................lpwkLF.WTLV.LF.AMTYVMLTSLKVLIGMGLQKHASWY--vn.....................................................................................................................................................................
A0A0D2H6P5_9EURO/484-901               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADMLKGLL.II.ST..C.LVLLR....L.DA......SR.MYHWIR...GQ..AAIKLYVIYNLLEV.................CDRLFSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKVLR.PFWL.FILA.....L....A..YT.........VIHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLIIIASRNIVEtgglsaglnafaaaasatasaplasnssm.............................................plitalpprsassilprsftlvpdvvssiTSY.APAVS..QVLGPFLAVL..GSE.MLVDWIKHAY....INKFN..NTR..P.A.I.YGRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLLI.RASG......QTYRM.FMaawvpstppssstslanihkhysaarstm...............................................................pmttstaiskavddiikaipavitsssivtHM.TTVL.VF.LLIFLILLACKLVLGMLLLAFARSRY-h......................................................................................................................................................................
A0A3L8SV16_CHLGU/10-254                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................acr--------------.--.--..-.-----....-.--......--.------...--..-------------V.................ADRLISSFGQDI.LDALYWTAT.................................E--PKE.R....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.---K.....R....A..HI.........VLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHFW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0V0ZXU9_9BILA/126-436               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................c-SPSERCDVLKIII.LI.VS..C.FLVNF....F.DT......SI.MYHMVR...GQ..AIVKLYIVFNMLEV.................ADKLFSSFGQDI.LDALFWTANe...............................pL--AGG.Q....................L............................................................................................................................................................................................................................................................................................................................................R................................................SAKQRCLK.LVPY.LVIA.....I....V..YV.........WLHA....LL.V.....L....LQATTLNV.AF..NSQ.N..KSLLTIMMSNNFVELKG...........SVFKKFARNNLF.QMAC..........S....DVRERFH.....YV.ILLGAVFVRNMSA......................................................................................................vSWR.RDDFF..DMAPDLVFVF..VAE.LLVDWVKHAF....ITKFN..EIP..A.D.V.YKDFT.ITI..............AYDVAKSRQVN----.......................................................----ALTDH.CDQVSRRMGFIPLPLSVLVF.RILS......QSFKI.EP..........................................................................................................................-A.KHWP.TL.ALVFVALLLLKLLISVVMMGKSAE---yie....................................................................................................................................................................
S0DYW9_GIBF5/476-884                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....V..YC.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNVVEvgglsvpgagsesyde......................................................................tsvphhspsilphsftvLPS.WLMSG..EVLSPFFIVI..GSE.MLVDTIKHAY....VTKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTKRLGLAVIPLSCLFI.RASV......QTYHM.LLsthlpmpmpmpipqstqtslseesatpsspamiaaln...............................................rfdslirdslgratygypygsplnsrpwyswtsddfiaAI.TMVV.VF.FIAFLVLLILKLLLGMILLKYSRNRY-a......................................................................................................................................................................
A0A0D2AHR6_9EURO/475-892               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADMLKGLL.II.CT..C.LILLR....L.DA......SR.MYHWIR...GQ..AAIKLYVIYNLLEV.................CDRLFSAIGQDV.LECLFSKEA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKILR.PFWL.FVLA.....L....T..YT.........VIHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLVIIASRNIVEtgglsaglsaltrassataapplttnssi.............................................pftsalpprsvssilpksftllpaavntiTSY.APAVS..QVLGPFLAVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLLI.RATV......QTYQM.FMaawvpssspssstslasihehysaarsnm...............................................................pmttstaisktvddiiraipaaitsssvvtHM.TTIL.LF.LLFFLILLACKLVLGMLLLAFARSRYR.......................................................................................................................................................................
A0A0D2RGT0_GOSRA/292-487               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELCDFGCFLV.LA.CG..V.IVLGR....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVWEI.................FDKLCQRFGGDV.LETLFNSAE.................................GLANCS.Q....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMGFWIRR.FVSD.QALT.....M....A..FS.........ILHS....FI.L.....L....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRFSRDNIH.GLAY..........S....DSVERFH.....IS.ACLLFVLAQNILE.......................................................................................................-AE.GPWFE..SF--------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------lftlniqte..............................................................................................................................................................
A0A2N5U036_9BASI/106-532               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lsv---PCKVDLLQGLL.II.SV..C.VFLHH....VtDA......SR.MYHSVR...GQ..ETIKLYVIFNVLEI.................ADRLCCSFGQDI.LDSLFSPST.................................LGRRID.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--TQPHMK.PLFL.FILA.....F....I..FT.........VAHT....LV.L.....F....YQLVSLNV.AI..NSF.D..HSLITLLISNQFVEIKG...........AVFKKFEKENLF.QMSC..........A....DIVERFQ.....LF.LMLTIIAIRNLIEmsgsstssshah..............................................................................sytyhylpaslnlSPT.LSLIE..KIFSPVLVVM..LSE.VLVDWLKHAF....ITKFN..HIR..P.T.V.YGRFI.DVL..............CKDLVSDHTPQIKVEedt................................................ndddQDLKPFVDK.SPAVSRRLGFSVFPIFCLSV.RVFF......QAIDM.LSdtsdeefnlftdqviddfntdgqskfsveyikqqffrip...........................................ystflngdpqlplldtiekdavppsstevagsstfssfqmKG.FIIL.SC.VVVMSFLILIKLYIGIRIRLYAIKRV-e......................................................................................................................................................................
L8G301_PSED2/488-891                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLATVGQDI.LECLVCDET.................................LERGLD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FVLT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsasgaad...................................................................tlrnatiplrssiipnsfKII.PSWSG..EVLSPLLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FVathfppplastatsisleseataspattaameh.......................................................ldilirkalgrstyvtgasvertwqlfdsddiisFI.AMAA.FF.LGAFLALLSCKLVLGMLLLQYSRRRY-e......................................................................................................................................................................
A0A395IDS6_ASPHC/506-928               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.MI.AT..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFGAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnifsglgssftststnstplst..................................................pprtsssilpqaftivpssivasfsqaNSY.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYKM.FIaallpqqpssstavestslsaihsqyvpapmpsp.....................................................ppltfqnfiptstayagawfrqmlantmptpassvYI.FTIV.LI.LTGYVVLLILKLLLGMLLLALARSRYK.......................................................................................................................................................................
C3Y6T6_BRAFL/87-391                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LEPAQICDLIKAGI.II.VC..T.NILFY....V.DT......SM.LYHVVR...GQ..SIIKLYIIFNMLEV.................ADRLFSAVGQDI.LDALFWTAT.................................---EPR.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RRRDHLG.VIPH.FFMA.....I....I..YV.........FLHS....TL.V.....L....FQATCLNV.AF..NSH.N..KSLLTVMMSKHFVELKG...........SVFKKFAKNNLF.QMSC..........A....DIRERFH.....YH.VLLYIVVMRNMTE......................................................................................................fNWS.PDHLY..QLIPDVSMII..AAE.YLVDWVKHAF....ITKFN..EIP..A.D.V.YDEYR.ASL..............AYDMISSRQKN----.......................................................----AFSDH.SDLVSRRMGFIPLPLTCLVY.MITR......KSVKV.QG..........................................................................................................................-T.TGIF.LL.ALTYLALVTVKVLNSIVLLGNACKYV-k......................................................................................................................................................................
F1PQT8_CANLF/357-661                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.TAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.VLFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A2I0MN86_COLLI/16-320                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A3B3Y556_9TELE/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHFW..VLFPDVVMVI..TSE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----mfvk...................................................................................................................................................................
A0A210QSL0_MIZYE/121-425               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LEPAQICDILKGII.LL.VS..F.FIINY....I.DT......SM.MYHLVR...GQ..AIVKLYVFFNMLDM.................ADRLFSSFGQDI.LDSLYWTAM.................................EPR---.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DKKRQHFG.VIPH.LLLA.....I....L..YV.........IIHC....LL.I.....L....FQATVLNV.AF..NSH.N..KALLTIMMSNNFVEIKG...........SLFRKIDKELLY.HISC..........S....DVKERFH.....YT.ILLAVVFIRNMTE......................................................................................................fNWN.IEHVW..VIIPDAVIVL..CAE.LCVDWVKHAF....ILKFN..EMP..A.D.I.YHTYK.VRL..............SEDMISNRQS-----.......................................................---RAYIDY.SDMVARRMGFTPLPLACLLV.RICT......KSFKV.TG..........................................................................................................................-T.TGAL.VV.FLLFLCLITFKILNSIILLGQATE---mta....................................................................................................................................................................
G4ZK70_PHYSP/209-506                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lr--RTHFYDLMVAVI.VA.VG..T.SVLLN....V.DM......SR.VYHAIR...GQ..AMIKLYVLFTMIEI.................FDRLFSSLGQDI.LDSLYYTAK.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YHPRRVTR.MFLD.FTVA.....I....V..YV.........VLHS....LL.L.....F....AQVVTLNV.AV..NSS.N..TSLLTLLISNNFAELKS...........SVFKKFEEQNLF.QISC..........S....DIVERFK.....LI.TIISLILLQSSTG.......................................................................................................---.-----..DVAWGTAMVW..VAE.MLIDWLKHAF....ITKFN..QLP..P.T.M.YSKFI.TIL..............CRDLTGWKSE-----.......................................................---DTILDH.THHVSKRLGLMSLPLACVVL.RMVS......KALAD.VPie......................................................................................................................ftSP.SGVL.VT.IAFFMCLAAFKALLSLALMIYACKS--gr.....................................................................................................................................................................
A0A1E1KDY8_9HELO/536-925               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSYHKADLLQGAV.II.VS..C.FILMR....L.DA......SR.MYHSIR...GQ..SAIKLYVIFNALEV.................CDKLLAALGQDI.LECLFSNET.................................LERNSY.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PLGM.FILA.....L....I..YN.........VTHA....TA.L.....F....YQVIALNV.AV..NSY.S..NALLTLLISNQFVEVKS...........TVFKKIEKDNLF.QLTC..........A....DIVERFQ.....LW.LMLVIIALRNFVEvggyadiagada...............................................................................vsrntsifpssfNIL.PSWSG..EVLTPFLVVL..GSE.MMVDWIKHAY....ISKFN..NVK..P.A.V.YKRYM.DIL..............AKDYYTN--------.......................................................----AFVNQ.N--LIKRLGLPVIPLSCLFI.RSSV......QTYHM.FLathvpspvastatalsvesaspattaalehfd.........................................................niirralgrstfgipdplaknpwylpsaddaiaAL.TMLV.FF.LGAFFVLLACKLVLGMLLLKYARNRY-a......................................................................................................................................................................
A0A2V1BQB4_9HELO/512-896               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGAV.II.FS..C.FILMK....L.DA......SR.MYHSIR...GQ..SAIKLYVIFNALEV.................CDKLLAALGQDI.LECLFSNET.................................LERDSY.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PLGM.FVLA.....L....I..YN.........VTHA....TA.L.....F....YQVIALNV.AV..NSY.S..NALLTLLISNQFVEVKS...........TVFKKIEKDNLF.QLTC..........A....DIVERFQ.....LW.LMLIIIALRNVVEvgygdaag......................................................................................ddtilpssfIVL.PSWSG..EVLTPFLLVL..GSE.MLVDWIKHSY....ISKFN..NVK..P.A.V.YQRYL.DVL..............AKDYYTN--------.......................................................----AFINQ.N--LIKRLGLPVIPLSCLFI.RSSM......QTYQM.FLathlpspvastatalsvesattspattaalehf.......................................................dniirralgrstfgipdplatnpwylpsaddaiaAL.TMLI.FF.LGAFFVLLACKLVLGMLLLKFARNRYR.......................................................................................................................................................................
I3N3A7_ICTTR/88-392                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKILNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0A2KXZ6_PENIT/498-929               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILTGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIIR.PFWL.FLVA.....L....V..YT.........VSHS....LS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFRKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgnlglgssftgqsstitnstpl.............................................stpprtassilplaftlfpssilpsfnsvNSF.IPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NNR..P.V.I.YSRFL.DVL..............AKDYYTN--------.......................................................----AFGEQ.N--LTRRIGLPVIPLSCLFF.RXRL......RRTKP.PPshrpptallpqnpsstamgatsltsihnnyapspip.................................................sappltlatlipasaahasalfrtllenaipspaqsvHI.FTGI.LL.LTGFIVLLILKLLLGMALLAFARSRYR.......................................................................................................................................................................
A0A369J834_HYPMA/239-596               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRALL.LV.VS..V.LILNP....LtDA......SK.IYHTIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.IDCLFSRST.................................LEPLSH.R....................-............................................................................................................................................................................................................................................................................................................................................I................................................PVTTHTFR.PILF.FTLA.....T....L..YN.........VAHA....LV.M.....V....YQLISLNV.AI..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLFVVAFRNLIElsgsefdfs.....................................................................................egfvlpkswFRG.NNVLW..TISYPVVTVM..MSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFAALPLAVLAI.LVGS......QSLNL.MFavnsdfsslwt....................................................................................................vpslsnaeimhYL.TWAA.MG.VLFWLCFLVIKIILGVNLISYATRRR-a......................................................................................................................................................................
A0A061E9M6_THECC/291-451               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELCDFGCFAV.LA.CG..V.ILLER....T.DI......SL.IYHMIR...GQ..GTFKLYVVYNVLEI.................FDKLCQSFGGDV.LETLFYSAE.................................GLANCS.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................KMRFWIRR.FVLD.QALA.....M....A..FS.........ILHS....FI.L.....L....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRFSKDNIH.SLVY..........S....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------adfey..................................................................................................................................................................
A0A151T1Y6_CAJCA/217-507               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--TIELSDFGCFLI.MA.CG..V.TVLQQ....I.DI......SL.IYHMIR...GQ..ATIKLYVIYNVLEI.................FDKLCQTFIGDQ.---LLLQI-.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-------S.FFFG.LIIF.....L....T..FV.........LVHS....FI.L.....L....VQAITLSA.CI..VAH.Y..NALPALLVSNNFSEIKS...........YVFKGYSKDNVH.SMVY.........sA....DSIERFH.....IS.AFVLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLINILLVY..LFE.MAIDVIKHSF....IAKFN..NIA..P.I.A.YSEFL.EVL..............CKQTLHMQT------.......................................................---------.-EGARKKLTFVPLAPACVVI.RVLT......PVYAA.NLpyns..................................................................................................................lpwrLS.GILL.FS.ALTYVMLTSLKVLTGMILQKHARWY--vn.....................................................................................................................................................................
A0A2P7YZH0_9ASCO/187-519               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lhfi-----KRDLINVFV.IL.TT..V.ALLASp..tV.EV......SR.LYHDVR...GQ..AHLKLYVIFGVLEV.................MDKLLSSIGQEI.FTVLVGIPV.................................T-----.-....................-............................................................................................................................................................................................................................................................................................................................................N................................................TNIRNMSK.LALF.MGIA.....L....V..YS.........ASHA....YV.L.....I....YQSVSLHV.AA..NSY.S..NALMALLLSNQFAELKG...........AVFKKFDREGLF.QVAM..........S....DLTERFQ.....LS.LMLFIISIRNLAQlnmtqlg.........................................................................................lvvpdswKSW.NKWFG..AIFGPSMVVL..GSE.VFVDWLKHCF....IIKFN..RIK..P.R.V.YKNFL.YVS..............STDFMEVFTSNSRR-.......................................................-STLNEISD.YIILAKRIGLPISSLCICFL.RMTL......RDLKQ.LYvpsl..................................................................................................................nllsIL.ACGL.LA.VLTFITLLVVRLVLGLWLLQWARRI--kh.....................................................................................................................................................................
L2FM54_COLFN/546-954                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGAV.IL.CS..S.LFLMK....L.DA......SR.MYHFIR...AQ..DGIKLYVIYNVLEV.................GDRLLSALGQDI.FECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PMGM.FVLA.....L....V..YN.........VIHS....VS.L.....Y....YQVITLNV.AV..NSY.S..NALLTLMISNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLLIIGMRNIVEvgglsvpgagsesgsdmg...................................................................ggamplhspsilpfsftvLPS.WVWSG..EVLSPFLIVI..GSE.MLVDTIKHAY....VNKFN..NIK..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLAVIPLSCLFI.RASV......QTYHM.FLstriptplpestqtslsvesatpsspvmvaaldrld..................................................tllrdalgravygypyaspgvkarswwswtsddviaAV.TMIV.VF.FIAFLVLLVIKLLLGMILLRYSRNRY-a......................................................................................................................................................................
A0A364L251_9EURO/491-918               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-EPDDKADLLKGFL.MI.CT..C.IILSS....L.DA......SR.MYHWIR...GQ..NAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSEEA.................................LDRGQD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVVR.PFWL.FLLA.....L....T..YT.........TTHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgaltswftvgstvvnqvrstvtnstplt.............................................tsprsstsilpqsftflpstiftsltggaNTL.LPHFA..QVLGPFLIVL..GSE.MFVDWLKHAY....IAKFN..NTR..P.A.I.YGRFL.DVL..............TKDYYTN--------.......................................................----AFVDQ.N--LTKRMGLAVIPMACLFF.RVSV......QTYQM.FLqallpmqasstehsasltamhehysnlpqpstpp.....................................................ipftvqsvmstsldrlswvfntivenaipspiqsvTF.FTIV.LV.VTGYLILLILKLTLGILLLSFSRSRYK.......................................................................................................................................................................
F0ZW42_DICPU/356-671                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TTNQIFDLIRGFI.WV.SC..F.IFLTF....I.DS......SM.LYHYIR...GQ..AVIKLYVIYNVLEV.................LDKLCCSFGQDI.FDSLYWMSYs..............................fsHSKDIK.E....................K............................................................................................................................................................................................................................................................................................................................................S................................................QKETRILA.PVSH.TIVA.....T....G..YV.........FLHS....LV.L.....F....SQVITLNV.AI..NSY.N..NALLTLMISNQFVELKG...........SVFKRFEKENLF.QISC..........S....DIVERFQ.....AF.IFLMIIAFQNLSDl....................................................................................................nwDLS.KDYFL..DIGLVFLTVL..GSE.LVVDAIKHAF....ITKFN..KLP..P.K.L.YTKFF.IIL..............SDNIVDPRNR-----.......................................................----NFTES.SWGINNIIGFVPFPLASIII.RFFY......KFIPF.DN..........................................................................................................................VV.TGIV.LT.VQIYICLVLLKIFIKIVIIGQCLSN--nd.....................................................................................................................................................................
A0A0N1INF9_PAPXU/138-448               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKPAETCDVLKGFI.LL.IC..S.ILMCY....I.DT......NM.MYHLVK...SQ..SVMKLYIFYNMLEV.................GDRLFSAFGQDI.IDALFWTAT.................................E---PR.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DRRREHLG.VIPH.FIFA.....M....T..YV.........FLHS....LL.V.....L....FQATTLNV.AF..NSN.N..KSLLMIMMSNNFVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERLH.....LS.VLLFIVVLQTMKE......................................................................................................yLWR.EDRFW..ILAPDCVLVL..TFE.VIIDWVKHAF....ITRFN..EIP..Y.G.V.YREYT.VSL..............AYDVAQTRQKY----.......................................................----AFSDH.SDLVARRMGFIPLPLGVVIT.RVLV......HAVK-.--..........................................................................................................................--.----.--.---------------------------idgepkevtkeisfskpaecevplarkpvqlkfqipedvvise............................................................................................................................
A0A0L7REA6_9HYME/149-456               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-RPAEICDLLKGIV.VI.SC..W.AVTWK....V.DT......SM.MYHLVK...SQ..SVIKLYIFYNMLEV.................GDRLFSSFGQDT.IDALLWTAT.................................EPRSKR.K....................-............................................................................................................................................................................................................................................................................................................................................-................................................-TRSQHLG.TIPH.LMFA.....G....T..YV.........LLHS....IL.V.....L....FQATTLNV.AI..NSS.N..KALLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........A....DVRERFH.....LI.MLLFAVNLQTMKE......................................................................................................yAWK.TERLA..DLLPDCIMLL..LAE.VLVDWVKHAF....ITRFN..ELR..S.T.V.YRDYT.ISL..............AYDMAQTRQEN----.......................................................----AFSDP.SDLVARRMGFIPLPLGVAIG.RVFC......TTVTP.SA..........................................................................................................................KP.ANII.LF.LLAYLILIALRILNSVVILGKAC----dli....................................................................................................................................................................
A0A0R0J9R9_SOYBN/271-470               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................e--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--AITLSA.CI..VSH.Y..NALPALLVSNNFAEIKS...........YVFKGYSRDNVH.SMVY..........S....DSIERFH.....IS.AFILFVLAQNILE.......................................................................................................-AE.GPWFG..SFISNILLVY..LFE.MGIDIIKHSF....IAKFN..NIA..P.I.A.YSEFL.EVL..............CKQTLHMQ-------.......................................................---------.TEGAKKKLTFVPLAPACVVI.RVLA......PVYAA.NLpynp..................................................................................................................lrwrLF.WILL.FS.AITYIMLTSLKVLIGMVLQKHARWY--vn.....................................................................................................................................................................
W2JJI2_PHYPR/253-550                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RTHFYDLMVAVI.IA.VG..T.TVLGY....V.DM......SR.VYHAIR...GQ..AMIKLYVLFTMIEI.................FDRLFSSLGQDV.LDSLYYTAK.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YHPRRVTR.MFLD.FAVA.....I....I..YV.........VLHS....LL.L.....F....AQVVTLNV.AV..NSS.N..TSLLTLLISNNFAELKS...........SVFKKFEEQNLF.QISC..........S....DIVERFK.....LL.TIIGLILLQSSTG.......................................................................................................---.-----..DVAWGTAMVW..VAE.MLIDWLKHAF....ITKFN..QLP..P.T.M.YSKFI.TIL..............CRDLTGWKSE-----.......................................................---DTILDH.THHVSKRLGLMSLPLACVVL.RMVS......KALVE.APie......................................................................................................................faSP.GGVL.VT.VAFFLCLAAFKALLSLVLMIYACKS--gr.....................................................................................................................................................................
A0A0D1ZUI0_9EURO/472-889               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADLLRGLL.IL.TT..C.VVLLR....L.DA......SR.MYHWVR...GQ..AAIKLYVIYNILEV.................CDRLFSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKILR.PFWL.FVLA.....L....V..YT.........VIHS....VA.L.....F....YQVITLNV.AV..NSY.S..NALITLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DIVERFQ.....LW.HMLVIIAARNIVEtgglssglsalmnsasattsapassnssl.............................................pltaavppksassilpssftllpavvnsiTSY.APAVS..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYQM.FMaawvpstapssstslasiyedysaarstl...............................................................plstsaaisrtvddiirsiptvitksravtHM.TTVL.MF.LLLFLILLACKLVLGMVLLAFARSRY-h......................................................................................................................................................................
N1Q8R6_PSEFD/201-609                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLQGLL.IG.AA..C.VVLMS....F.DA......SR.MYHSIR...GQ..SAMKLYVIYNVLEV.................FDRLLSALGQDI.LECLFSKET.................................LERDTD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVKR.PLGM.FLLA.....L....V..YT.........IGHS....TV.L.....F....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........AVFKKFEKENLF.QMTC..........A....DVVERFQ.....LL.LMLLIIALRNIVEvgglsisltsafvdttapie..............................................................smggnstgvpsvsgfvipkafTLL.PKWTG..EVLGPFLIVL..GSE.ALVDWCKHAY....ITKFN..NVK..P.K.I.YGRFL.DVM..............AKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVIPLSCLFI.RAVV......QTYHM.FLaihmpppipsaatsisvdseaasssatmaafah.......................................................fdqvlrralgrssfgagndsngsfgwwtfddsiaLA.TMLI.FF.LASYLILLAFKLLLGMGLLSYARNIY-k......................................................................................................................................................................
G8BRY7_TETPH/151-473                   ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................asrisk-------ERLIVFI.IV.VA..S.LILTK....L.DT......SK.VYHLIK...RQ..SSVKLYMLYNVLEM.................SDKMLSSFGQSL.LNVVLSKKY.................................N-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................AYKGTPIQ.HIFF.IIIS.....I....V..YL.........VIHG....YI.L.....V....YQTVALNV.AI..NSY.S..NSLLTLLLSIQFAELKS...........AIFKKFDKEGLF.QITI..........A....DVVERFQ.....II.VILTIISVRNLVArygssgtilp...................................................................................tswtlhsttsTTA.SIIIG..ALCGPMVSVI..GSE.LIVDWAKHAY....INKFN..RIR..P.T.I.YEKFF.VIT..............YRSYISG--------.......................................................---------.IQKYQDRLGLPLHAYTVLSL.VMVP......RTIIQ.GLrasny................................................................................................................hgtqiFI.VATL.IF.IFVMGILIVMKLCVYSILTKWGTEI--kk.....................................................................................................................................................................
H2YLP4_CIOSA/230-361                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................qys--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................-WN.YEHFM..EIIPNMLMLL..FSE.CVVDWFKHAF....VLKFN..HIP..I.E.S.YKEYR.ATL..............AYDVASSRHKD----.......................................................----SVNDH.SDVVSRRLGFIPLPLAVLMF.HVTR......ISIDF.HG..........................................................................................................................-T.AGVL.VI.FVGYIILTLLKVFNSIVIVGKAC----iyi....................................................................................................................................................................
A0A194WXL8_9HELO/464-857               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSYHKADLLQGAV.II.CS..C.MILMK....L.DA......SR.MYHSIR...GQ..AAIKLYVIFNVLEV.................FDKLLAALGQDI.LECLSSNET.................................LERDID.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PMGM.FILA.....L....I..YN.........VVHA....AA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........TVFKKIEKDNLF.QLTC..........A....DIVERFQ.....LW.LMLMIIALRNIVEvgglsmlgggadgdlm......................................................................rdptapsrsnsimpnsfTIL.PSWSG..EVLSPFLLVL..GSE.MLVDWIKHAY....TSKFN..NVK..P.A.V.YNRYL.DVL..............AKDYYTN--------.......................................................----AFVNQ.N--LIKRLGLPVIPLSCLFI.RSAF......QTYHM.FLathlpsplpspslstslsvessspsttaal..............................................................dhfdtiirralggsplpghwmipdtdsllaAT.TMIV.FF.LGLFLVLLALKLVLGMLLLKFARNRYK.......................................................................................................................................................................
A0A2H3F3F4_9HELO/499-616               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....--EFN..NVK..P.A.V.YQRYL.DVL..............AKDYYTN--------.......................................................----AFVSQ.N--LIKRLGLPVIPLSCLFI.RSSM......QTYHM.FLathxxxxxxxxx..................................................................................................xxxxxxxxxaiaTL.TMLI.FF.LGAFFVLLACKLVLGMLLLKFARNRYR.......................................................................................................................................................................
A0A2I0XJ69_9ASPA/274-587               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pn--AAELSDFGCFIV.LV.LG..V.TTLQR....T.DI......SL.IYHMIR...GQ..GTVKLYVVYNVLEV.................FDKLCQSLGEDV.LQVLFSSAE.................................SLSSCS.A....................-............................................................................................................................................................................................................................................................................................................................................E................................................NFKLEVGK.FIFD.AAIAivsfnI....L..DV.........ILHS....FI.L.....L....AQAVTLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKDNLH.NLVY..........S....DIIERFH.....IT.AFVLFVLAQNILE.......................................................................................................-AE.GSWFE..SFLMNAFMVY..MCE.ILIDSIKHSF....LAKFN..DIK..P.D.A.YSEFL.EDL..............CKQTLNEKPE-----.......................................................---------.--GRPKDLTFIPIAPACVVI.RVLT......PIYAT.LLpygp..................................................................................................................fmwrLF.WIIV.WS.SLTYVMLAISKIMVGLTLRRLANW---yln....................................................................................................................................................................
H2LUY7_ORYLA/218-522                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVVMVI..TSE.VAVDIVKHAF....ITKFN..DIN..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYMGMITLKVLNSIVLLGTSCS---fvk....................................................................................................................................................................
A0A3P8TR69_AMPPE/179-483               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHMIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVFMVV..TSE.IAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................-A.LSYS.CL.FLFYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A0C3DZD2_9AGAM/161-519               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.VV.VS..V.TVLLP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNSLEI.................ADRLCASIGQDI.LDCLFSRST.................................LETVSR.G....................T............................................................................................................................................................................................................................................................................................................................................S................................................-VTPHILR.PYVY.FVLA.....T....L..YV.........ACHT....LV.M.....L....YQLLSLNV.AV..NSY.D..HALLTLLMSNQFVEIKG...........CVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLLVVAFRNLIElsgsefdfsg...................................................................................gfvmpksfgwFRG.NNVLW..TISYPVLTVL..ASE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYI.DVL..............CRDLASGSAVG-RLG.......................................................ARKHSYVDQ.SPLVARRLGFSSVPLAVLAI.LIGF......QSLNL.VLshrlygewst.....................................................................................................lgqmssvevlyLV.KCLA.IG.LAFWLCSLAFKVLLGVNLICYATQRR-g......................................................................................................................................................................
H2YLP4_CIOSA/83-235                    .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-DPAQSCDLLKGVI.FI.SC..V.FFMSY....I.DT......SI.IYHLVR...AQ..TLIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALFLTAT.................................E----S.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................RLKRGGFR.VLLH.LILA.....I....I..YV.........FSHA....VL.V.....L....FEATTLNV.AF..NSH.N..KVLLTIMMANNFVEIKG...........TVFKKYDKNNLF.QQ--..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------yswny..................................................................................................................................................................
A0A151GVE2_9HYPO/539-946               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.IA.CS..S.LALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAM.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....S..YN.........CLHS....IS.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNIVEvgglsvpgagsdsvledi...................................................................sgstpnrsssvlppsftfLPS.WIMSG..EVLSPFLIVI..GSE.MLVDTIKHAY....VTKFN..NIK..P.A.F.YSRTL.DIL..............CKDYYTN--------.......................................................----AFVAP.S--LTRRLGLAVIPLSCLFI.RASI......QTYHM.FLsthipmpappstqtslseesatptspammaalnrf...................................................dtllrtslgratfgypygsplnsrrwyswtsddviaAL.TMVV.VF.FIAFLVLLMLKLLLGMVLLKYARNRY-s......................................................................................................................................................................
S8DX91_FOMPI/130-493                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.LI.VS..V.IILSP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEVISH.H....................K............................................................................................................................................................................................................................................................................................................................................K................................................-PTSYIFR.PVAY.FALA.....L....V..YN.........MAHT....LV.M.....I....YQTISLNV.AV..NSF.D..YALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LF.LMLLVVAFRNLIElsgssfnlge...................................................................................glalpksfgwFRG.NNALW..TISYPVLSVM..TSE.MIVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFASVPLAVLAI.LIGS......QSVNL.LIsmhadsdvpwiwd................................................................................................rtyadvstdewinAA.KWAA.LA.VLLWFCFVVVKIMLGVQLLSYATRRR-a......................................................................................................................................................................
A0A2N6NQI9_BEABA/543-957               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STYHKADLLQGAV.IL.CS..S.FVLMK....L.DA......SR.MYHFIR...AQ..SAIKLYVIFNILEV.................GDRLLSAIGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGM.FLLA.....L....A..YN.........CLHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFH.....LW.IMLLIIAMRNIVEvggfsvpgagvgetdvdg..................................................................sgggaplhnssilphsftaLPS.WMWSG..EVLSPFLIVV..GSE.MLVDTIKHAY....VTKFN..NIK..P.H.F.YSRTL.DIL..............CKDYYTH--------.......................................................----AFTSP.S--LTRRLGLAVIPLSCLFI.RASV......QTYHM.FLatylpmplpastqtslaeesarpsspammaalnrfdal.............................................irdslgratygsppplggahhphhhqrpwyawtsddlvaAL.TMVV.VF.FIAFLVLLILKLLLGMALLKYSRARY-a......................................................................................................................................................................
A0A1S3SSN5_SALSA/153-457               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDIMKGLI.MV.LC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLQV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FIMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWS.PDHLW..VLLPDVFMVI..ASE.IAVDVIKHAF....ITKFN..EIT..A.D.V.YSEYR.ASL..............AFDLISCRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVNV.QG..........................................................................................................................A-.LSYS.CV.SLFYMGMVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A444ZWR8_ARAHY/265-557               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pst---VELSDFGCFLM.MV.CG..V.ILLQQ....I.DI......SL.IYHMIR...GQ..STIKLYVIYNVLEI.................FDKLCQHFNGDV.MRMLFHSAE.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.GLAK.FHPE.....M....E..IV.........LVHS....CI.L.....L....VQAITLSA.CM..VAH.N..NALPAMLVSNNFAEIKS...........YVFKGYNKDNVR.SLVY..........F....DSIERFH.....IS.ALILFVLAQNILE.......................................................................................................-AE.GSWLG..SFLINILLVF..LCE.MAIDIIKHSF....IAKFN..NIK..P.I.A.FSEFL.EAL..............CKQTLNIETE-----.......................................................---------.--DAKKNLTFVPIAPACVVI.RVLT......PVYAA.NLpynp..................................................................................................................lpwrLF.WIML.FS.AMTYIMLTSLKVLIGMILQKHATWY--in.....................................................................................................................................................................
A0A0J8QSS9_COCIT/643-721               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................faa---AGKADILKGLL.MI.LN..C.TILLY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLFSAIGQDV.LECLFSREA.................................LERG--.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------rta....................................................................................................................................................................
A0A0R0JIG8_SOYBN/279-581               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMEVSDFGCFLI.LS.SG..V.VLLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVI------.................FDKLCQNFNGDV.LQTLFLSAE.................................GLANCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................SMRFWIWR.FASD.QALA.....V....A..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSEDNVH.SLVY..........F....DSVERFH.....IS.SFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLINILLVY..VSE.MIIDIIKHSF....IAKFN..NIK..P.I.A.YSEFL.EDL..............CKQTLNMQTK-----.......................................................---------.--SAKKNLTFVPLAPACVVI.RVFT......PVYAA.NLppnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKVLIGMGLQKHATWY--vn.....................................................................................................................................................................
A8N7H3_COPC7/231-593                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRGLL.LI.IS..L.LILNP....LtDA......SK.IYHTIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDV.LDCLFSRST.................................LEPLTH.R....................-............................................................................................................................................................................................................................................................................................................................................I................................................PVTTQTLR.PIFF.FFLA.....T....I..YN.........VAHG....LV.M.....V....YQLIALNV.AI..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLLIVALRNLMElrgtdfease...................................................................................gfvlpksfgwFRG.NNILW..TISYPVVMVL..GCE.MVVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CLDLSSGSAVG-RRR.......................................................TRKHSYVDQ.SPLVARRLGFASLPLAALFI.LVGS......QSLSG.VFssafseftypwt.................................................................................................wslrtlsqddfiyYL.TWAT.IG.LLFWLCFVCIKIIVGINLISFATRRR-a......................................................................................................................................................................
A0A3D8RMG8_9HELO/500-896               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSYHKADLLEGAV.II.CS..C.VILLK....L.DA......SR.MYHSIR...GQ..AAIKLYVIYNVLEV.................CDRLFSALGQDI.FECLFSDET.................................LERNSN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PLGM.FFLA.....L....A..YN.........VIHA....AA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........TVFKKFEKDNLF.QLTC..........A....DVVERFQ.....LW.LMLMIIACRNIVEvgglsalsnasdevt.........................................................................ksgpirsnsmlpnsfQIL.PSWSG..ELLSPFLIVL..GSE.MLVDWVKHAY....ISKFN..SVK..P.A.V.YQRFL.DVL..............AKDYYTN--------.......................................................----AFVNQ.N--LIKRLGLPVIPLSCLFI.RASV......QTYHM.FLathmpppipstatalslenaptpvttaafehfd........................................................niirsalgrsafgipdpaasgpwylpsaddviaAL.TMLV.FF.SGAFLVLLALKLVLGMLLLKFARNRY-s......................................................................................................................................................................
A0A1Q3E3E0_LENED/57-436                ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.LI.LT..V.AILVP....LtDA......SK.IYHFVR...GQ..DTIKLYVIFNALEI.................GDRLCASIGQDI.LDCLFSRST.................................LEPLSH.R....................-............................................................................................................................................................................................................................................................................................................................................V................................................PFSSHTFR.PLVF.FLLA.....T....V..YN.........VLHC....IV.M.....V....YQLISLNV.AV..NSY.D..NALLSLLISNQFVEIKG...........SVFKKFEKDGLF.QITC..........A....DIVERFT.....LT.LMLGIVAFRNLIElsgsefdfdtggf.............................................................................vlpksfgwfwfrgHKT.INFLW..TISYPVLTVM..ISE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERFT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFSSLPLAVLAI.LIFY......QSLSL.LFslpsatsgsfspagiwdt......................................................................................espvtrgsfdftneellrCA.TWIF.LG.VLIWLCFVVIKIIIGVNLISYATRRR-a......................................................................................................................................................................
A0A0E0GSV9_ORYNI/276-570               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................NATFELMR.FIL-.----.....-....-..--.........----....-D.E.....A....IAAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IT.SFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASLVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKTD-----.......................................................---------.--DRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrVF.WILL.WS.VLTYFMLAVFKILVGLVLRCLATWY--vn.....................................................................................................................................................................
A0A319EUF1_ASPSB/529-953               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.MI.AT..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNLVEtgafnilgslssslggyastgtnstpls...............................................tpprtassilpqaftivpssiiasfsqvNTY.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.A.I.YGRFL.DIL..............TKDYYTN--------.......................................................----AFANQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FItallpqhpsstaieatslsaihrqyvpapipspp......................................................pltlrtfiptstayagaffrqvlanampspaqsvYI.FTIV.LI.LTGFVVLLILKLLLGMVLLAYARSRYK.......................................................................................................................................................................
A0A2R8QA95_DANRE/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.TLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSIV.CV.LLFYLGMITLKVLNSIVLLGKSCM---yvk....................................................................................................................................................................
C5WN07_SORBI/284-592                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSACS.A....................D............................................................................................................................................................................................................................................................................................................................................N................................................-VTFELMR.FILD.EAIA.....V....V..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.SLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLTNASLVF..LCE.VVIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKPD-----.......................................................---------.--DHKKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrIF.WILL.WS.ILTYFMLAIFKIIVGLILRCLANW---yvn....................................................................................................................................................................
A0A093QIW3_9PASS/89-393                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLISSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0S7DNT9_9EURO/512-935               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VLHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgtlssslssrststnstpls................................................tpprssssilpqsftffpsslissfsqvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....ISKFN..NTR..P.A.I.YGRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallphqpsstavestslasihshyvpspipsap......................................................pltlrtilpasaahasaffrrvlanampspaqsvYI.FTIV.LI.LTAFILLLILKLLLGMLLLAYSRSRYK.......................................................................................................................................................................
A0A2H3JNI4_WOLCO/130-493               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.LI.TS..V.ITLAP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEVISH.R....................K............................................................................................................................................................................................................................................................................................................................................R................................................-PTSFIFR.PLLF.FVLA.....L....V..YN.........VAHT....LV.M.....I....YQMISLNV.AV..NSY.D..YSLLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLGVVAFRNLIElsgssfnfse...................................................................................gfalpksfgwFRG.NNVLW..TISYPVLAVM..ASE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFASLPLAVLAI.LIGS......QSVNI.LIlmhtdgsvpwiwt................................................................................................rpfdeisndelinVA.KWVA.SA.LLMWFCFVVIKIILGVKLLSYASMRR-a......................................................................................................................................................................
K1RDF0_CRAGI/121-440                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LEPAQICDILKGVI.LV.FC..F.LIVNY....I.DT......SM.MYHLVR...GQ..AVIKLYVFYNMLDM.................ADKLFSSFGQDI.LDSLFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DRKREHIG.VLPH.LVIA.....I....I..YV.........VIHT....LL.I.....L....FQATVLLV.AF..NSH.N..KALLTVMMSNNFVEIKG...........SLFKKIDKGFLF.HISC..........S....DVKERFL.....YI.VLLAIVFIRNMTE......................................................................................................fSWD.PQHVW..VILPDAVMVF..VAE.ILVDWVKHAF....ILKFN..EIP..A.D.V.YHSFS.TRL..............AEDMVANRQSRVSDSkse................................................kilrRKHVAFIDY.SDLVSRRMGFTPIPLAVLVL.RICT......KSFKV.SG..........................................................................................................................-Y.TGLG.IL.ILLYLCLMTFKVFNSIVLLGKAY----tlie...................................................................................................................................................................
A0A0V0TYW5_9BILA/124-434               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................c-SPSERCDVLKIII.LI.VS..C.FLVNF....F.DT......SI.MYHMVR...GQ..AIVKLYIVFNMLEV.................ADKLFSSFGQDI.LDALFWTANe...............................pL--AGG.Q....................L............................................................................................................................................................................................................................................................................................................................................R................................................SAKQRCLK.LVPY.LVIA.....I....V..YV.........WLHA....LL.V.....L....LQATTLNV.AF..NSQ.N..KSLLTIMMSNNFVELKG...........SVFKKFARNNLF.QMAC..........S....DVRERFH.....YV.ILLGAVFVRNMSA......................................................................................................vSWR.RDDFF..DMAPDLVFVF..VAE.LLVDWVKHAF....ITKFN..EIP..A.D.V.YKDFT.ITI..............AYDVAKSRQVN----.......................................................----ALTDH.CDQVSRRMGFIPLPLSVLVF.RILS......QSFKI.EP..........................................................................................................................-A.KHWP.TL.ALVFVALLLLKLLISVVMMGKSAE---yie....................................................................................................................................................................
G8JNL6_ERECY/105-416                   ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................yqkvik-------EVKMLSL.IL.VS..S.FVLLH....L.DT......SR.VYHKIK...GQ..SAVKLYMMFQVLEM.................CDKMLSSFGQNL.FSTVIISKT.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-TRKHTIR.EICL.FVAT.....L....G..YL.........IAHV....FI.L.....I....YQTIALNV.AV..NSY.S..NSLLTLILSMQFAELKA...........SVFKRFDKEGLF.QLAI..........A....DIVERFQ.....LL.TFLTIIALRNIVAtgksishi.......................................................................................ipnswrlpSTS.SIITG..VLYGPVVTVI..GSE.ILVDWIKHGY....VTKFN..CIR..P.H.L.YDRFL.QIL..............YHDHQNNL-------.......................................................---------.-REFQLRIGLPIPALVVLFI.VLVS......PTISQ.GLisa....................................................................................................................stsSM.NTVA.IL.VLGFLCLVLAKFILQAILLKWV-----kasq...................................................................................................................................................................
A0A165TLJ9_9AGAM/230-586               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--SSQKADILRALL.LL.AS..L.AVLVP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................GDRLLASIGQDI.LDCLFSPPT.................................LAPTS-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RKADTLR.PISF.FILA.....V....L..YA.........VLHT....LT.L.....L....YQTISLNV.AV..NSY.D..YSLLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLIIVAFRNLIElsgsatdwstp................................................................................mpksfllpkrfsGIP.GSVVG..TISYPVLTVL..LSE.TLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CGDLRGGWAK-----.......................................................VRVHSYVDQ.SPLAARRLGFAALPLANLAL.IIGS......QCVGL.LAaapvwevwevwt..................................................................................................svqvwagwvvvrVG.KWAV.LG.VLFWVCAVAVKLIIGINLLAYASKRR-a......................................................................................................................................................................
A0A151ZI49_9MYCE/657-1001              .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TTTQVYDLFRGFI.WI.IC..I.FFLTF....L.DS......SM.LYHYIR...GQ..AVIKLYVIYNVLEV.................LDKLCCSFGQDI.FDSLYWMSFslkqpklvysss........ssttsstsssstpN-----.-....................-............................................................................................................................................................................................................................................................................................................................................Sifnnnnn..................................nksttikGSGKRTLA.PVTH.TLVA.....L....V..YV.........LFHS....IV.L.....F....AQVITLNV.AI..NSY.N..NSLLTLLMSNQFVELKG...........SVFKKCEKENLF.QISC..........S....DIVERFQ.....VF.IYITIVSFQNLSDm....................................................................................................nwNMS.WDYTI..SVITISVTVL..GSE.VLVDGIKHAF....ITKFN..KLH..Y.D.V.YSFFF.NDL..............TKTIIDSKN------.......................................................---RNFTES.SWGITNIIGFIPFPLATVAV.RIFY......RFIPS.TN..........................................................................................................................SI.FGVI.LI.IQIYLTLLLLKLFIKIIILGICLG---hkk....................................................................................................................................................................
A0A3M0KSF1_HIRRU/208-385               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................e--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------FVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
M1VZL3_CLAP2/564-971                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SHFHKADLLQGAV.II.CS..S.FALMS....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................SDRLLSAIGQDI.LECLFSHET.................................LSRNQS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGI.FFLA.....L....V..YN.........CLHS....IT.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFDKDNLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNIVEvgafsvpgagfdsshddg...................................................................kvsvplhprsilphsftvLPS.WLNSG..EALSPFLIVV..GSE.MLVDTVKHVY....VTKFN..NIK..P.T.F.YGRTL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LMRRLGLAVIPLSCLFI.RASI......QTYHM.FLsahvpmplpastqtslmqesavpsspammaalsrf...................................................dallrdslgratygnpygsplnarpwyawnsddiiaAL.TMVV.VF.FIVFLVLLILKLLLGMVLLQYSRNRY-a......................................................................................................................................................................
J9K7S7_ACYPI/105-409                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAAETCDLLKMAV.LI.TC..S.MMLLP....W.DT......SM.MYHVIK...SQ..SVIKLYIFFNMLEV.................GDRLFSSFGQDI.LDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................TSRREHFG.VLPH.FIIA.....V....F..YV.........FLHS....IL.V.....L....CQATTLNV.AI..NSS.H..KALLAIMMSNNFVELKG...........SVFKKFDKTNLF.QLSC..........S....DVRERFH.....LF.ILLLIVVVQTMKE......................................................................................................yQWT.SESFW..ELMLDCMYVM..ISE.MLIDWTKHAF....ITRFN..EIN..L.S.V.YSDYV.LSF..............AYDTAQSRHK-----.......................................................---KAFTDH.SDLVARRMGFIPIPLGVVMI.KVLT......RCVSI.DG..........................................................................................................................RL.ASII.LL.IFTFTCLVTLKIVNLVYILGRACK---li.....................................................................................................................................................................
A0A3P6H9D0_9CEST/1-216                 ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................mlvfip--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..LA.........AAHC....LL.L.....L....AQVTTLNV.AF..NSQ.N..RSLLTVIISNNFVELKG...........NVFRKMGKSNLF.QIAC..........A....DVRERFH.....YT.VWLFIIVCRNMSA......................................................................................................sGWQ.YEDFL..ALLPDILLIF..LAE.VAVDWIKHAF....ISKFN..VIA..S.D.V.YEEYT.VSI..............AYDLLLCHQG-----.......................................................---KNTSDY.FELLARRMGLTPISLSCLIN.VMII......QTVKS.SW..........................................................................................................................--.-IYV.FL.LLALPLLFAFKVLAHIVLLNRAYT---hvq....................................................................................................................................................................
A0A182EU65_ONCOC/13-294                ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wt--ASNTCDFLKIFI.VI.VC..S.CLMTL....I.DT......SV.MYHQVR...GQ..GIIKLYIFYNMLEV.................ADKLFSSFGQDI.FDALFWSST.................................H-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SSSNFVW.MFVH.LFIA.....I....I..YT.........WLHT....IL.V.....L....LQATTLNV.AF..NSH.T..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMSC..........S....DVRERFH.....IF.TLLTVVVVRNMMA......................................................................................................vNWK.FEHFV..EMLPDLALVI..VAE.IIVDWLKHAF....ITKFN..EIP..A.E.V.YQDFT.ITI..............AFDVVRSRDE-----.......................................................---KAFSDY.SDQVSRRMGFAPIPLTIMLI.RVVT......QTFDF.TI..........................................................................................................................TS.VQLV.FC.E--------------------------llviv..................................................................................................................................................................
A0A194WB55_9PEZI/548-962               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGLV.II.CS..S.IALMN....L.DA......SR.MYHFIR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDI.FECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVML.PFGM.FLLS.....L....V..YN.........CAHA....IT.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........SVFKRFEKENLF.QLTC..........A....DVVERFQ.....LW.LVLLIIGMRNVVEvgglsvpgagvglgddpm..................................................................atakaplhsssilpmsftiLPS.WLRSG..EVLSPFLIVI..GSE.MLVDWIKHAY....INKFN..NIK..P.N.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLPLLPLSTLFI.RASF......QTYRM.FLathlpapmppstqtslsvesstasspavtaaldrldni.............................................irnalgrsiygfegdlnntttsstssfsflswstddviaLV.TMLL.VF.FIAFLVLLIVKLLLGMLLLRYSRDRY-a......................................................................................................................................................................
A0A2K6PJG1_RHIRO/96-400                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A3M2S1Z7_9HYPO/504-910               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.IV.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................SDRLLSALGQDI.LECLFSSET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PGGM.FLLA.....L....A..YC.........CLHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLLIIGMRNVVEvgglsvpgagselsfde....................................................................srtvplhnpsilphsftvLPS.WLMSG..EVLSPFLIVI..GSE.MLVDTVKHAY....VTKFN..NIK..P.G.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsthlpmpipestqtslteesaapsspamiaalnrf...................................................dtlirdslgratygypygsplnsrpwyswtsddfiaAV.TMIV.VF.FIAFLVLLILKLLLGMVLLKYSRNRY-a......................................................................................................................................................................
A0A0D7BKJ8_9AGAR/148-471               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ip--PSQKADLLRMIL.LI.TT..V.AICLP....LtDA......SK.IYHTIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRSS.................................L-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--TPTSFR.TVLY.FLLA.....T....G..YT.........VVHS....LV.A.....I....YHLISLNV.AI..NSY.D..NALLTLLVSNQFVEIKA...........SVFKKFEKEILF.QLTC..........A....DIVERFT.....LT.LMLCTVAFRNLVEltgsaahfe....................................................................................idallprsfgWAQ.AGLLW..TIGYPVIAVL..LSE.CVVDSLKHAF....ITKFN..HIR..P.S.V.YGRFM.DVL..............CRDLTSGSAVGR---.......................................................-RMHSYVDQ.SPVVARRLGFAPLPLAVLTI.LILG......QSFPP.FD..........................................................................................................................-A.LVGL.LG.LLFWLCFLGLKLILGLNLVGYATMRQ-e......................................................................................................................................................................
A0A2H3HVK2_FUSOX/478-841               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....V..YC.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNVVEvgglsvpgagsesyde......................................................................tsvphhspsilphsftvLPS.WLMSG..EVLSPFFIVI..GSE.MLVDTIKHAY....VTKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTKRLES-ATPSSPAMI.AALN......RFDSL.IRdslgratygypygsp...........................................................................................lnsrpwyswtsddfiaAV.TMVV.VF.FIAFLVLLILKLLLGMVLLKYSRNRY-a......................................................................................................................................................................
A0A287A5J1_PIG/97-401                  ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.MC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKILNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A1R1X2D8_9FUNG/330-817               .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ravrl------TSLYKIFV.FI.TT..F.ILVGS....V.DS......AQ.AYHTIR...AQ..SSLKLYFIFNSLEL.................FDKLLTSFGLDA.LDSIQYSIAk..............................iiE-YKKS.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................SSAMDVMI.SIIH.GIIG.....L....V..YM.........LLHT....LV.L.....Y....FQVLSLNV.AI..NSY.S..QQLLLLLISNQFVELKG...........NILKKFEKENFF.QLTC..........G....DIVERFQ.....EF.VFLGLIITQNLFElidsrsfgfnsts.............................................................................vshyfatmfspefLQL.DFLLN..RVLIPVFMVI..GTE.IIVDWVKHAF....IAKFN..WFR..P.Y.L.YSKYG.DIL..............CRDLVGATPA-DDIAnmnnntgvv....................................llsvpskstnGKKIEMPDL.TPKVARRMGFLPYPLAVLTM.VIVS......DSIIL.VTgnitsffsllkclkglfslfimhpffklyqfsrcglmcyidspkkdfksaficnnfcytnkiqkpdlhylintldkaklsdqelktfysnklailnsyseasssslsnhylkvyeneidinsL-.----.--.---------------------------qstcyyilfvsailvlvavlkffafeklkqyassryl..................................................................................................................................
A0A287N3P7_HORVV/286-385               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................G-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------lstcstdrvtfellrflldgaiavlaf............................................................................................................................................
A0A3Q3S7X4_9TELE/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVIMVI..ASE.VAVDIVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
M7NW34_PNEMU/219-574                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................i-KSSEKIDFLEGFL.IL.GT..C.VILQR....L.DA......SR.IYHNIR...GQ..ATIKLYVIYNVLEI.................GDRLLSAFGQDV.IESFFSKVS.................................NREGS-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-TKHYYLN.LSLY.FILA.....L....I..AN.........VLHT....TM.L.....F....YQVMTLNV.TV..NSY.S..NALLTLLISNQFVEIKG...........TIFKKFENENML.QMTL..........A....DIVERFQ.....LT.LMLSIILFRNLIEiyesrfpf......................................................................................slfpssffhFSS.YSVFF..MITTPVILVM..GSE.IFVDWLKHMF....IIKFN..HIQ..S.S.I.YSRFA.DVL..............S-DYYISCMNK----.......................................................-KKDTRIRQ.PYFISRKIGLPILPLACLMI.RASF......KICRI.FYssklftdikilsndp...........................................................................................slekiklflskdkiipIF.YGTF.IM.IILFFCLIVMKLILSTILMKLSYKYY-n......................................................................................................................................................................
A0A166X8J7_9AGAM/125-484               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-PPAQKADILRSLL.IL.VS..I.LILVP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEYLTN.K....................-............................................................................................................................................................................................................................................................................................................................................A................................................PVSSHTMR.PFLF.FSLA.....L....L..YN.........VAHA....LV.M.....V....YQLLALNV.AV..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLTVVAFRNLIElsgsefdfse...................................................................................gfvlprsfgwFRG.NNVIW..TISYPVVTVM..VSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFASLPLAVLAV.LIGH......QSLGL.MFalhsdasspwt....................................................................................................vpaltnaeivhYA.KWAI.MG.VLFWLCFVGLKVIMGVNLISYATRRR-a......................................................................................................................................................................
A0A2K5XP15_MANLE/88-304                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------la.....................................................................................................................................................................
A0A2I2FL70_9EURO/157-581               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.MI.AT..C.VVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....G..YT.........VTHA....TS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgalnfigelgtsfsgqaststnstpms...............................................tpprmassilpqsftivpssiiasfshvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.M.YHRFL.DIL..............AKDYYTN--------.......................................................----AFGDP.N--LMRRVGLPVIPLSCLFF.RVSV......QTYQM.FLtallpqqpsstaadstslssihshyapspqpslp......................................................pltlrtilpasaahagaffrqllanaiptpaqsvYI.FTAV.LL.LTGFVLLLIIKLLLGMLLLTWSRGRY-k......................................................................................................................................................................
E3QKI9_COLGM/525-933                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGAV.IL.FS..S.LFLMK....L.DA......SR.MYHFIR...AQ..DGIKLYVIYNVLEV.................GDRLLSALGQDI.FECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FILA.....L....I..YN.........VIHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLMISNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNIVEvgglsvpgagsensdlgg...................................................................sgamplhspsilpfsftiLPS.WVWSG..EVLSPFLIVI..GSE.MLVDTIKHAY....VNKFN..NIK..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVSP.S--LTRRLGLAVIPLSCLFI.RASV......QTYHM.FLstriptpipestqtslsvesatpsspvmvaaldrld..................................................tllrdalgravygypygepsvqsrawwtwtsddviaAV.TMIV.VF.FIAFLVLLIIKLLLGMVLLRYSRNRY-a......................................................................................................................................................................
A0A2Z6QQC6_9GLOM/122-486               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ln--LSQKCDLLKGLL.II.LV..C.MALQN....V.DA......SR.IYHIIR...GQ..SAIKLYVIFNVLEI.................FDRLCCSFGGDI.LDSLFSKST.................................LGKRKD.D...................sD............................................................................................................................................................................................................................................................................................................................................D................................................SNNNPDWR.AIKF.FVLA.....L....I..YI.........LIHS....IV.L.....F....YQAITLNV.AI..NSY.S..NALLTLLLSNQFIEIKG...........SVFKRFEKENLF.QLSC..........A....DIVERFQ.....LA.IFLSVITVRNLIElsgsppspf....................................................................................silpasfiplFPA.MTTVE..TLMTPVLFVL..LSE.LLVDWLKHAF....ITKFN..HIR..T.S.I.YDRYI.DLL..............SRDLVIGNPT-RNSDgi..................................................nnnVRPQKFVNQ.SPIVSRRIGFAAFPLTCFTI.SMTS......QTISM.IYdliqdmeddpk....................................................................................................nmpivnvatqpPI.IWIL.CG.ILAYVMLILLKLLVGINLLGFAHRRY-a......................................................................................................................................................................
A0A1R0GND0_9FUNG/380-684               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ylnn-----LASLYKILV.FL.LT..F.YIVGK....L.DS......AK.TYHLIR...AQ..SSLKLYFIYNSLEL.................FDKLLTSFGLDT.LDSTQYSIL.................................KLINYK.K....................-............................................................................................................................................................................................................................................................................................................................................-................................................STFFELFL.SLLH.FVIG.....L....I..YM.........IMHT....LV.L.....Y....LQVLSLNV.AI..NSY.S..QQLLLLLISNQFVELKG...........NILKKFEKETFF.QLAC..........G....DIVERFE.....QF.VFLGLIITQNFFElfdsasfgtsel..............................................................................fpryfyqlfsfesLQL.DFLLN..RVLIPVLLVI..GTE.ILVDWVKHAF....ISKFN..WFR..P.Y.L.YTKYG.DIL..............CRDLVGATPADDRLNadnvst..........................................ttvlfssPRSEPLPDL.APKVARRMGFWKTAV-----.----......-----.--..........................................................................................................................--.----.--.---------------------------ys.....................................................................................................................................................................
A0A1J7J864_9PEZI/592-925               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-------S.PFFM.FLLS.....L....A..YN.........TLHA....VS.L.....F....YQVTTLNV.AV..NSY.S..NALLTLLISNQFVEIKS...........SVFKRFEKENTF.QLTC..........A....DIVERFQ.....LW.IMLLIIGMRNVVEvggftvpgagngdats......................................................................sslpihtasilpdsftlLPS.WLLSG..EVLSPFVIVI..GSE.MLVDWIKHAY....INKFN..NIR..P.N.F.YGRIL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLPLLPLSCLFI.RASV......QTYHM.FLathlpapippstatslsvesvlpsatassqavvaaldrldt.......................................virsalgravygypfsdadgattagvgiltfwrrwnsddaiaAV.TMVV.VF.LLVFLALLVVKLVLGMGLLRYSRDRY-a......................................................................................................................................................................
A0A024TUS5_9STRA/165-335               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RSHVHDVLTAVI.MV.LS..T.AVLMQ....V.DM......SR.VYHLIR...GQ..ALIKLYVLFTMLEI.................FDKLFSSLGQDV.LDAMYFTVR.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YQPRRVGR.MMFD.FAVC.....S....I..YV.........VLHS....LL.L.....F....GQVVTINV.AI..HSS.S..SSLMTLLISNNFAELKS...........SVFKKFEEQNLF.QVAC..........S....DIVERFK.....LM.LIIGLILVQ----.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------fdgkd..................................................................................................................................................................
G3PWI8_GASAC/113-417                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.MV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FLMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVFMVV..TSE.VAVDIIKHAF....ITKFN..DIT..A.E.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......TSVKV.QG..........................................................................................................................-A.LSYS.CV.FLCYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A1B8DWD9_9PEZI/488-891               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLAAVGQDI.LECLVCDET.................................LERGLD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FVLT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsangaad...................................................................tlrnatiplrssiipnsfKII.PSWSG..EVLSPFLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FIathfppplastatsisleseataspattaameh.......................................................ldilirkalgrstygvgasveetwqlfdsddiisFI.AMAA.FF.LGAFLALLSCKLVIGMLLLRYSRRRY-e......................................................................................................................................................................
A0A3Q0KTC9_SCHMA/139-453               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lyn---YELRDLIKFSL.LC.IC..T.VILTK....Y.DS......SM.AYHEIR...TQ..SVIKIYIFFNLLEV.................ADRLLSAVCQDA.LDDLLFTISkpr..........................sdsvLSNNLE.E....................-............................................................................................................................................................................................................................................................................................................................................-................................................NSFIFWRD.VVLQ.YCFA.....F....F..CL.........IAHC....FL.L.....L....CQVTTLNV.AF..NSQ.N..KSLITVFISNNFVELKG...........NVFRKMGKTNLF.QIAC..........A....DVRERFH.....YC.VWFSIIVCRNMNE......................................................................................................sGWN.LDDLQ..TILIDVTYIL..LAE.VAVDWIKHSF....ITKFN..VIP..S.N.V.YEEYT.VSI..............AYDLLLCHQG-----.......................................................---KNTSDY.SDLLSRRMGLTPIPLSCLIN.AMLF......QTIRS.PS..........................................................................................................................--.TLCL.TL.PFVVSALFAVKVATNLTLMSMAYSH--ir.....................................................................................................................................................................
A0A1V9ZSK3_9STRA/170-473               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RSHMHDVLLAII.MT.LS..I.VVLMQ....V.DM......SR.VYHLIR...GQ..ALIKLYVLFTMLEI.................VDKLFCSLGQDV.LDAMYFTVK.................................F-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-QPRRVGR.MAFD.FAIC.....S....I..YV.........DI--....-L.F.....N....FLVVTMNV.AI..HSS.S..TSLLTLLISNNFAELKT...........SVFKKFEEQNLF.QIAC..........S....DIVERFK.....LM.LIIGLILLQSDGK.......................................................................................................---.-----..DVADGTAMVL..MAE.MLIDWIKHAF....ITKFN..QIP..P.S.V.YSKFT.TIL..............CRDVAGFRSD-----.......................................................---STIQDH.TQFVSRRLGLISLPLACVTV.RMVH......EALKD.AQtiasleg............................................................................................................dftfvisHP.AWVC.IV.LLAFLCLSAFKVLLSMLLMVHAC----isg....................................................................................................................................................................
A0A453H7S5_AEGTS/323-448               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTC-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------stdrvtfellrflldgaiavlafdilgsklccliftcpcliylhstslr......................................................................................................................
A0A2P5PYG3_GOSBA/60-256                ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................qcvg--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRFSRDNIH.SLAY..........S....DSVERFH.....IS.ACLLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLFNAFVVF..VCE.MLIDIIKHSF....LAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNIQTE-----.......................................................---------.--DCKKNLTFVPLAPACVVI.RVLT......PVYAA.HLpcsp..................................................................................................................lawrFF.WILV.LI.SMTYIMLTSLKVMIGV-----------gke....................................................................................................................................................................
A0A2U4ASQ8_TURTR/351-655               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..TSE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0P8YMH3_DROAN/174-478               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEICDLLKGVI.WI.IV..T.LIMLL....V.DT......NR.VYHIIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.MDALFWTAT.................................---EPK.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SKREHFG.VFTH.TLFT.....L....I..YV.........ILHS....GL.I.....M....FQATCLNV.AV..NSN.N..KGLLTIMISNNFVELKG...........SVFKKFDKNNLF.QLTC..........S....DVRERFH.....LS.VLLFIVVIQTMKE......................................................................................................fDWC.ITQFC..VMLPDCISVL..FTE.ILIDWVKHAF....ITRFN..ELP..E.S.I.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPFPLAVVLI.KAIY......TAVSF.KS..........................................................................................................................-L.AAWL.LF.LLAYLFAMGLRVCLTICALGKACK---lmk....................................................................................................................................................................
A0A093Y385_9PEZI/1657-2060             ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLSAVGQDI.LECLVSDET.................................LERGSD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FVLT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsvggaad...................................................................slrnatiplrssiipnsfKII.PSWSG..EVLSPFLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FIathfppplastatsislessataspattaameh.......................................................ldilirkalgrstygtdplvertwqlfdsddiisFI.AMAA.FF.LGAFLALLSCKLVLGMLLLRYSRRRY-e......................................................................................................................................................................
A0A0V1DB82_TRIBR/126-436               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................c-SPSERCDVLKIII.LI.VS..C.FLVNF....F.DT......SI.MYHMVR...GQ..AIVKLYIVFNMLEV.................ADKLFSSFGQDI.LDALFWTANe...............................pL--AGG.Q....................L............................................................................................................................................................................................................................................................................................................................................R................................................SAKQRCLK.LVPY.LVIA.....I....V..YV.........WLHA....LL.V.....L....LQATTLNV.AF..NSQ.N..KSLLTIMMSNNFVELKG...........SVFKKFARNNLF.QMAC..........S....DVRERFH.....YV.ILLGAVFVRNMSA......................................................................................................vSWR.RDDFF..DMAPDLVFVF..VAE.LLVDWVKHAF....ITKFN..EIP..A.D.V.YKDFT.ITI..............AYDVAKSRQVN----.......................................................----ALTDH.CDQVSRRMGFIPLPLSVLVF.RILS......QSFKI.EP..........................................................................................................................-A.KHWP.TL.ALVFVALLLLKLLISVVMMGKSAE---yie....................................................................................................................................................................
A0A3F2XYJ6_DEKBR/187-542               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................inky-----KNDAIFVLL.TI.FS..L.LMLTG....L.DE......SK.IYHKVK...SG..TSMKLYFMVGLLEI.................ANKLLSAVGQDI.IELLFRISI.................................LKLTKD.K....................R............................................................................................................................................................................................................................................................................................................................................I...............................................rFVHHALLK.FVLV.ALLS.....I....L..YL.........TFHS....II.M.....V....YQVMALNV.AV..NSY.S..NALLTLILSSQFSELKG...........SVFKRIEREGLF.QLVC..........A....DLNERFM.....LF.TMLLVISSRNMLQlvsngaslsslfd............................................................................nlkpnswysdltfsKSL.NDWIG..FLVGPSFVVI..GSE.ILVDWLKHTY....IIKFN..KIR..P.R.V.YRKYA.SVL..............AKDYLADFEFSHSDE.......................................................QDNHPITKDiPEILIKRTGLPVFTLCVVLF.KMTIfp.wmgF----.-Vvdse.................................................................................................................niflsVL.LVIM.IL.ILCSFLTICFKMVLSLILAEFCK----tfvs...................................................................................................................................................................
S7RS40_GLOTA/356-411                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-AASQKADILRALL.LA.AS..L.LILVP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEV.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------psvv...................................................................................................................................................................
A0A0Q9X1H0_DROWI/156-460               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEICDLLKGAI.WI.TV..T.LIMLL....V.DT......NR.VYHIIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKREHFG.VVTH.ILFT.....L....I..YV.........VLHS....GL.I.....M....FQATCLNV.AV..NSN.N..KGLLTIMISNNFVELKG...........SVFKKFDKNNLF.QLTC..........S....DVRERFH.....LS.VLLFIVMIQTMKE......................................................................................................fDWS.ITQFC..VMLPDCFAVL..FTE.ILIDWVKHAF....ITRFN..ELP..E.G.I.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPFPLAVVLI.KAIY......TAVSF.QN..........................................................................................................................-A.AAWL.LF.FLAYLFTLGLRICLTICALGKACK---lmk....................................................................................................................................................................
A0A0D2XIR8_FUSO4/478-670               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....V..YC.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNVVE.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------vgglsvpgagsesydets.....................................................................................................................................................
A0A314ZKV9_PRUYE/374-579               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................iwrf--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....I....SQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSKDNIH.SLVY..........F....DSVERFH.....IS.AFVLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLSNALLVY..VCE.MIIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNIQTE-----.......................................................---------.--ASKKNLTFIPLAPACVVI.RVLT......PVYAA.RLpysp..................................................................................................................lpwkLF.WILV.LF.AMTYVMLTSLKVLIGMGLQKHAS----cskr...................................................................................................................................................................
I1KCA1_SOYBN/279-587                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMEVSDFGCFLI.LS.SG..V.VLLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQNFNGDV.LQTLFLSAE.................................GLANCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................SMRFWIWR.FASD.QALA.....V....A..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSEDNVH.SLVY..........F....DSVERFH.....IS.SFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLINILLVY..VSE.MIIDIIKHSF....IAKFN..NIK..P.I.A.YSEFL.EDL..............CKQTLNMQTK-----.......................................................---------.--SAKKNLTFVPLAPACVVI.RVFT......PVYAA.NLppnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKVLIGMGLQKHATWY--vn.....................................................................................................................................................................
A0A182PE05_9DIPT/166-470               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAPAEICDLLKGTI.WI.IC..S.YTLLY....I.DT......NM.LYHMIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKRQHLG.TIPH.FLFA.....I....V..YV.........TMHS....VL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........S....DVRERFH.....LS.VLMLIVLIQTMKE......................................................................................................fSWK.SEQFF..VMFPDCMYVM..FTE.CLVDWIKHAF....ITRFN..EIP..C.E.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPYPLGVILV.KALY......HALSF.DN..........................................................................................................................-A.GSIV.IL.LVAFLALLSARVLNTICALGKAC----dltq...................................................................................................................................................................
A0A2P4ZTT1_9HYPO/500-905               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGAV.II.CS..S.LVLMK....L.DA......SR.MYHLIR...AQ..SAIKLYVVYNILEV.................GDKLLSALGQDI.LECLFSSET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGM.FVLA.....L....I..YC.........VLHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDSLF.QLTC..........A....DIVERFH.....LW.VMLLIIGMRNIVEvgglsipgasmsddppt.....................................................................kaaplhsasilphsftvLPS.WVMSG..EVLSPFLIVV..GSE.MLVDTIKHAY....VTKFN..NIK..P.K.F.YNRIL.DIL..............CKDYYTN--------.......................................................----AFTAP.A--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsahvpmplpistqtslteasatpsspamiaalnrf...................................................dtlirdslgratygypydhplnsrpwyrwtsddaiaAV.TMVV.VF.FIIFLVLLICKLLLGMILLKYARNRY-a......................................................................................................................................................................
S2KAD5_MUCC1/230-629                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKSSQKCDLLKGFL.II.IT..C.IVMCS....L.DP......SR.IYHSIR...GQ..AVLKLYVVFNVLEI.................CDKLCCSVGVDI.LDALFSKST.................................LGNPEQ.Gi..................gG............................................................................................................................................................................................................................................................................................................................................A................................................AYAKRQLK.PITL.FVLA.....A....G..YM.........VVHT....TV.L.....F....FQMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKKFEKENLF.QLTC..........A....DIVERFQ.....QY.AFLFIITLRNVIElsesgpssi....................................................................................lpstfvplfkLPA.TTSLN..TLMTPVVMVI..ASE.LMVDWLKHAF....ITKFN..QIR..P.T.I.YGKYI.DVL..............CKDLVIGSPG--RIS.......................................................GRHHAFVDQ.SPVVSRRIGFPVLPLACLHV.RMMQ......QILPM.MFmshnnqtantsaaaslitnsllnylmnnqgm............................................................vnqvlpariqlvvlsmvkggwlengldqlfrFI.TWTL.VV.VVLAVILLALKVVVGINLLGFAYKR--ft.....................................................................................................................................................................
A0A267EYE3_9PLAT/119-418               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--HSQKSDLLHGLL.LV.VT.tC.LIVQL....T.DS......SV.IYHFIR...SQ..SVIKLYIFFNMLEI.................ADRLLSAVSQDV.LDGLAFTIA.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................KPLESTLL.LLLN.WALS.....V....V..MV.........TLHS....CL.M.....L....LQALTLNV.GF..NSH.N..RTLLTIIMSNNFVELKG...........SVFRKFAEENMF.QLAC..........A....DIRERFH.....CA.VLLLIVLLRNMRA......................................................................................................vNWE.LSHFI..DICPDALIVL..ITE.LIVDSVKHAF....IAKFN..EMP..A.S.V.YRSFS.LRV..............ALDLRRMRSH-----.......................................................-------RQ.YLSLNRRMGLTPMPLFVLVA.MSLY......LALPEgAK..........................................................................................................................LV.NGLC.LT.VLVLPSLIVLKLIVGRFLHSLAD----kii....................................................................................................................................................................
A0A2T9YUY8_9FUNG/385-857               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ma---EEAKDIYKLFI.IS.AA..C.FFVGK....I.DA......AQ.VYHTIR...AQ..SALKLYFIYNSLEL.................FDKLCTSFGIDV.LDSIEYSFY.................................EAFEKStK....................K............................................................................................................................................................................................................................................................................................................................................R................................................TKLYKSLV.LSIH.GFLG.....L....L..YL.........VIHA....LV.L.....Y....FQVLSLNV.AI..NSY.S..QQLLMLLISNQFVELKG...........NILKKFEKENFF.QLTC..........G....DIVERFQ.....EI.VFLILIVLRNFIElvdpgsvqnlaqts..........................................................................ssyvkyiyfissansIPY.SLLYY..RVLQPVLMVI..GTE.ILVDWVKHAF....ISKYN..WMR..P.Q.I.YSRYG.DIL..............CRDLVGATAKDDVTNskphkssiss...................................sklpekheliVNADPTSDL.STKVARRIGFLPYPLAVLTL.LVVW......QSVTL.ITgpsiefsdliditkafflgdwlknvylmfswafwnigctfdqvcksmigkdh.................tfsgffkgkcdsfpnknysipgnmngkesgtfsnatthnnmgwknlylnkfesLV.YSIL.FV.LIIFLLFALCRISFRHKLKRYAARRY-l......................................................................................................................................................................
A0A0N4VBY0_ENTVE/186-498               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wt--SSDTCDFLKASI.II.VA..S.LIMQV....I.DT......SV.MYHQVR...GQ..GVIKLYIFYNMLEV.................ADKLFSSFGQDI.FDALFWTAS.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERSATLLR.TLGH.LFPA.....I....V..YA.........TFHT....VL.V.....L....LQTTTLNV.AF..NSH.N..QALIAIMMSNNFVELKG...........SVFKKFGKPNLF.QMAC..........S....DVRERFH.....IM.IILSMVVVRNMMAvnwkie...........................................................................................hlvemaPDL.VAFNI..EFTLVLAMVV..IVE.FIVDWLKHAF....ITKFN..GIP..S.E.V.YKDFT.ITI..............AYDVVRNHDE-----.......................................................---TAFSDY.SDQVSRRMGFIPIPLTIMVI.RVLT......QTFDF.TT..........................................................................................................................-T.SAFI.LL.VLSWFLVLSIKMLNGVILLGKACEY--vt.....................................................................................................................................................................
A0A4P1R2T6_LUPAN/74-528                .................................................................................................................................................................................................................................................................................................................................................................snslnsnsvsvdlkrevplengracngfelnglcysvtesvftvaaredgsefpasaregfnfgelrqraviggssedlkastvvaaaavvddggkhdgsdtvkasvvvkpnepdrnvvtklvkeesldwnrlmaedpnyvfsvekspvtyfleemhngnslrstttlgnekerervydtifrlpwrcellidvgffvcldsflslltvmptrimmtiwrflktrqfkrlstielsdfgcfvimssgviller--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....T....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRYSKDNVH.SLVY..........F....DSVERFH.....IS.AFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLINVLFVY..VCE.MIIDIIKHSF....IAKFN..DLK..P.I.A.YSEFL.EDL..............CKQTLNMQTE-----.......................................................---------.--GSKKNLTFVPLAPACVVI.RVFT......PVYAA.NLpsnp..................................................................................................................lpwrLF.WILL.YS.AMTYVMLTSLKVLIGMALQKHASW---yin....................................................................................................................................................................
A0A1B8CIV4_9PEZI/488-891               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLAAVGQDI.LECLVCDET.................................LERGLD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FILT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsangaad...................................................................tlrnatiplrssiipnsfKII.PSWSG..EVLSPFLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FVathfppplastatsisveseataspattaameh.......................................................ldilirkalgrstyvtgasvertwqffdsddiisFI.AMAA.FF.LGAFLALLSCKLVLGMLLLRYSRRRY-e......................................................................................................................................................................
A0A177U5V5_9BASI/597-770               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................tstvpfpnestasssss--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------AAAVRR.......................................................ARKHTFVDQ.SPLVARRLGFAALPLACLIV.RMTQ......QILSM.LSgdesdfdecigrrsssgagvgtgvggdgglwgsstgve..............................................fgwkwlllswrrarsgnmvpdaldaqrmgaalldgaahVV.GFTV.VF.VIPWAFLIALKLLLGMNLAAYAAQRH-a......................................................................................................................................................................
A0A044UI72_ONCVO/132-405               .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pvrll--------------.--.--..-.-----....-.--......--.----VR...GQ..GIIKLYIFYNMLEV.................ADKLFSSFGQDI.FDALFWSST.................................H-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SSSNFVW.MFVH.LFIA.....I....I..YT.........WLHT....IL.V.....L....LQATTLNV.AF..NSH.T..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMSC..........S....DVRERFH.....IF.TLLTVVVVRNMMA......................................................................................................vNWK.FEHFV..EMLPDLALVI..VAE.IIVDWLKHAF....ITKFN..EIP..A.E.V.YQDFT.ITI..............AFDVVRSRDE-----.......................................................---KAFSDY.SDQVSRRMGFAPIPLTIMLI.RVVT......QTFDF.TI..........................................................................................................................-T.SVQL.VF.CITWMLLLSLKIVNGMVVLGKACG---hvk....................................................................................................................................................................
H2XTB6_CIOIN/107-410                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-DPAQSCDLLKGVI.FT.SC..V.FCMSY....I.DT......SI.IYHLVR...AQ..TLIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALFLTAT.................................ES----.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................RQKRESFR.VLLH.LILA.....V....I..YV.........FSHA....VL.V.....L....FEATTLNV.AF..NSH.N..KVLLTIMMANNFVEIKG...........TVFKKYDKNNLF.QISC..........S....DIRERFH.....YF.ALMLVVLLRNMQQ......................................................................................................ySWN.YEHFT..EIIPNMLMLL..SSE.CVVDWFKHAF....VLKFN..HIP..I.E.S.YSEYR.ATL..............AYDVASSRHKD----.......................................................----SINDH.SDVVSRRLGFIPLPLAVLIF.HVTR......ISIDF.HG..........................................................................................................................-A.AGFL.VI.LVGYVILTLLKVFNSIVIVGKAC----cyi....................................................................................................................................................................
A0A1B8D966_9PEZI/488-891               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPYHKADILQGLV.II.FS..C.IILMQ....L.DA......SR.MYHSIR...GQ..AAMKLYVIYNVLEV.................GDRLLAAVGQDI.LECLVCDET.................................LERGLD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLQ.PLGM.FVLT.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLFTLLLSNQFVEIKG...........TVFKRVEKQNLF.QLFC..........A....DVVERFQ.....LW.LMLIIIGLRNIVEvgglsilsnpqsangaad...................................................................tlrnatiplrssiipnsfKII.PSWSG..EVLSPFLLVL..GSE.VLVDWIKHCY....VGKFN..NVK..P.V.I.YKKFL.DIL..............SKDYYTN--------.......................................................----AFVNQ.N--LTKRLGLPVIPLSCLFI.RASV......QTYHM.FVathfppplastatsisleseataspattaameh.......................................................ldilirkalgrstyvtgasvertwqffdsddiisFI.AMAA.FF.LGAFLALLSCKLVLGMLLLRYSRRRY-e......................................................................................................................................................................
A0A1S3SSM3_SALSA/44-348                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDIMKGLI.MV.LC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLQV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FIMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWS.PDHLW..VLLPDVFMVI..ASE.IAVDVIKHAF....ITKFN..EIT..A.D.V.YSEYR.ASL..............AFDLISCRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVNV.QG..........................................................................................................................A-.LSYS.CV.SLFYMGMVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A3P8ZF81_ESOLU/161-465               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGLI.MV.LC..Y.SMMHY....V.DY......SM.MYHLIR...AQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSLG.VIPH.FIMA.....V....L..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLLPDVLMVI..TSE.VAVDVIKHAF....ITKFN..EIT..A.N.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.EG..........................................................................................................................A-.LSYS.CV.FLFYLGLVTLKVLNSIVLLGTSC----vyvk...................................................................................................................................................................
A0A0B2VLR8_TOXCA/91-392                ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wt--TADTCDFLKAAI.VV.FA..S.FLMQI....V.DT......SV.MYHQVR...GQ..GVIKLYIFYNMLEV.................ADKLFSSFGQDT.LDALFWTAT.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERASNPFR.TLTH.FLAA.....V....V..YA.........LLHT....LL.V.....L....LQATTLNV.AF..NSH.N..QALLAIMMSNNFVELKG...........SVFKKFGKPNLF.QMSC..........S....DVRERFH.....IM.ILLSVVVVRNMMA......................................................................................................vNWK.LDHLV..EMLPDLAMVV..IAE.LMVDWLKHAF....ITKFN..EIP..A.E.V.YRDFT.ITI..............AYDVVQSRDED----.......................................................----AFSDY.SDQVSRRMGFIPIPLTIMLI.RVLT......QSLTL.TT..........................................................................................................................-K.PALL.LF.GMAWFLLLTVKILNGIIMLGKACEY--vt.....................................................................................................................................................................
A0A3Q3VV93_MOLML/102-406               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NC.ILLLIVCLRNMEQ......................................................................................................fSWN.SDHLW..VLFPDVVMVL..GSE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYK.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVM......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----mfvk...................................................................................................................................................................
A0A3N4IKI2_ASCIM/416-796               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPQHKADILRGLL.VF.CS..C.WCLMT....F.DA......SR.MYHSIR...GQ..AAIKLYVIYNVLEM.................ADRLFSALGQDI.LELLFCADT.................................LERKEN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PFLT.FLLA.....L....G..YT.........VAHS....TI.L.....F....YEVVTLNV.AV..NSY.S..NALLTLLMSSQFVEIKS...........TVFKKFEKESLF.QLVC..........S....DIVERFQ.....LW.LMLVIILMRNVVEmsvrssggnilgs.............................................................................lkqastaalpksfTTF.PEWTG..QLMGPFIMVL..GSE.MIVDWLKHAF....INKFN..IMR..P.R.L.HSRFL.DVL..............CKDYYTN--------.......................................................----AFGDQ.N--LTKRIGLPVIPLACVFI.RASI......QTYQM.VItnhlpsptvhpalqkattilssnvtnp....................................................................ttantptniflspfsalspllssysssPL.PSIT.FA.LATFLAFLGLKLALGLVLLNFARSRYK.......................................................................................................................................................................
A0A3Q1D1Z5_AMPOC/168-476               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHMIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVFMVV..TSE.IAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................VSNGLSFSH.HHHYPPINSTEPTQLINSLI.RVVM......SSVKV.QG..........................................................................................................................-A.LSYS.CL.FLFYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A2P5HTY9_9PEZI/560-993               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGLV.II.CS..S.VALMN....L.DA......SR.MYHFIR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDI.FECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVML.PFGM.FLLS.....L....V..YN.........CAHA....VT.L.....F....YQVIALNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........SVFKRFEKENTF.QLTC..........A....DVVERFQ.....LW.LVLLIIGMRNVVEvgglsvpgagielgddgia.................................................................saakgplhnpsilpmsftiLPS.WLWSG..EVLSPFLIVI..GSE.MFVDWIKHAY....INKFN..NIK..P.N.F.YSRIL.DIL..............CKDYYTNVSVMADLRvp...................................................qsNNPQAFVAP.S--LTRRLGLPLLPLSTLFI.RASF......QTYHM.FLathlpvplppstqtslsvesstpsspavtaaldrledfi...........................................rnalgrsvygldegflangtgahsttmlswltwssddaiaLV.TKVL.VF.FIAFLFLLILKLLLGMLLLKYSRDRY-a......................................................................................................................................................................
A0A1R1XPR4_9FUNG/330-817               .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ravrl------TSLYKIFV.FI.TT..F.ILVGS....V.DS......AQ.AYHTIR...AQ..SSLKLYFIFNSLEL.................FDKLLTSFGLDA.LDSIQYSIAk..............................iiE-YKKS.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................SSAMDVMI.SIIH.GIIG.....L....V..YM.........LLHT....LV.L.....Y....FQVLSLNV.AI..NSY.S..QQLLLLLISNQFVELKG...........NILKKFEKENFF.QLTC..........G....DIVERFQ.....EF.VFLGLIITQNLFElidsrsfgfnsts.............................................................................vshyfatmfspefLQL.DFLLN..RVLIPVFMVI..GTE.IIVDWVKHAF....IAKFN..WFR..P.Y.L.YSKYG.DIL..............CRDLVGATPA-DDIAnmnnntgvv....................................llsvpskstnGKKIEMPDL.TPKVARRMGFLPYPLAVLTM.VIVS......DSIIL.VTgnitsffsllkclkglfslfimhpffklyqfsrcglmcyidspkkdfksaficnnfcytnkiqkpdlhylintldkaklsdqelktfysnklailnsyseasssslsnhylkvyeneidinsL-.----.--.---------------------------qstcyyilfvsailvlvavlkffafeklkqyassryl..................................................................................................................................
Q0CJR2_ASPTN/523-947                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHA....TA.L.....F....FQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafsffgrlgtsfssnpststnstpls...............................................tpprtassilpqsftivpssiiasisnvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallphqpsstavestslssihshyvpsplpspt......................................................plslrtivpvsiahadaffrqllanampspaqsvYI.FTVV.LL.LTGFVLLLIFKLLLGMLLLTFARSRYK.......................................................................................................................................................................
A0A401GGB7_9APHY/219-581               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.LV.TT..I.VALAP....LtDA......SK.LYHFIR...GQ..DSIKLYVIFNALEI.................ADRLCASIGQDI.FDCLFSRST.................................MEIISH.R....................-............................................................................................................................................................................................................................................................................................................................................K................................................PPTSYILR.PVLF.FVLA.....V....I..YN.........MAHT....LV.M.....I....YQMISLNV.AV..NSY.D..NALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFS.....LM.LMLCVVAFRNLIElsgssfnfsd...................................................................................gfalpksfgwFRG.NNVIW..TISYPVLTVM..VSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVGRRRG.......................................................ARKHSYVDQ.SPLVARRLGFASLPLAVLAI.LTGT......QSINL.LIsmhtdgsspwtr..................................................................................................plsqlstdeiinIA.KWAA.LC.VSFWLCFVVVKIITGVHLLSYATRRR-a......................................................................................................................................................................
V3ZUJ8_LOTGI/90-393                    .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-ESAQICDLLKGLV.FV.SC..C.CIVNY....I.DT......SM.MYHLVR...GQ..AVIKLYVLHNMLDV.................ADKLFSGFGQDI.LDAMFWTAT.................................E---P-.-....................-............................................................................................................................................................................................................................................................................................................................................R................................................DRKREHVG.TLPH.FLLS.....I....I..YV.........IIHT....LI.I.....L....FQAAVLNV.AF..NSH.N..KALMTIMMSNNFVEIKG...........NLFKRLDRNHLF.HISC..........G....DIKERFH.....WA.LLLSIVFIRNMTE......................................................................................................fSWN.PDHVW..VILPDALLVF..VAE.FVVDWIKHAF....VTKFN..KIP..S.E.V.YQEFT.YNL..............ATDMISSRQK-----.......................................................---SAFTDH.SDLLSRKMGFTPIPLGCLLV.RVCS......KSFKI.SG..........................................................................................................................-I.LGIA.LL.IILYCCLFTSKILISIVLLGYGTK---ll.....................................................................................................................................................................
A0A1L9R6K4_ASPWE/607-1033              ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.AT..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFWL.FLLA.....L....A..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnffgtlglgstlggfsststnstpl.............................................stpprtsssilpqsftifpsslissfskvNGF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.M.YGRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLaallpqhpsstaveatslssihshyvpspmpsap......................................................pltlrtiipssaahvsaffrsvlanamptpaqsvYI.FTVV.LI.LTVFIVLLIMKLLLGMGLLAYSRSRYK.......................................................................................................................................................................
C4M0T8_ENTHI/120-425                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ihy---KRIYDILMYLS.TL.FC..V.IIIYQ....V.DI......GF.VYHYIR...AE..SVLKLYALYNALGM.................LNSLLSAFTFDI.HSSLLISIK.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--NKKMSD.SILF.FILT.....V....F..IT.........LLHS....FN.L.....F....FYIMALNV.AI..NSK.G..HALLALLVSNNILELKS...........SVWKRMFPENVF.QVLC..........A....DILELFE.....LF.SFVILLSLSNFGYye..................................................................................................wdiESN.PDLLI..SMIYSLFLIL..LAE.VIIDSLKHMF....IGKFN..NIP..L.S.I.YDKGK.FVL..............LNDLISTQDG-----.......................................................LFKIPSLDS.TSTSARRLGMPAVPLSVLFI.CFGL......ETIPP.SH..........................................................................................................................--.FNLL.FI.ISLLLILYLFKILLAIALRYLAFTE--vt.....................................................................................................................................................................
A0A453H7S9_AEGTS/21-329                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQP------.......................................................---------.-DDRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrIF.WILL.WS.VLTYFMLAIFKILVGLILRCLATW---yin....................................................................................................................................................................
A0A444ZWU0_ARAHY/341-547               ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fhpeme--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....IQAITLSA.CM..VAH.N..NALPAMLVSNNFAEIKS...........YVFKGYNKDNVR.SLVY..........F....DSIERFH.....IS.ALILFVLAQNILE.......................................................................................................-AE.GSWLG..SFLINILLVF..LCE.MAIDIIKHSF....IAKFN..NIK..P.I.A.FSEFL.EAL..............CKQTLNIETE-----.......................................................---------.--DAKKNLTFVPIAPACVVI.RVLT......PVYAA.NLpynp..................................................................................................................lpwrLF.WIML.FS.AMTYIMLTSLKVLIGMILQKHATWY--in.....................................................................................................................................................................
W4GDR1_9STRA/142-441                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RSHVHDLLTAVI.VI.LS..T.GVLMQ....V.DM......SR.VYHLIR...NQ..ALIKLYVLFTMLEI.................FDKLFSSLGQDV.LDAMYFTVR.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YQPRRVGR.MMFD.FAVC.....S....I..YV.........VLHS....LL.L.....F....GQVVTINV.AI..HSS.S..SSLMTLLISNNFAELKS...........SVFKKFEEQNLF.QVAC..........S....DIVERFK.....LM.VIIGLILVQVDGK.......................................................................................................---.-----..DVADGTFVVL..AAE.MLIDWIKHAF....ISKFN..QIP..P.S.V.YSKFL.TVL..............CRDVSGYRSD-----.......................................................---TTFLDH.SQFVSRRLGLISLPLACVVL.RMLF......KALRD.FDlws....................................................................................................................qlyTP.SGMS.IA.LLGFANLSAFKVLLSLWLMVHSTT---sgr....................................................................................................................................................................
A0A1Y2FJ93_9FUNG/275-663               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fki---RHESDLLKGLL.IL.FC..C.IFMQY....I.DV......SR.LYHFIR...GQ..NIVKLYLIYNTMEV.................FDKLCSAFGHDV.LDSLFAENI.................................IKKSNQ.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................----SRFP.VIVH.FIVA.....L....T..YL.........ILHT....IV.L.....F....YLVVSLNV.SI..NSY.N..NALLSFLISNQFGEIKS...........SVFKRFERENLF.QLTC..........A....DIVERFQ.....IL.VFLVIITGRNFLEltgtgaetlshfytlfsksilspasfsswvpk.......................................vdilqtfqssnfpefcekivnllvtkftnfmnSST.YQLLA..VLITPVVVIY..GSE.IFVDYLKHTF....ITKFN..QIK..P.N.V.YTKYR.DSL..............CKDFAAPDHN--KKK.......................................................YSDNQILDR.SNYVSRRIGLVTLPLACLTI.RILN......QTLKM.FGylyidgdrfhsfsihnf.......................................................................................yhddgtlntkyaklafinFF.TLFV.FF.FF-------------------------iyiw...................................................................................................................................................................
A0A0L0FQH4_9EUKA/36-342                .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SNNQQCDILRLII.VV.VV..S.TFLQM....L.DA......SK.LYHMIR...SQ..DTIRLYVIFNVLEI.................LEKYCSWLGQDI.LDALFSRQR.................................A-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.-KRV.FIVA.....I....G..YT.........ILHS....LV.C.....F....CQVMALQV.AI..NSY.N..RALLTMLVSNQFVEVKG...........NVFKKYGREQVY.RIAC..........Y....DIVERFY.....LI.TFLVLIAMRNLKE......................................................................................................lDWS.WYQLD..REAYLFLGVM..MSE.VGVDWIKHAF....LSKFN..GFS..W.V.V.YQDLR.NDL..............AQEFVLSYAVDTQAAl....................................................stSHKRKFIDQ.THLVSRRIGFVGLPIACVFV.RITM......QSTPV.IP.........................................................................................................................sGM.TGVL.LG.LLVWLCLLMVKVISSITILGASCQ---lvq....................................................................................................................................................................
R9ARA3_WALI9/94-454                    .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-NASQKSDILKLTL.FL.LL.sT.FLLLY....T.EP......SR.MYHGVR...GQ..DNVKLYVIFNALEI.................ADRLCCSIGQDI.LDTLFSRAS.................................L-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-TQAPTTT.LVVY.LLLA.....L....V..YG.........IAHS....LV.F.....L....YQLVALNV.AV..NSY.D..NALLTLLISNQFVEIKG...........SVFKRFDKESLF.QITC..........A....DIVERFQ.....LM.LMLGVIAFRNLIElsgsdf..........................................................................................tylpsafIRS.NTQLE..MIFSPVLLVI..MSE.MAVDWLKHAF....ITKFM..HIR..P.S.I.YARFI.DLL..............AGDLVPESVGRKGRSl.....................................................sSGSSSPGGL.SARISRRLGFASIPMGAFVV.RVSV......QALGM.LNdsstidecapsshsngm.......................................................................................sqdvahelthsishvtlqWC.LRLL.VG.VVAWLVLLAVKLLLGVRLHALALHRQ-t......................................................................................................................................................................
A0A1S3D001_DIACI/3-162                 ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ilm--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.-QTC..........S....DIRERFH.....LF.VLMLIVVLQTMKE......................................................................................................lNWA.GDRLW..MLIIDCIFVL..LAE.VLVDWLKHCF....ITKFN..ELP..F.H.V.YQDYT.LSL..............AYDMAQTRQKN----.......................................................----AFIDH.SDLVARRMGFIPLPLGVVMI.RVLM......QSLRI.HG..........................................................................................................................-P.VSVL.LV.LLAYSCLFTARICNNIIILGKAC----cli....................................................................................................................................................................
A0A3Q0H579_ALLSI/39-343                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDIFKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLLPDVCMVI..GSE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYA.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A194PM24_PAPXU/138-441               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKPAETCDVLKGFI.LL.IC..S.ILMCY....I.DT......NM.MYHLVK...SQ..SVMKLYIFYNMLEV.................GDRLFSAFGQDI.IDALFWTAT.................................E---PR.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DRRREHLG.VIPH.FIFA.....M....T..YV.........FLHS....LL.V.....L....FQATTLNV.AF..NSN.N..KSLLMIMMSNNFVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERLH.....LS.VLLFIVVLQTMKE......................................................................................................yLWR.EDRFW..ILAPDCVLVL..TFE.VIIDWVKHAF....ITRFN..EIP..Y.G.V.YREYT.VSL..............AYDVAQTRQKY----.......................................................----AFSDH.SDLVARRMGFIPLPLGVVIT.RVLV......HAVKI.DG..........................................................................................................................-F.AAMF.LI.ILAYLCLITVRVLISIVILGKAC----ali....................................................................................................................................................................
A0A072VA13_MEDTR/287-533               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMELSDLGCFII.MS.FG..V.ILLQR....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTSFHSAE.................................GLASCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMRFWLWR.FVCD.QALA.....V....-..--.........----....--.-.....-....--AITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSKDNVQ.SLVY..........F....DSVERFH.....IS.AFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLTNILLVY..VCE.MVIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNLQTEGVK--.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------knltfvplapacvvsinefh...................................................................................................................................................
A0A2H9TFG8_9FUNG/8-50                  ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ldldyvly--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..GLVTPLGLVF..FSE.ILVDWLKHSF....ITKFN..HIH..P.D.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------gt.....................................................................................................................................................................
U5HJK1_USTV1/362-736                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................mrl---SHKCDLAKAAI.FV.LA..M.IALHR....ItDA......SK.MYHSVR...GQ..DTIKLYVLFNVLEI.................ADRLCCSFGQDL.QDSLFSRQT.................................LGRRTD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SHPRIR.PLAL.FGLT.....V....V..YV.........VAHT....LV.L.....F....YQLVTLNV.AI..NSY.S..NALLTLLLSNQFVEIKG...........SVFKKFEKENLF.QLTC..........A....DVVERFQ.....LG.IMLFIIALRNLVElsstaaiplfpf..............................................................................lasfptslsklptPSS.LALLQ..TIFSPAIVVL..MSE.CFVDWLKHAF....ITKFN..HIR..P.Q.V.YGRFI.DVL..............CKDLVVGAKGT----.......................................................RREQPFVDQ.SPVVARRLGFAALPLGCLVV.RVIA......QAFEM.LVddsaidecampstnsmnst....................................................................................ggsvlksggveegwgdlrgWA.VIAL.VV.LIGWICLVALKLLIGINLRSFASER--wa.....................................................................................................................................................................
A0A2T3B1M7_AMORE/356-753               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSSNHKADLLQGAV.II.CS..C.IILMK....L.DA......SR.MYHSIR...GQ..ATIKLYVIYNVLEV.................CDKLFSALGQDI.FECLFSVET.................................LGRDLH.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVIR.PLGM.FILA.....L....I..YN.........VIHA....TA.L.....F....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........SVFKKIEKDNLF.QLTC..........A....DVVERFQ.....LW.LMLMIIALRNIVEvgglsivnngisgaef......................................................................vkesvpirtnsilpvsfTIL.PSWAG..EVLSPFLLVI..GSE.MLVDWVKHAY....INKFN..NVK..P.A.I.YQRYL.DIL..............GKDYYTN--------.......................................................----AFVNQ.N--LVKRLGLPVIPLSCLFI.RSSV......QTYHM.FLatnlpapipstatelsataspattaalehfdn..........................................................iirkalgrsalgipdpasttpwylpsaddaiaAV.AMLV.FF.LGAFFVLLACKLVLGMLLLRFARNRYR.......................................................................................................................................................................
A0A3B4AYD1_9GOBI/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................SL.-SFM.CV.FLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
A0A445C2G7_ARAHY/301-380               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAMELSDFGCFLI.MS.CG..V.ILLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTFFHSA-.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------eglascppe..............................................................................................................................................................
A0A3M6USH3_9CNID/314-491               .......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................qtlchlq--------------.--.--..-.-----....-.--......--.------...--..------------HI.................ADRLFSSVGQDI.LDALFWTAT.................................EPRDRR.R....................E............................................................................................................................................................................................................................................................................................................................................H................................................IGIIPHFA.MAVV.YLFA.....L....I..LL.........VFHA....VL.V.....L....FQAICLNV.AV..NSH.N..KALLVIMVSNQFVELKG...........SVFKRFEKNNLF.QMAC..........S....DIRERFY.....YI.VLVVIVTLRNLTEfnwna............................................................................................atqyvkQ--.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------kqdletnnrqhsnqastqklktqasvtll..........................................................................................................................................
A0A1J6JT76_NICAT/5-162                 ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................naqs--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........Y....DSVERFH.....IS.AFLLFVLAQNLLE.......................................................................................................-AD.GPWFE..SFLCNAFVVY..VSE.MTIDIIKHSF....IAKFN..NIK..P.I.A.FSEFL.EDL..............CKQTLNIQTE-----.......................................................---------.--NMKNNLTFVPLAPACVVI.RVLR......PVFAA.HLpynp..................................................................................................................lpwrLF.WIFL.LS.AMTFVMLASLKVMISIGLKKHARWY--in.....................................................................................................................................................................
B0D1B5_LACBS/230-591                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRALL.LI.IS..L.LILNP....LtDA......SK.IYHAIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDSLFSRSI.................................LEPLSH.R....................-............................................................................................................................................................................................................................................................................................................................................I................................................PVTTDTFR.PFFF.FFLA.....T....L..YN.........VAHA....LV.M.....V....YQLIALNV.AI..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLCIVAFRNLIElsgtefdfte...................................................................................gfilpksfgwFRG.NNVLW..TISYPVVTVM..ISE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERFT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTFVDQ.SPLVARRLGFASVPLAALAI.LVGS......QSISL.MFsansdftspwtw..................................................................................................tvwslsnaeiahYL.TWAA.MG.VLFWLCFVVIKVIIGVNLISYATRRR-s......................................................................................................................................................................
E3S743_PYRTT/466-872                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPSHKADILKGLL.VI.AS..C.FVLMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAVGQDV.LECLFSRET.................................LDRNPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PLGM.FVLA.....L....A..YT.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DVVERFQ.....LW.LMLLIIAMRNVVEvgglsiqssdtswtamftg................................................................sanassgtafkassiipmsfTIF.PKYIA..QVLNPFLLVL..GSE.MFVDWLKHAY....ITKFN..QYK..P.E.V.YSKFF.DVL..............AKDYYSN--------.......................................................----AFADA.D--LTRRLGLPVIPLSCLFI.RAAI......QTYHM.FIamhmppplhatstsltsdptsspvttaalahid.......................................................hvfrralgrssfgagipsqvwynpfsynlddliaGS.TMLI.VF.LIIYLMLLAFKLVLGMFLLSVSRKRY-h......................................................................................................................................................................
C9SYQ1_VERA1/429-836                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSMHKADILQGAI.IL.FS..S.TFLMN....L.DA......SR.MYHVIR...GQ..DAIKLFVIYNVLEV.................GDRLLSALGQDI.FECLLSTEA.................................LSRNKS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLL.PFGL.FLLA.....L....V..YN.........CIHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEVKS...........TVFKRFEKDNLF.QLTC..........A....DITERFQ.....LW.LMLFIIGMRNVVEvgglsipgaglsgdlkv....................................................................pstkpqhspfilphsftvLPS.WLWSG..EVLSPFLIVI..GSE.ILVDTIKHAY....INKFN..KIR..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVRP.S--LTRRVGLATLPLACLFI.RASV......QTYHM.FVstrvaapiirstqtslseesatpsspamtaaldrld..................................................sllrdalgravygqqasgssngkaswfswstddviaAV.TMLV.VF.FIAFLVLLVFKILLSMILLRYSRDRY-a......................................................................................................................................................................
A0A2H3F3F4_9HELO/451-501               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSSYHKADLLQGAV.IM.CS..C.IILMR....L.DA......SR.MYHSIR...GQ..SAIKLYVIFNALE-.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------f......................................................................................................................................................................
A0A2P6R3I6_ROSCH/281-575               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELSDFGCFTI.MA.CG..V.ILLEQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTLFNSAD.................................GLASCP.T....................-............................................................................................................................................................................................................................................................................................................................................-................................................---ENMRF.W---.----.....-....-..-I.........WRFT....CD.Q.....A....LAAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRYSKENIH.SLVY..........F....DSVERFH.....IS.AFIIFILAQNILE.......................................................................................................-AE.GPWFE..SFLFNAGVVF..VCE.MIIDIVKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNI--------.......................................................--------Q.PETAKKNLTFIPLAPACVVI.RVLT......PVYAA.HLpcsp..................................................................................................................lpwkLF.WILV.LF.AMNYVMLTSLKVLIGMGLQKHASWY--vn.....................................................................................................................................................................
E9EQG6_METRA/501-908                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.FALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSNET.................................LSRNPS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGM.FILA.....L....I..YN.........CLHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNIVEvgafsvpgagfdsthedg...................................................................ssavplhppsilphsftvLPS.WLRSG..EALSPFLIVV..GSE.MLVDTIKHAY....VTKFN..NIK..P.N.F.YGRTL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLAVIPLSCLFI.RASI......QTYHM.FLathvpmpippstqtslteesavpsspamiaalsrf...................................................dalirdslgratygypygsplnsrpwyswtsddliaAL.TMVV.VF.FIVFLVLLILKLLLGMVLLQYSRNRY-a......................................................................................................................................................................
A0A3P6P9A6_CAEEL/1-182                 ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..------MMSNNFVELKG...........SVFKKFAKANLF.QMAC..........S....DVRERFH.....IF.ALLFVVMIRNMTA......................................................................................................vNWN.IDSFT..EMIPDIIMVV..GCE.YFVDWLKHAF....ITKFN..EIN..A.E.V.YKDFT.ITI..............AFDVIRSRDQ-----.......................................................---SAFSDY.SDQVSRRMGFIPIPLSIMII.RVLS......QTFTL.DN..........................................................................................................................-W.GSCI.IF.GIGWLLVFAVKICNGVVMLGQACHH--vk.....................................................................................................................................................................
A0A2A2J735_9BILA/244-547               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................w-TSAETCDLLKVGI.IL.FA..S.LLVQK....I.DT......SV.LYHQVR...GQ..GVIKLYIFYNMLEV.................ADRLFSSLGQDV.LDALFWTAN.................................E-----.-....................-............................................................................................................................................................................................................................................................................................................................................R................................................FHVRNIFR.TLFH.FVAA.....I....I..YA.........AIHA....FL.V.....L....LQATTLNV.AF..NSH.N..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMAC..........S....DVRERFH.....IM.ALLFVVMVRNMMA......................................................................................................vNWN.LEQFG..NMLPDIMMVV..GAE.LLVDWLKHAF....ITKFN..EIN..S.E.V.YKDFT.ITI..............SFDVVRSRDS-----.......................................................---SAFSDY.SDQVSRRMGFIPIPLSIMLI.RVLS......QTFTI.SN..........................................................................................................................-R.TSII.IC.VIAWFLMLMVKICNGIIMLGQACQH--vs.....................................................................................................................................................................
A0A364NHG8_9PLEO/555-963               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPSHKADILKGLL.VI.AS..C.FVLMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAMGQDV.LECLFSRET.................................LDRNPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PLGM.FTLA.....L....L..YT.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DIVERFQ.....LW.LMLLIIAMRNVVEvgglsiqssdtswtamftg................................................................sanassatafkassiipmsfTIF.PKYIA..QVLNPFLLVL..GSE.MFVDWLKHAY....ITKFN..QYK..P.E.V.YSKFF.DVL..............AKDYYSN--------.......................................................----AFADA.D--LTRRLGLPVIPLSCLFI.RAAI......QTYHM.FIalhmpaplhatstsltsenptsspattaalvhid.....................................................hvfrralgrssfgaglpskawyhhpfsytlddliaAS.TMLI.VF.LVIYLFFLAFKLLLGMFLLSVSRKRYR.......................................................................................................................................................................
A0A3B3TRT5_9TELE/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDMLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHS....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..MLFPDVFMVV..MSE.VAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGMVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
C1EEN9_MICCC/111-460                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ya--REHLSDSLWLFM.LL.AA..F.AAAKL....V.DV......SV.VYHYIR...GQ..EVIKLYLACSVLEC.................FDKLCCAFNCHV.LDALQNSVYil............................vntAQEDCS.-....................T............................................................................................................................................................................................................................................................................................................................................A................................................ELINATFQ.LAFD.AALT.....L....A..AT.........CAHA....MI.M.....L....THAVTLSV.AI..NSH.T..NAMLLVLISNNFGEIKS...........HIFKKMDAAKLF.SVAR..........L....DIVERVH.....LS.ICLVFVAAQRVTAa.....................................................................................................gSVA.GGLTR..KMLKDSLMVL..SSE.IVVDVFKHAF....MSKFN..NIR..P.R.V.YRGFL.RQL..............CREHVKL--------.......................................................-------AQ.SYRLHRVVGFVPLAPAAVLM.KVLP......DLYRT.LFpsnssgdfdsgfmdeatpaaa................................................................................gggggwfgnmrleagilglvpDP.SSFA.AY.VLFFALLVAFKLAFGVALH--------wlgahm.................................................................................................................................................................
A0A445C2H6_ARAHY/482-638               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................hnkp--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....DSIERFH.....IS.AFILFVLAQNILE.......................................................................................................-AE.GPWFE..SFLSNVLLVY..VCE.MIIDIIKHSF....IAKFN..DIK..P.I.T.YSEFL.EDL..............CKQTLNM--------.......................................................--------Q.TEGVKKNLTFVPLAPASVVI.RVLT......PVFAV.NIppnp..................................................................................................................lrwrLF.WILL.FT.AMTYVMLTSLKVLVGLGLQKHATWY--vn.....................................................................................................................................................................
A0A0M8N8C3_9HYPO/5-413                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STFHKADLLQGAV.II.CS..S.LVLMR....L.DA......SR.MYHLIR...AQ..SAIKLYVVYNILEV.................GDRLLSALGQDI.LECLFSAET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FVLA.....L....G..YS.........CLHS....VA.L.....Y....IQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFERDNLF.QLTC..........A....DIVERFH.....LW.VMLLIIAMRNIVEvgglsipslnyermsdss..................................................................psnttplhppsilphsftvLPS.WIMSG..EVLSPFLIVV..GSE.MLVDSIKHAY....VTKFN..NIK..P.K.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFSAP.A--LTRRLGLAVIPLSCLFI.RASI......QTYHM.LLsahvpmpfpqstqtslaqesavptspammaalnrl...................................................dvlirdslgratygypygsplnsrpwyrwtsddviaAL.TMVV.VF.FILFLVLLIIKLLLGMALLKYSRDRY-a......................................................................................................................................................................
A0A453H7R8_AEGTS/1-286                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.--..-.-----....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQP------.......................................................---------.-DDRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrIF.WILL.WS.VLTYFMLAIFKILVGLILRCLATW---yin....................................................................................................................................................................
A0A3B4WRW5_SERLL/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
A0A401PLA8_SCYTO/88-392                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKAVI.MI.IC..F.VMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................KKKRAHIG.VIPH.FFMA.....V....L..YV.........FLHT....IL.V.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIRERFN.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.MAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDTVSRRMGFIPLPLAVLLS.RVIT......SSTKI.QG..........................................................................................................................-A.LAIV.SL.LVFYFGLIALKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A074RT21_9AGAM/229-578               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRVLI.LI.LA..I.SILAP....LtDA......SK.IYHSIR...GQ..DNIKIYVIFNALEI.................ADRLCTSFGQDI.LDCLFSRST.................................LLVLTY.R....................-............................................................................................................................................................................................................................................................................................................................................L................................................PLTAQTLR.PFLY.FGLA.....S....C..YL.........VLHS....LV.L.....V....YQLISLNV.AI..NSY.D..NALLTLLISNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFQ.....LS.LMLLAVALRNMIElssdsfdmest................................................................................vlpqsfkvnflsGIG.GGTIW..AIFSPVLTVL..LSE.IVVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLLASGSGR---S.......................................................SHKNTYVDQ.SPLVARRLGLATLPLAVLVL.LIGS......QSAEL.ALavygw...............................................................................................................nwtwerTT.QCAV.LG.VLMWLCLVTIKLMLGVNLLVYATSRRK.......................................................................................................................................................................
A9UYW0_MONBE/129-433                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fa--RRDIFPLVQFLL.LI.TG..C.WLLTK....A.DL......SY.IYHNIK...TQ..STVKLYVIVNMFEV.................LDRLATAMGMDI.MLSLSGALE.................................S-----.-....................-............................................................................................................................................................................................................................................................................................................................................T................................................FSASNVRN.ILLL.AAGV.....F....I..YL.........FVHI....FV.I.....L....YQVIALSV.AI..NAH.D..ASLLAILLSNQFIEIKG...........AVFKRVDATGHF.QFIC..........Y....DLRERFL.....LI.MILVMIATRNLAEv.....................................................................................................nWNV.HHLTD..WLIYKIVFVM..SSE.MVVDTIKHTF....LMRFN..DMP..T.S.V.FHDFE.AQL..............CRDLVEGQEL-----.......................................................----SAPLR.SRKLEYRLGFTPLPIACLLW.KYLS......VVLPD.LP..........................................................................................................................WH.YWLI.IL.PPVLGIALVIKVINRSLLHRYAAWR--le.....................................................................................................................................................................
A0A1E3Q0D5_LIPST/135-498               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQQSQKIDIVKGVI.LV.GT..V.YLLSG....L.NA......SI.LYHNIR...GQ..SAVKLYVMFNVLEI.................GDKLFCSLGQDI.TEVLFSNNT.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--LQKPIR.LYFF.IIVS.....I....F..YN.........LLHA....AA.L.....F....CQMITLNV.AV..NSY.S..NALLTLLLSNQFGEIKS...........TVFKKFERENLF.QLTC..........A....DISERFQ.....LW.VMLLIIGLRNIVEisasst..........................................................................................giipqswKGM.NTILG..AFCGPAIVVL..GSE.VCVDWLKHSY....IAKFN..KLK..P.K.V.YNRFL.DVF..............CRDLLRN--------.......................................................----GL-SG.QTNLTKRIGVPLIPLVCVFV.KSTT......QTAQL.IIsnhsfqiptrtvaafvpgyddgnelasp..................................................................satgygsnksasalvleyatsymmstieIS.LYLG.IL.LAIFAIFVLLRLVLGTMLLEYCFHR--ld.....................................................................................................................................................................
A0A2D0RJD0_ICTPU/58-362                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDLLKGLI.MV.LC..C.SMMHY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E---PK.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................SRKRSHIG.LIPH.FIMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NC.ILLLIVCLRNMEQ......................................................................................................fSWN.SDHLW..VLLPDVFMVV..ASE.VAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFELVSSRQQY----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLVI.RVVM......SSVKI.QG..........................................................................................................................A-.LASV.SL.LLFYLGMITLKVLNSIVLLGKSCHY--vk.....................................................................................................................................................................
K1VHZ3_TRIAC/321-633                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ip--PAHVQSLMRMAL.IV.IP..A.IILLC...gT.DT......SK.MYHSVR...GQ..DTIKLYVIFNALEI.................GDRLCCAFGQDV.IDTLFARDT.................................LTYTDK.R....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RKRDHVR.PVFF.FTLS.....L....A..YV.........FVHT....LI.F.....F....YMLISLNV.AI..NSY.D..YTLISLLISNQFVEIKG...........Y-----------.----..........-....-IVERFQ.....LG.LMLVVISLRNMIE.......................................................................................................M--.-AGSD..LAFLPRSFVR..GKS.LLERILSHAF....IAKFN..HVR..A.T.V.YGRFT.DIL..............AKDVLLAGTYKT---.......................................................--EGRNKKK.SPLVSRRLGIANIPLAVLVV.RIGA......QIFGM.LTssghavdgea.....................................................................................................lssglfwtalkWV.IGIL.VT.ATAWGCLVVVKLLLGLGLLSYSALR--qa.....................................................................................................................................................................
A0A3B3SXT9_9TELE/116-420               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................v-QPSQVCDILKAFI.MV.IC..C.CLLHY....V.DY......SM.MYHMIR...GQ..SVIKLYVIYNMMEV.................ADRLFSSVGQDI.LDALYWTAA.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.LIPH.FVIA.....V....L..YV.........FLHA....VL.I.....M....IQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.RMSN..........S....DIKERFT.....NY.ILVLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLLPDVCMVI..ASE.VAVDVVKHAF....ITKFN..DLT..A.D.V.YSEYR.ARL..............AFDLVSSRQK-----.......................................................---TAYTDY.SDSVARRMGFIPLPLAVLLI.RVVL......SCWKA.EG..........................................................................................................................-T.LSYL.CL.ILFFMGMMSLKVLNSIILVGKSC----iyik...................................................................................................................................................................
A0A024TSW5_9STRA/165-277               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RSHVHDVLTAVI.MV.LS..T.AVLMQ....V.DM......SR.VYHLIR...GQ..ALIKLYVLFTMLEI.................FDKLFSSLGQDV.LDAMYFTVR.................................YQPRRV.G....................R............................................................................................................................................................................................................................................................................................................................................M................................................MFDFAVCS.IYVD.ILFA.....C....V..YI.........H---....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------vsvefrstias............................................................................................................................................................
F7F820_MONDO/186-490                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQICDILKGVI.LV.IC..F.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.LIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.TAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKILNSIVLLGKSCQY--vk.....................................................................................................................................................................
U7Q609_SPOS1/502-923                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGAV.IV.CS..S.LALMN....L.DA......SR.MYHFVR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDI.FECLFSAET.................................LSRTAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PFGM.FCLA.....L....V..YN.........IAHT....TV.L.....F....YQVITLNV.AV..NSY.S..NALLSLLMSNQFVEVKS...........SVFKRTEKENTF.QLAC..........A....DIVERFQ.....LW.IVLFIIALRNVVEigglsvpgagldlgasglle...............................................................dmaakvplhnasilpasftiLPS.WLTSV..EVLSPFLIVI..GSE.MVVDWIKHGY....INKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFLAP.A--LIRRLGLPLIPLCTLFL.RSSV......QTYHM.FLathlpsplppsthtslvaeaatpsspamaaslerldllir.........................................nalgravhgnpyaamggdaaagassssslwlwrwssddliaGV.TMVV.VF.FLMFLILLIAKLLLGMALLRYARNRY-a......................................................................................................................................................................
A0A2I2ZQB9_GORGO/176-480               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A3Q4GMT9_NEOBR/146-450               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.ADHLW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
M3XT23_MUSPF/54-358                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.TAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYLGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A182F718_ANOAL/166-470               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LTPAEICDLLKGTI.WI.IC..S.YTLLY....V.DT......NM.LYHLIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKRQHFG.TIPH.FLFA.....I....V..YV.........TLHS....GL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLAC..........S....DVRERFH.....LT.VLMVIVLIQTMKE......................................................................................................fNWK.SEQFF..IMLYDCMWVM..ATE.VLVDWIKHAF....ITRFN..EIP..S.D.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPYPLGVVLV.KALY......HALAF.DN..........................................................................................................................-A.GSVV.IL.FVAFLALLAGRVLNTIYTLGEAC----dltq...................................................................................................................................................................
M3HEQ5_CANMX/177-504                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................rli-----KKDVITLSL.IF.FA..L.IVLSNk..kL.DI......SR.MYHDVR...GQ..TDIKLYVMFGVLEC.................AEKLCSSIGQDI.LNILYGSST.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SRKTGR.FVVF.YFLS.....I....F..YL.........SFHA....YI.L.....V....YQTVSLNV.AA..NSY.S..NALMTLLLSNQFGELKG...........SVFKKFEREGLF.QITM..........A....DLSERFQ.....LS.LMLGIIALRNLMQlsvtgg...........................................................................................lipnswKSW.NRWIG..AVFGPGVVVI..GSE.VFVDWLKHCY....IVKFN..KIK..P.K.I.YKNFL.YVS..............CLDFLEVFGDKSKNG.......................................................KSSHEFTD-.YISLTRRIGLPLLASVVCYL.RMTL......PDLKS.IFifpdt...............................................................................................................gsktyaVI.GSTT.LI.GVTFLTLLLVRVILSMVIFKIA-----nvl....................................................................................................................................................................
A0A1Y1XAV7_9FUNG/408-813               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................f-KTRHKSDILKGLL.IL.FC..C.IALQY....I.DV......SR.LYHFVR...GQ..NIVKLYLIYNLMEN.................FDKLCSAFGHDV.LDSLFAENI.................................IKKSNK.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................---GSRFP.VVVH.FVVA.....L....I..YL.........ILHT....VV.L.....F....YLVVSLNV.AI..NSY.N..NALLSFLISNQFGEIKS...........SVFKRFERENLF.QLTC..........A....DIVERFQ.....IL.VFLVIITGRNFLEltgtgaetlshfytlfsksilspasfssfipk.......................................ldilqtfqssnfpefcekivnlvvskftnflnSPT.YQLLA..VLVTPVVVIY..GSE.MFVDYLKHTF....ITKFN..QIK..P.S.V.YTKYK.DSL..............CKDFAGTKKF-----.......................................................-SDNQILDR.SGYVSRRIGFVSIPLACLTI.RIIM......QTLKM.FGylyidgdslhifsihnf.......................................................................................fkndgsinyiyakrafinFI.MIFI.FL.LIVYICVLVFKIYLSLYIHKLSYKRV-q......................................................................................................................................................................
K0KHR9_WICCF/141-472                   ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................siinsknl---------LLAS-.IL.FL..A.MISSN....V.DT......SR.IYHTIR...AQ..SSIKLYVMFGVLEI.................ADKLMATVNQDL.MNVLFSYNT.................................ILTK--.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-DLTSLGL.FCLF.YGLS.....V....V..FL.........SIHT....VI.L.....I....YQTIALNV.AA..NSY.S..NSLLTLLLSNQFAEIKG...........AVFKKIDREGLF.QMSC..........A....DVVERFQ.....LL.TMLTIISLRNIVQigndsngi.......................................................................................glipnssfISW.NKALG..IIFGPTMIVI..GSE.LLVDWVKHAY....VTKFN..KIR..P.Q.I.YSKFL.NVF..............ANDMVNNFKI-----.......................................................---RVSNNN.DDKIQHRIGLPLPALFVLFI.VMSK......NTLSW.FLldksvn.............................................................................................................dsilgqiIW.TNLF.IF.IVTFITLVFFKLLIELILIKWANQK--lk.....................................................................................................................................................................
A0A068YFZ9_ECHMU/127-460               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lya---TDARELVKFSF.VC.IC..T.IFLYT....F.DS......SI.AYHEIR...TQ..SIIKIYIFFNLLEV.................ADRLLSAVCLDA.VDDVLFTVSvgl..........................sglrRQRSSS.G....................D............................................................................................................................................................................................................................................................................................................................................Havttssgas..............................stdpsscpsTEVVGLGA.LFVQ.YLFA.....L....A..CL.........SAHC....LL.L.....L....AQVTTLNV.AF..NSQ.N..RSLLTVIISNNFVELKG...........NVFRKMGKSNLF.QIAC..........A....DVRERFH.....YA.VWLFIIVCRNMSA......................................................................................................sGWQ.YEDFL..ALLPDILLIL..LAE.IAVDWIKHAF....ISKFN..VIA..S.D.V.YEEYT.VSI..............AYDLLLCRQG-----.......................................................---KNTSDY.FELLARRMGLTPISLSCLIN.VMII......QTVKS.SL..........................................................................................................................--.-IYI.FL.LLALPLLFALKVLVHIILLNRAYA---hvq....................................................................................................................................................................
G8ZPL3_TORDC/122-434                   ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lsktfnes---------FMVFM.IV.VA..S.VILSK....L.DT......SK.AYHRIK...RQ..SSVKLYMLFGVLEM.................ADKMLASMGQSL.FTIVLARNF.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--KRSKYR.QVVL.SCTS.....I....I..YL.........VCHG....YV.M.....V....YQTVALHV.AV..NSY.S..NAFLTLLLSMQFAEIKA...........ALLKKIDKEGLF.QLAI..........A....DVVERSQ.....LI.FLLIIIALRNVVAksksqsnv.......................................................................................ipnswnlhATS.SVVLG..VLCGPMFNVV..GSE.LVVDWVKHAY....VTKFN..RIR..P.R.I.YDKFL.IIM..............CRDYVTS--------.......................................................---------.LHKFCDRLGLPIPALVVLFI.VMIR......PTLLE.ILdis...................................................................................................................svpaIA.ITIF.KC.LAGFACLVLIKLFLRMMLLRWSQ----tila...................................................................................................................................................................
F1MN55_BOVIN/151-455                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGVI.LV.IC..Y.CMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERRRAHIG.VAPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSVKV.QG..........................................................................................................................-I.LSYA.CV.ILFYLGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A1U8NDL8_GOSHI/237-545               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELCDFGCFLV.LA.CG..V.IVLGR....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVWEI.................FDKLCQRFGGDV.LETLFNSAE.................................GLANCS.Q....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMGFWIRR.FVSD.QALT.....M....A..FS.........ILHS....FI.L.....L....AQAITLST.CI..VAH.N..NALFALLVSNNFAEIKS...........NVFKRFSRDNIH.SLAY..........S....DSVERFH.....IS.ACLLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLFNAFVVF..VCE.MLIDIIKHSF....LAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNIQTE-----.......................................................---------.--DCKKNLTFVPLAPACVVI.RVLT......PVYAA.HLpcsp..................................................................................................................lawrFF.RILV.LI.SMTYIMLTSLKVMIGMGLQKHATWY--vs.....................................................................................................................................................................
A0A182G0L7_AEDAL/178-482               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAPAEICDLLKGLI.WV.IC..S.WAMFY....V.DT......NM.LYHLIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DSKKQHLG.TIPH.FLFA.....L....I..YV.........TIHS....AL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........S....DVRERFH.....LT.ILMLIVLIQTMKE......................................................................................................fSWK.SEQFF..VMIPDCMYVM..LTE.LFVDWIKHAF....ITRFN..EIP..V.D.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPFPLGVILV.KALY......HALSF.DN..........................................................................................................................-T.ASIA.LF.IIAYLVLLSCRVLNTVCTLGKAC----dlmq...................................................................................................................................................................
A0A0G4KV86_9PEZI/489-880               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................avex--------------.--.--..-.-FLMN....L.DA......SR.MYHVIR...GQ..DAIKLYVIYNVLEV.................GDRLLSALGQDI.FECLLSTEA.................................LSRNKS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLL.PFGL.FLLA.....L....V..YN.........CIHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEVKS...........TVFKRFEKDNLF.QLTC..........A....DITERFQ.....LW.LMLFIIGMRNVVEvgglsipgaglsgdlkv....................................................................sstkpqhspfilphsftvLPS.WLWSG..EVLSPFLIVI..GSE.ILVDTIKHAY....INKFN..KIR..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVRP.S--LTRRVGLATLPLACLFI.RASV......QTYHM.FVstrvaapiirstqtslseesatpsspamtaaldrld..................................................sllrdalgravygqqadgssngkaswfswstddviaAV.TMLV.VF.FIAFLVLLVFKILLSMVLLRYSRDRY-a......................................................................................................................................................................
A0A3E2HA67_SCYLI/889-1289              ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................rg---RHKADLLQGAV.II.TS..C.IILLK....L.DA......SR.MYHSIR...GQ..AAIKLYVIYNLLEV.................CDRLFSALGQDI.FECLFSNET.................................LGRDDD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PLGM.FVLS.....L....V..YN.........VIHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........TVFKKFEKDNLF.QLTC..........A....DIVERFQ.....LW.LMLLIIAMRNIVEvgglsvvngsrhaftaa.....................................................................gdatvvsgprsiipnsfTIL.PSWSG..EVLTPFLFVL..GSE.MLVDWIKHAY....ISKFN..NVK..P.A.L.YQRYL.DVL..............AKDYYTH--------.......................................................----AFVDQ.N--LIKRLGLPVIPLSCLFI.RASV......QTYHM.FLathfqppipatttsisvdaavtspattaalehf.......................................................dyiirhalgratygipnpaasnpwylpgaddaiaAL.TMLV.FF.LVVFFLLLAFKLLLGMLLLKYSRNRY-r......................................................................................................................................................................
A0A1A6A8Y0_9TREE/313-673               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ipla----HQHSILRMLL.LL.IP..A.SILLG...aT.DS......SK.MYHSVR...GQ..DTIKLYVIFNALEI.................ADRLCCAFGQDV.LDTLFARETla.............................psI--RKS.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................GRKRQQAR.PVFF.FALS.....L....G..YV.........LAHT....LI.F.....F....YMLVSLNV.AI..NSY.D..YTLLSLLISNQFVEIKG...........SVFKKFEKENLF.QIMC..........A....DIVERFQ.....LS.LMLSVIALRNMIEmagsei..........................................................................................aflpksfIRG.KNLVD..SILSPVLFVI..VSE.MIVDWLKHAF....ITKFN..HVR..A.S.V.YERFT.DVL..............AKDVLLAGTVANGRSrr...................................................rgRNHQVLLDQ.SPLVARRLGFASIPLACLVL.RVAA......QAIGM.LStsshsdeslad...................................................................................................ftaeewawtvvkWI.SWTG.VG.LCAWGCLVFLKVILGLALLSFSAMRQ-e......................................................................................................................................................................
A0A3B3QKE0_9TELE/163-467               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.IC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSCV.CV.LLFYLGMITLKVLNSIVLLGRSC----lyvk...................................................................................................................................................................
M0T627_MUSAM/282-594                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAAELSDFGCFLV.LA.LG..V.ASLQL....A.DI......SL.IYHFIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFDSAEg...............................lS--TCP.P....................-............................................................................................................................................................................................................................................................................................................................................D................................................NMKFELIR.FILD.EAIA.....ViafdI..LL.........LVHS....FI.L.....L....AQAITLST.CI..IAH.N..NAVLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IT.AFVLFVLAQNILE.......................................................................................................-AE.GPWFE..SFITNALLVY..MCE.VLVDAIKHSF....LAKFN..EIK..P.I.A.YSEFL.EDL..............CEQTLNEKP------.......................................................---------.-DEGRKDLTFIPLAPACVVI.RVLT......PVYAH.LLpsgp..................................................................................................................lpwrLV.WILF.LS.SLTYIMLAIWKILVGLSLRRLATWY--ik.....................................................................................................................................................................
A0A1U8B4Z9_NELNU/315-509               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ph--AAELSDFGCLIV.LA.LG..V.ILLQE....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQNFGGDV.LQTLFSSSE.................................GLANSS.P....................E............................................................................................................................................................................................................................................................................................................................................-................................................NMRFWLWR.YISD.QALA.....I....V..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLXLLVSNNFAEIKS...........NVFKRFSKDNIH.SVVY..........H....DSVERFH.....IL.SFLLFVLAQNILE.......................................................................................................-AE.GPWFG..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------nflfaecssg.............................................................................................................................................................
A0A1A9X1M6_9MUSC/129-211               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LTPAEICDLLKCAI.WL.TV..T.LLMLS....V.DT......NR.VYHIIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................EPKNS-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------krehfg.................................................................................................................................................................
A0A0J9X301_GEOCN/277-610               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lpm---SRKADILKGFI.FV.LT..I.YLLLQ....L.DT......SK.IYHSIR...GQ..SAIKLYVMFSVLEI.................SDKLLSALGQDI.LECLFSHKT.................................LSRHYN.D....................-............................................................................................................................................................................................................................................................................................................................................-................................................-GAHKYYQ.PVLF.AMLA.....V....L..YV.........FCHS....LV.I.....L....YQIITLNV.AV..NSY.S..NALLTLLLSNQFSEIKS...........AVFKKFERENLF.QLTC..........A....DITERFQ.....LT.AMLFIIGMRNLVEvsnag............................................................................................lvprswSGW.NRWLG..AMFGPMFVVI..GSE.ICVDWLKHAY....ISKFN..NIK..S.R.V.YDKFL.DVL..............TFDYSEN--------.......................................................-----AL-S.DYIMTKRMGLPVFPIASVFI.RMLL......QSYSI.LTahaaeqqpvt.....................................................................................................iklesvwfaadIL.FSAF.LL.ILVFIFLFVIKLILGLFLLQYSYY---hra....................................................................................................................................................................
F2SLW9_TRIRC/564-1002                  ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--ENDKADILKGLL.MI.FT..C.TILMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSQEA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVVR.PFWM.FIFA.....L....I..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKRFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLIIIASRNFVEtggfklgnaltsqssattttnsttaf...................................................rpstsilpqsftllipssvfsslssvNSI.LPAIG..HLLAPFLVVL..GSE.MVVDWLKHAY....ISKFN..NLK..P.A.M.YGRFL.DIL..............AKDYYSS--------.......................................................----AFSDP.N--LNRRLGLPVIPLACLFF.RVSV......QTYQM.FLtawlpqlsssplypppsnatslteihshyapisgssaslssil....................................pgfsnasastilssislstiaqaasslfqtlvsyatpspesfvPI.FTVI.LV.LLLYITLLLGKLVLGMILLGYSRTRYK.......................................................................................................................................................................
A0A3B4BS61_PYGNA/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.MV.LC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDVVKHAF....ITKFN..DIP..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-A.LAVV.CV.VLFYLGMITLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
G3I7L5_CRIGR/1-135                     .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................meqfs--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................-WN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKILNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A2T2P7V3_CORCC/476-882               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PSHKADILKGLL.VI.SS..C.AILMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAVGQDV.LECLFSRET.................................LDRNAD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVIR.PFWM.FVLA.....L....V..YN.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKG...........TVFKKFEKENLF.QVTC..........A....DIVERFQ.....LW.LMLLIIAMRNIVEvgglsigsstfwsnsfgvg.................................................................gnstttapfsassiiplsfTIF.PKWIG..QVLNPFLLVL..GSE.MLVDWLKHAY....ITKFN..QTK..P.E.V.YGKFL.DVL..............AKDYYSN--------.......................................................----AFTDP.N--LTRRLGLPVLPLSCLFI.RAAI......QTYHM.FIathmplpfpststslasnpptsspattaalahid......................................................qifrralgrstfgagvaeqswynfsswslddaiaGA.TMLI.VF.LVGYLFILAFKLILGMLLLRVARNRY-h......................................................................................................................................................................
A0A1X2GDD4_9FUNG/226-628               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-RASQKCDLLKGLL.II.ST..C.VAMAT....L.DP......SR.LYHAIR...GQ..AVLKLYVIFNVLEI.................CDKLCCSVGVDI.LDALFSKSTlgs...........................sphHESGTA.-....................-............................................................................................................................................................................................................................................................................................................................................T................................................DYARRHLK.PVTL.FMLA.....A....I..YM.........LIHT....AV.L.....F....FEMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKKFERENLF.QLSC..........S....DIVERFQ.....QS.VFLTIITLRNVVElsdssptsv....................................................................................lpstfvplfqLPA.SISIN..SLMTPVLMVI..ASE.LTVDWLKHAF....ISKFN..QIR..P.S.I.YEKYI.DIL..............CRDLVVGNPGRMSSS.......................................................KKKNSFVDQ.SPVVSRRIGFPALPLACMVG.FMLP......FFELY.HP..........................................................................................................................--.----.--.---------------------------nssffairmmqqllpmifmpsrfddgpsgtsepatsvastlvhgllsyladhqgivsrllpariqlvilslvqcgwlergldhfvrgltwtffvlf.......................................................................
A0A0G4IS94_PLABS/83-393                .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lkvge-----QRDVLVTFL.LF.SV..I.VVLHLaslaL.DVs....ySH.TYHIIR...RQ..GYFRVFVLFNIVNV.................LDRLCSMFGGDL.FASAIETRA.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SRSATR.AACD.VALC.....I....A..YA.........VVHV....AV.I.....Y....AQVVTLNV.AV..NSD.Q..AELIVILTSSNFSELKG...........SVLKKFSVINVF.QIAM..........G....DVVERFQ.....TF.AVLLMISAHQFSAm....................................................................................................drADY.AEFGG..RILLVVVWMS..TFE.IMVDWMKHGF....INRFN..DLS..P.H.I.YSEFS.AIL..............SHDVITN--------.......................................................---------.PDVIPKRIGLVPLPLASIIA.RGVL......QILWR.KHfrfwmf..............................................................................................................ythqirGL.S-IA.CL.VLLVSCLLLVKVMLRVLLIGASTRRM-r......................................................................................................................................................................
A0A0D0E0S4_9AGAM/204-564               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADIIRTLL.VV.VS..I.TLLIP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNSLEI.................ADRLCASIGQDI.LDCLFSRST.................................LEVLSH.K....................-............................................................................................................................................................................................................................................................................................................................................V................................................PVSSHTLR.PFIF.FVLA.....T....L..YV.........ASHT....LV.M.....L....YQLLSLNV.AV..NSY.D..HALLTLLMSNQFVEIKG...........CVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLVVVAFRNLIElsgsefdftg...................................................................................gfvmpksfgwFRG.NNVLW..TISYPVVTVL..ISE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RLG.......................................................ARKHTYADQ.SPLVARRLGFASVPLAVLAI.LIGF......QSLNL.VFsrrfndewsld...................................................................................................almqmplaevvhLV.KWVV.MG.VAFWLCSLAFKVLLGVNLISYASKRR-a......................................................................................................................................................................
A0A1L9PA94_ASPVE/1061-1491             ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MV.TT..C.TILMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIFR.PLGL.FLLA.....L....A..YT.........VIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........SVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNMVEtgafqfggsllstsatgaapvtnstpls...............................................tpprsstsilpqaftlvpssvmasishvNSF.LPALA..QVLGPFLVVL..GSE.MFVDWLKHAY....INKFN..NTR..P.N.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPIIPLSCLFF.RVSV......QTYQM.FLaallpqspplspsssiavettslatihsqyvpagpvp................................................spppitlgnilpataahasvwfrralanampspahsvYI.FTVV.LV.LTGFVLLLILKLLLGMLLLTYSRSRYK.......................................................................................................................................................................
W4GFT2_9STRA/142-430                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fr--RSHVHDLLTAVI.VI.LS..T.GVLMQ....V.DM......SR.VYHLIR...NQ..ALIKLYVLFTMLEI.................FDKLFSSLGQDV.LDAMYFTVR.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................YQPRRVGR.MMFD.FAVC.....S....I..YV.........VLHS....LL.L.....F....GQVVTINV.AI..HSS.S..SSLMTLLISNNFAELKS...........SVFKKFEEQNLF.QVAC..........S....DIVERFK.....LM.VIIGLILVQVDGK.......................................................................................................---.-----..DVADGTFVVL..AAE.MLIDWIKHAF....ISKFN..QIP..P.S.V.YSKFL.TVL..............CRDVSGYRSD-----.......................................................---TTFLDH.SQFVSRRLGLISLPLACVVL.RMLF......KALRD.FDlws....................................................................................................................qlyTP.SGMS.IA.LLGFANLSAFKV---------------htle...................................................................................................................................................................
A0A0A1NSK0_RHIZD/1-362                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.IT..C.VFMNI....F.DP......SR.VYHSIR...GQ..AVLKLYVILNVLEI.................CDKLCCSLGVDV.LDALFSKST.................................LGNSPQ.D....................I............................................................................................................................................................................................................................................................................................................................................Kg..............................................aAYARRQLR.PITF.FILA.....A....G..YM.........VMHT....LI.L.....F....FQMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKRFEKENLF.QLTC..........S....DIVERFQ.....QS.AFLFIITLRNVIElsesgpssi....................................................................................lpstfvplfkLPA.STSLN..TLMTPVVMVI..TSE.LLVDWLKHAF....ITKFN..QIR..P.S.I.YGKYI.DIL..............CKDLVIGSPG--RMT.......................................................GKHHAFVDQ.SPVVSRRIGFPVLPLACLYI.RMMQ......QILPM.MFiilhyqnvlsqylpvrfql...................................................................................ilvsmvnsgwlehvldqlirFV.IWTL.FV.CVLAIVLLALKVVVGMNLLGYAYKRY-l......................................................................................................................................................................
A0A3B4ESG0_9CICH/206-322               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................cil--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..--------PAKFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVFMVV..TSE.VAVDVIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKNV---.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------snc....................................................................................................................................................................
D7FP16_ECTSI/732-1038                  .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................vnrpl-----VYDWMRGAT.FA.AA..L.GSLQF....L.EM......SR.VYHYIR...GQ..AMVKLYVLIAMVEI.................FDKLMCSFGQDA.LDSLYLSTV.................................H-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................---KKKRR.VLVH.FTIV.....C....V..TA.........CLHS....LL.L.....F....VHVTTLTV.AV..NSS.D..QALLTLLISNNFAEIKS...........SVFKKFDKHNLF.QLSC..........H....DVVERFK.....LA.LFLAMIMLLNVCQ.......................................................................................................GGL.DDPVA..QFSVIFAMVF..GGE.VLADWIKHGF....IIKFN..QLT..P.S.I.YDEYS.TIL..............ARDVAAFRKDD----.......................................................---GSTLDH.THFVARRLAFATVPLNCVMI.RFVQ......MAVPK.LLqrl...................................................................................................................pdapPS.ALWV.SA.ILFYLMALALKVLTGIKLMAD------sctlh..................................................................................................................................................................
A0A2U9R2C7_PICKU/86-370                ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lnyi------RDTISISL.IS.IA..-.LLLLN....I.DT......SR.IYHNIR...SG..TAIKLYFMMQVLDV.................ADRLLSVTGKDI.STWMHSCTG.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................------AK.FYLL.YSLS.....A....L..YL.........VLHS....WV.L.....V....YQVMALNV.AI..NSY.S..NVLLTLILSNQFSELKS...........AVFKRIQREGLF.QMSC..........A....DLNERFI.....LF.IMVTIITSRNILQv.....................................................................................................sGSP.KSWPS..LLIQPSILVF..GSE.VIVDWLKHAY....IVRFN..TFS..P.Q.I.YTKFT.TIL..............ASDFLNN--------.......................................................---------.-KSFTRRTGFPMGPAIIVLL.KLTI......FPYIS.IT..........................................................................................................................PY.ITIP.FI.PFIVLLLILVRMALSHGLRRCARK---lrt....................................................................................................................................................................
A0A177CZ34_9PLEO/465-872               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PSHKADMLKGAL.VV.VS..C.VVLMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSALGQDV.LECLFSRET.................................LDRNSD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PLWM.FVLA.....L....V..YN.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........TVFKKFEKENLF.QVTC..........A....DIVERFQ.....LW.LMLLIIAMRNIVEvgglsigapsfssvftgg...................................................................nttasapfsaasilpmsfTIF.PKWIG..QVLSPFLLVL..GSE.MAVDWLKHAY....ITKFN..QTK..P.E.V.YDKFL.DVL..............AKDYYSD--------.......................................................----AFIDQ.N--LTRRLGLPVIPLSCLFV.RAAV......QTYHM.FIathmpapfpststsltpnepptsspattaalahid...................................................qifrralgrssfgtgssnssalpwysstwtlddviaGS.TMLI.VF.LIVYLFFLAFKLLLGMFLLRVARNRY-r......................................................................................................................................................................
A0A1U7LGH9_NEOID/122-482               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ild---SEKCDVLKGFL.VA.LS..C.FALSF....M.DV......SR.TYHLIR...RQ..NTMKLYVLFNVLEI.................SDRLLCAIGQDI.LDCLFSSSS.................................FGRKKD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--GRRHLR.PITF.FLLG.....V....I..YN.........VTHA....II.L.....F....YQLVTLNV.AV..NSY.S..NALLTLLMSNQIVEIKS...........SVFKKFEKENLF.QITC..........A....DIVERFQ.....LS.VLLTIISLRNLIElrgssf..........................................................................................svlpdsyLPS.FHVLI..TIFTPVLVVL..SSE.IIVDSLKHAF....ITKFN..HFR..P.G.I.YPLFL.DCL..............ARDYIVCENG-----.......................................................--SQKFVDQ.SPAVSRRIGLPVLPLSCLFI.RAMI......QIYNM.ILssslndaattptedilrvte..................................................................................tssgvdeifrnfvdeprvqrIV.GLSL.FS.IMVFVSLVVLKLVLGVSITLFAARRV-q......................................................................................................................................................................
A0A383YWZ6_BALAS/14-318                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKTAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..TSE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A409VGR0_9AGAR/231-592               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRALL.LV.AS..I.LILNP....LtDA......SK.IYHTIR...GQ..ETIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEPLSR.R....................-............................................................................................................................................................................................................................................................................................................................................V................................................PVSSHTIR.PFLF.FLLA.....L....V..YTe......lqVSHA....LV.M.....M....YQLISLNV.AI..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDSLF.QITC..........A....DIVERFT.....LS.LMLVIVAFRNLIElsgsefdft.....................................................................................ggfglpkswVRG.NSLLW..TISYPVLSVM..VSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYI.DVL..............CRDLASMTGLS--RR.......................................................ARKHSYVDQ.SPLVARRLGFASLPLAALAI.LVGS......QSIGL.MLssgsdfaspwtw..................................................................................................slrslsnaeilrYV.TWAV.IG.LLFWLCFVVVKIIIGVNLLSYATRRR-a......................................................................................................................................................................
A0A166MZG5_EXIGL/176-529               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--AAQKADILRALL.LI.LS..I.VILAP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLFASFGQDI.IDCLFSRSN.................................LMLLSH.H....................-............................................................................................................................................................................................................................................................................................................................................L................................................PLSAGTLK.PMFF.FVLS.....T....L..YT.........VGHA....LV.L.....I....YQLTALNV.AI..NSY.D..HSLLTLLVSNQFVEIKG...........SVFKKFEKDNFF.QITC..........A....DIVERFQ.....LA.LMLASVAFRNFIEvtgstfdfgdtg...............................................................................gsllvlpksfnwVQG.RNVVY..TVFYPVMTVL..LSE.VVVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSALS-RRR.......................................................AQKHTYVDQ.SPLVARRLGFAALPMAVLAV.LLGT......QSVHL.LFvnmyst..............................................................................................................eldwtrRA.QWTV.LG.ILFWLCLVLVKIILGLNLIGYAAYR--qa.....................................................................................................................................................................
A4H4V9_LEIBR/128-501                   ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................wrrcel------RDIIALLV.LT.IVlgS.YWVAG....L.ATtq..lySY.LYHAVR...RT..SFIKVVMIFGILDV.................VDKILSSFSQDS.LEVLYTAVDdeysyy.....................carrrqA-----.Kppaa............stptK............................................................................................................................................................................................................................................................................................................................................Raasgrgyagc............................ddvgtaaasqHTPPSRWL.LAGS.GVVA.....C....L..ST.........SCHS....LS.L.....L....LHVVTLNV.AI..NAE.G..NSLLALLVANNFTELKG...........VLFKKNTPESLH.GVSS..........L....DALERMQ.....YI.VFFFVMLLQHMHE.......................................................................................................---.-RFTD..FAIADVCIIL..CVE.VAIDFVKHLF....VFRFN..GIP..P.S.M.SRAYS.QLA..............LLDLSCETVLWRLPSlevvvsgpss...................................svatrmeeaaELLTPAHGF.APKHVKRAGFDAIAYAALLL.WSCE......RVAGY.LL..........................................................................................................................-L.QAPL.VC.VLLVLILALLKVMLSSIVYGVCAR---ft.....................................................................................................................................................................
A0A3B4TZL6_SERDU/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.ADHLW..VLFPDVFMVV..TSE.VAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A1J7IRN0_LUPAN/379-584               ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................scppet--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....-QAITLST.CI..VAH.N..NALFALLVSNNFGEIKS...........NVFKRYSKDNVH.RLVY..........F....DSVERFH.....IS.AFILFVLAQNVLE.......................................................................................................-AE.GPWFE..SFLINILYVY..VCE.MIIDIIKHSF....IAKFN..DLK..P.I.A.YSDFL.EDL..............CKQTLNMQTE-----.......................................................---------.--GSKKNLTFVPLAPACVVI.RVLT......PVYAA.NLpsnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKVLIGMGLQKHASWY--vn.....................................................................................................................................................................
M7Z694_TRIUA/246-457                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................es--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..-L.........LVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQP------.......................................................---------.-DDRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................ftwrIF.WILL.WS.VLTYFILAIFKILVGLILRCLATW---yin....................................................................................................................................................................
A0A0A1NLE6_RHIZD/1-378                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.IT..C.VFMNI....F.DP......SR.VYHSIR...GQ..AVLKLYVILNVLEI.................CDKLCCSLGVDV.LDALFSKST.................................LGNSPQ.D....................I............................................................................................................................................................................................................................................................................................................................................Kg..............................................aAYAKRQLK.PITF.FILA.....A....G..YM.........VMHT....LI.L.....F....FQMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKRFEKENLF.QLTC..........S....DIVERFQ.....QS.AFLFIITLRNVIElsesgpssi....................................................................................lpstfvplfkLPA.STSLN..TLMTPVVMVI..TSE.LLVDWLKHAF....ITKFN..QIR..P.S.I.YGKYI.DIL..............CKDLVIGSPG--RMT.......................................................GKHHAFVDQ.SPVVSRRIGFPVLPLACLYI.RMMQ......QILPM.MFmsqggngttaasvitssilhyqnvlsq...................................................................ylpvrlqivlvsmvnsgwlehvldrlirFV.IWTL.FV.CVLAIVLLALKVVVGMNLLGYAYKRY-l......................................................................................................................................................................
A0A1E5R731_HANUV/142-571               ...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................yrrlklhllnf-----------FKI.II.IS..H.IIIKQ....V.DT......SR.LYHMIK...LQ..SYMKIFALINFLQM.................IEKLTSTILVDI.TTEQKDKQN.................................----KD.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................-ERHKXL-.---K.FLIQ.....L....P..IL.........FVNS....LV.I.....I....MQALTFNV.II..NSKgN..NKLNTLLITISFNKLKS...........STFKRFNGSSLF.QVFL..........Q....DSNDRFQ.....LN.VALIIVLINNYFH.......................................................................................................---.-----..--FNKILILI..LVT.TITDWIQQIF....IVRYN..SID..L.K.V.YXAYK.QVL..............VHDYLNXGIIKRFGMpvd.................................................ghiVSCIVMLYR.KNINIKTWGIFLILFFATKV.TCIY......-----.--..........................................................................................................................--.----.--.---------------------------ilesllqiydtekdhtidknvtrfikglpkdtdvspkavskskmfmikxnvlslvnkqrssyaiktytrqmpklstyftpkrsffytptmlnlqrksvipekapfkidlsdkeyeeifgdktqpqlvkgfdaenalrikknqrpldcdkkvaywlffvaslvfsiii
J9JXN6_ACYPI/104-409                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAAEIIDLLKMAV.LI.TC..L.MMLLP....W.DT......SM.IYHVIK...RQ..SVIKLYIFFNMLEV.................GDRLLSSFGQDI.LDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................TSQRSHFG.VLPH.FIIA.....V....F..YV.........FLHS....IL.V.....L....CQATILNI.AI..NSK.K..RALLPIMMSNNFIELNG...........SVFKKFNKTSLF.QLSC..........S....DVRERFH.....LF.ILLLIVVVQTMKE......................................................................................................yQWT.SESFW..KLMLDCVYVM..ILE.IIIDWTKHAF....ITRFN..EIN..L.S.V.YSDYL.LSF..............AYDTAQSYNK-----.......................................................---KAFTDH.SDSVARRMGFIPIPLGVVII.KVLT......RCVSI.DG..........................................................................................................................QL.VSIV.IL.LSTLACVATLKIVNLVYIIGRACK---min....................................................................................................................................................................
K7ETY9_PONAB/44-348                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FFHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..GSE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVIT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A3Q0HSH7_PHODC/243-551               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pn--AAELSDFGCFIV.LT.IG..V.ITLQM....T.DI......SL.IYHIIR...GQ..GIVKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSNCL.P....................-............................................................................................................................................................................................................................................................................................................................................D................................................NMIFQLMR.FILD.EAIA.....I....I..AF.........VVHS....FI.L.....L....AQAITLST.CI..IGH.N..NALLALLVSNNFSEVKS...........SVFKRVSKENLH.SLVY..........Y....DIIERFH.....IT.TYVLFVLSQNILE.......................................................................................................-AE.GPWFE..SFAIDALQVY..VCE.TFIDTIKHSF....LAKFN..EIK..P.S.A.YSEFL.EDL..............CKQTLNEKPD-----.......................................................---------.--ERRKDLTFIPLAPASVVI.RVLT......PVYAI.VLpygp..................................................................................................................lpwrLF.WIIF.WS.SLTYITLAICKMLVGLSLRRLATWY--mn.....................................................................................................................................................................
A0A445DWK0_ARAHY/301-419               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAMELSDFGCFLI.MS.CG..V.ILLQQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTFFHSAEglasc.......................ppesmR-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................---FWIWR.FIAD.ES--.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------laiaasnilplwnyfyvfsyslvst..............................................................................................................................................
A0A0J6Y0C6_COCIT/543-893               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPNDKADILKGLL.MI.FT..C.TILLY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLFSAIGQDV.LECLFSREA.................................LERGPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PFWL.FILA.....L....F..YT.........VIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLIIIASRNFVEtgavtfgnalapfskpsptpstnstppa...............................................sppmsatsilpqsftlfpssiflslssvNSF.LPTIG..HVLGPFLVVL..GSE.MLVDCYTHAY....INKFN..NIR..P.S.I.YGRFL.DIL..............TKDYYTN--------.......................................................----AFADQ.N--LNRRTIL-----ETVMS.HTMP......SPATF.IP..........................................................................................................................-V.FTVI.LV.LLLYVTLLLVKLILGMTLLSFSRARYK.......................................................................................................................................................................
TAPT1_DICDI/468-787                    .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TTNQIFDLFRGFI.WV.TC..F.VFLNF....I.DS......SM.LYHYIR...GQ..AVIKLYVIYNVLEV.................LDKLCCSFGQDI.FDSLYWMSF.................................SLTSSN.R....................N............................................................................................................................................................................................................................................................................................................................................Rqdgl........................................vpkqRNETRILG.PFTH.LLVA.....T....G..YV.........CLHS....LV.L.....F....SQVITLNV.AI..NSY.N..NALLTLMISNQFVELKG...........SVFKRFEKENLF.QISC..........S....DIVERFQ.....AF.IFLTIIIFQNLSDl....................................................................................................nwDLS.WDFAI..NMLTVVGTVW..GSE.VLVDAIKHAF....ITKFN..KFS..P.Q.M.YSKFF.VLL..............SDTIVDPRN------.......................................................---RNFTES.SWGVNNIIGFVPFPLASIVV.RVFH......KFIPS.KG..........................................................................................................................-I.FGIF.LM.VQIYICLVLLKIFIKIIILGQCLSK--tt.....................................................................................................................................................................
A0A218Z295_9HELO/547-947               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSHHKADLLQGAV.II.CS..C.ITLMR....L.DA......SR.MYHSIR...GQ..SAIKLYVIFNALEV.................CDKLLAALGQDI.FECLFSNET.................................LERNSE.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PLEM.FVLA.....L....I..YN.........VTHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLISNQFVEIKS...........TVFKKIEKDNLF.QLTC..........A....DIVERFQ.....LW.LMMVIIALRNIVEvgglsiigngsdgdml......................................................................gntaastrsssifpssfTVF.PSWSG..EVLTPFLLVI..GSE.MVVDWIKHSY....ISKFN..NVK..P.A.V.YQRYL.DVL..............AKDYYTN--------.......................................................----AFVSQ.N--LIKRLGLPVIPLSCLFI.RSSM......QTYHM.FLatylpspiastatslavesattstattaalehf.......................................................dniirralgrstfnipnpiaastwylpsaddaisTL.TMLI.FF.LGAFFVLLACKLVLGMLLLRFARNRYR.......................................................................................................................................................................
A0A423VAI2_9PEZI/90-522                .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSFHKADLLQGLV.II.CS..S.IALMN....L.DA......SR.MYHFIR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDI.FECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVML.PFGM.FLLS.....L....V..YN.........CTHA....IT.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........SVFKRFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLLIIGMRNVVEvgglsvpgaggglgedgm..................................................................atakvplhnpsilpmsftiLPS.WLRSG..EVLSPFLIVI..GSE.MLVDWIKHAY....INKFN..NIK..P.T.F.YSRIL.DIL..............CKDYYTNVSTTAGSHsrl.................................................nlsNFSQAFVAP.S--LTRRLGLPLLPLSTLFI.RASF......QTYHM.FLathlpapmppsthtslsvesstasspavtaaldrldnl.............................................irnaigrsiygldgdfanatarnasnlsflswstddviaLV.TMLL.VF.FIAFLVLLIIKLLLGMLLLRYSRDRY-a......................................................................................................................................................................
A0A074XIQ6_9PEZI/141-548               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLHGAL.II.IS..C.MILVQ....F.DA......SR.MYHKIR...GQ..AAIKLYVIYNVLEV.................FDRLLSAIGQDI.IECLFSKET.................................LERKPN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLL.PLGM.FILA.....L....A..YN.........VAHA....AM.L.....F....YQVVALNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLLIIALRNIVEvgglnmsssssgstttfs...................................................................pnstgspiqstsilpqafNMF.PTGFG..QILGPFVTVI..GSE.MIVDWVKHAY....ISKFN..NIK..P.S.L.YGRFL.DVL..............TKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVLPLSCLFI.RASV......QTYHM.FIathmplpmpstataitletssgetspsttaalahi...................................................dqifrralgrssfgagadavtgasswrfwtiddaiaLG.TMLV.FF.LIIYLVLLALKLLLGMILLSFARTRY-r......................................................................................................................................................................
A0A1G4MKI5_LACFM/102-413               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lrna-----YKEYTMVFL.IS.GA..S.IILSG....L.DT......SR.VYHRIK...GQ..SAIKLYMMFGVLEM.................CDKMLSSVGQSL.ILVVLTKNK.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RHSKIE.LGLL.NFAA.....L....V..YL.........ICHA....FI.L.....I....YETIALNV.AV..NSY.S..NSLLTLLLSMQFAEIKA...........SVFKRFDKEGLF.QITI..........A....DIIERFQ.....LF.ILLTIIAIRNLVAtgrslstl.......................................................................................vpnswtlhSTS.SVMIG..VLCGPMITVV..GSE.IVVDWVKHAY....ITKFN..RMK..P.K.I.YDRFL.SIL..............CHDHSTNL-------.......................................................---------.-QKFQTRIGLPVPALVVLFI.VLIR......PTLKQ.NFeds....................................................................................................................sasPI.GTVI.IF.VLGFICLMLSKFVLQLALAKWAQ----alqa...................................................................................................................................................................
A0A1V4JFM7_PATFA/155-459               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A166IE44_9AGAM/156-508               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-ATTQKADIIRFLL.FL.VP..I.ALLFP...hV.DV......SK.IYHTIR...GQ..ETIKLYVIFNALEI.................ADRLLISFGQDL.LDSLFSRST.................................LVQLPR.H....................-............................................................................................................................................................................................................................................................................................................................................I................................................SLLPLRLG.PVVL.LLLA.....L....I..YT.........ICHS....LV.L.....V....YQLTSLNV.AI..NSY.D..HSLLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFQ.....LA.LMLMIIAFRNLVElagsefdg......................................................................................svlpqsfrwLHG.NSITW..TILSPVMTVL..LSE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYN.DVL..............CRDLVTSPAF-TRRG.......................................................SQKNPSVDH.SPLVARRLGFASLPLAVIIV.LVTC......QAVPF.IAppssqnwst........................................................................................................lsasawittAL.KWFV.LC.AAFWFCLVVIKIILGIQLMNYAASR--ap.....................................................................................................................................................................
W2TXJ3_NECAM/94-397                    .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................w-TSAETCDFFKVWI.IV.FG..S.ILMQH....I.DT......SV.VYHQVR...GQ..GVIKLYIFYNMLEV.................ADKLFSSLGQDI.LDALFWTAN.................................E-----.-....................-............................................................................................................................................................................................................................................................................................................................................P................................................KTFKSVVR.TLFH.FAFA.....L....S..YA.........TIHT....FL.V.....L....LQATTLNV.AF..NSH.N..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMAC..........S....DVRERFH.....II.ALLFVVMVRNMMA......................................................................................................vNWS.NEHLR..EMMPDILMVV..GAE.LLVDWLKHAF....ITKFN..EIN..A.E.V.YKDFT.ITI..............AYDVVRSRDS-----.......................................................---SAFSDY.SDQVSRRMGFIPIPLSIMLI.RVLS......QTFTL.QS..........................................................................................................................-K.TSLV.IC.VIAWLLMVSIKICNGIVLLGKAC----vhvt...................................................................................................................................................................
A0A158PZ58_BRUMA/1-222                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.-FVH.LFIA.....I....I..YT.........WLHT....IL.V.....L....LQATTLNV.AF..NSH.T..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMSC..........S....DVRERFH.....IF.TLLAVVVVRNMMA......................................................................................................vNWK.FEHFM..EMLPDLALVT..IAE.IIVDWLKHAF....ITKFN..EIP..A.E.V.YQDFT.ITI..............AFDVVRSRDE-----.......................................................---KAFSDY.SDQVSRRMGFIPIPLTIMLI.RVIT......QTFDF.TI..........................................................................................................................-T.SVQL.VF.CFTWILLLSLKIVNGIVVLGKACRH--vk.....................................................................................................................................................................
A0A139HYM4_9PEZI/392-800               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADLLQGLL.IG.TA..C.VVLMS....F.DA......SR.MYHSIR...GQ..SAMKLYVIYNVLEV.................FDRLLSALGQDI.LECLFSKET.................................LERDPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVKR.PLGM.FLLA.....L....V..YT.........IGHS....TV.L.....F....YQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........AVFKKFEKENLF.QMTC..........A....DVVERFQ.....LL.LMLLIIALRNIVEvgglsisltsafvdstaple..............................................................smggnstgvplvsgfvipkafTLL.PKWTG..EVLGPFLIVL..GSE.AVVDWCKHAY....ITKFN..NVK..P.N.I.YGRFL.DVM..............AKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVIPLSCLFI.RAVV......QTYHM.FLaihmpapipsaatsisvdseatsssatmaafah.......................................................fdqvlrralgrssfgagndsnasfgwwtfddfiaLA.TMLI.FF.LASYLILLAFKLLLGMGLLSYARNIY-r......................................................................................................................................................................
A0A2K3PRM3_TRIPR/138-195               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--PIELSDFGCFII.VA.CG..I.TVLQQ....I.DI......SL.IYHIIR...GQ..ATIKLYLI------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------dyvkvltgmcckc..........................................................................................................................................................
A0A453H805_AEGTS/21-211                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------sflivc.................................................................................................................................................................
A0A2T6ZPU8_TUBBO/484-864               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PSHKADILRGLV.VF.CT..C.WILMR....F.DA......SR.MYHSIR...GQ..NGVKLYVIYNMLEI.................SDKLCSALGQDI.FECLFSKET.................................LERGPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFGF.FLLG.....L....A..YN.........TAHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALVTLLLSVQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DIVERFQ.....LW.LMLIIIASRNLVEtgvwslagpdts...............................................................................sasgagimpksfTLF.PKWTG..QVMGPFLLVL..GSE.MLVDWLKHAY....ITKFN..NTR..P.A.V.YERFL.DVL..............SKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVIPLACLFI.RASL......QTYQM.FLathaplpmpstttslseshtsrttteal..................................................................tnidvlfrralghsptslptslpdnlvaTA.MLLI.FF.IGFFLVFLALKLVLGICLLSFARQRYK.......................................................................................................................................................................
A0A0D2GIX7_9EURO/470-888               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADMLKGLL.II.CT..C.LILLR....L.DA......SR.MYHWIR...GQ..AAIKLYVIYNLLEV.................CDRLFSAIGQDV.LECLFSKEA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--HSKVLR.PFWL.FVLA.....L....I..YT.........VIHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.HMLVIIASRNIVEtgglsaglnafvrassavaaapplttnss............................................lpfisalppksvsstlpksftllpaavntiTSY.APAVS..QVLGPFLAVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.I.YDRFL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTKRLGLPVIPLSCLLI.RATV......QTYQM.FMaawvpssspssstslasihehysaarsnm...............................................................pmttstaisktvddiiraipaaitsssvvtHM.TTIL.LF.LLFFLILLACKLVLGMLLLAFARSRYR.......................................................................................................................................................................
A0A1G4KHP7_9SACH/107-417               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lqr----TRKELTMLIL.IV.LA..A.CGLSH....M.NT......SR.VYHVIK...GQ..SAIKLYMMFGVLDM.................CDKMLSSVGQSL.LTALMANKY.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--KQKTIE.PFLL.QFFA.....L....L..YL.........LCHG....SV.L.....I....YETIALNV.AV..NAY.S..NSLWTLLLSMQFAEIKS...........SVFKRIDKEGLF.QIAI..........A....DVVERFQ.....MF.ILLLIIAIRNLVAsgstfntl.......................................................................................vpdswtfhTTS.SLVVG..ILCGPTVVVI..GSE.ILVDWIKHAY....ITKFN..RIR..P.Q.I.YDNYL.SIL..............SADHINH--------.......................................................---------.LSKFQARTGLPVPALVVTLI.VLTR......PPLQQ.SLkdt....................................................................................................................stsKT.GLML.IL.SLACVCLMLTKVILHLFLVKWSR----llq....................................................................................................................................................................
A0A1S3U8I8_VIGRR/273-581               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STMEISDFGCFLI.MA.CG..V.VLLQR....T.DI......SL.IYHMIR...GX..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LQTLFLSAE.................................GLANCP.Q....................-............................................................................................................................................................................................................................................................................................................................................E................................................SIRFWIWR.FVSD.QALA.....V....V..AS.........IVHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSMDNVH.SLVY..........F....DSVERFH.....IS.SFILFVLAQNILE.......................................................................................................-AE.GPWFQ..SFLINILLVY..VCE.MVIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNMQT------.......................................................---------.-EGAKKNLTFVPLAPACVVI.RVLT......PVYSA.NLpnnp..................................................................................................................lpwrLF.WILL.FS.AMTYVMLTSLKLLIGIGLQQHATWY--vn.....................................................................................................................................................................
S3CNK7_OPHP1/539-955                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGAV.IV.CS..A.LALMN....L.DA......SR.MYHFIR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDV.FECLFSAET.................................LSRTAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLL.PFGM.FCLG.....L....A..YN.........IAHS....IV.L.....F....YQVITLNV.AV..NSY.S..NALLSLLMSNQFVEVKS...........SVFKRTEKENTF.QLAC..........A....DIVERFQ.....LW.IVLFIIAMRNIVEigglsvpgsidlgeelvs..................................................................sankvplhnssilpasftiLPS.WLVSV..EVLSPFLIVI..GSE.MVVDWIKHGY....INKFN..NIK..P.Q.F.YSRVL.DIL..............CKDYYTN--------.......................................................----AFMAP.A--LMRRLGLPLIPLCTLFL.RSSI......QTYHM.FLathlpspslpsthtslatamggpsaaepsspamaasler...........................................ldllirnalgrsvhgnpyssseavsalaswwawssddmiaSV.TMVV.VF.FIVFLILLIARMLLSMALLRYARNRY-a......................................................................................................................................................................
A0A420HCW8_9PEZI/491-891               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SSQNKADLLQGIL.IF.FS..C.VILMK....L.DA......SR.MYHYIR...GQ..AAIKLYVIFNVLEV.................CDKLLAALGQDI.FECLFTNDN.................................LQHDSS.Y....................-............................................................................................................................................................................................................................................................................................................................................-................................................--GSTPFQ.TFWM.FLLA.....L....I..YN.........ICHT....AA.L.....F....FQVITLNV.AV..NSY.S..NALFTLLMSNQFVEIKS...........TVFKKIEKDNLF.QLLC..........A....DVVERFQ.....LC.IILIIIGLRNFIEmgglsvpsgdmngngeg....................................................................lkdansplrnnsilpnsfSLL.PSWTG..EILSPFFFVL..GSE.LLIDWIKHSY....ISKFN..NVK..P.T.I.YGRYL.DIL..............SKDYYLN--------.......................................................----AFRNQ.N--LVKRFGLPVIPLACLFI.RSSM......QTYHM.FLatylstpssvsnlspnsavtspatiaalkhfd.........................................................thirralgrstfgipdpnasnpwylpstddmiaAL.TMVV.FF.LGAFLVLLAFKIVLGMFLLRFARNRY-q......................................................................................................................................................................
A0A0D2V8I1_GOSRA/260-368               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAAELCDFGCFLV.LA.CG..V.ILLGQ....T.DI......SL.IYHMIR...GQ..GTIKLYMIYNVLEI.................IDKLCQSFGGDV.FETLFNSAEg...............................lA--TCS.Q....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMKFWIRR.FVSD.QALA.....M....A..F-.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------srcqhfqtln.............................................................................................................................................................
A0A074XNJ7_AURPU/416-820               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADILHGLL.II.IS..C.MILVQ....F.DA......SR.MYHKIR...GQ..AAIKLYVIYNVLEV.................FDRLLSAIGQDI.IECLFSKET.................................LERKPN.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGM.FILA.....L....V..YN.........VAHA....AM.L.....F....YQVIALNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLLIIALRNIVEvgglnmgsgsttnfsp......................................................................nstaspvqstsilpqafNMF.PTGFG..QIFGPFVTVI..GSE.MIVDWVKHAY....ISKFN..NIK..P.S.L.YGRFL.DVL..............TKDYYSH--------.......................................................----AFADQ.N--LTKRLGLPVLPLSCLFI.RASV......QTYHM.LIathmplpmpstataialesasgetspsttaalahi...................................................dqifrralgrssfgagadaitganswrfwtlddaiaLG.TMLV.FF.LIIYLILLALKLLLGMLLLSFARTRY-r......................................................................................................................................................................
A0A0Q9X731_DROMO/161-465               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEICDLLKGTI.WI.TV..T.LIMLL....V.DT......NR.VYHIIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................---EPK.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SKREHFG.VLTH.ILFT.....L....I..YV.........FLHS....GL.I.....M....FQATCLNV.AV..NSN.N..KGLLTIMISNNFVELKG...........SVFKKFDKNNLF.QLTC..........S....DVRERFH.....LS.VLLFIVMIQTMKE......................................................................................................fDWS.ITQFC..VMLPDCFAVL..FTE.ILIDWVKHAF....ITRFN..ELP..E.S.I.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPFPLAVVLI.KAIY......TAVSF.HN..........................................................................................................................-L.AAWL.LF.LLAYLFALGLRICLTICALGKACK---lmk....................................................................................................................................................................
A0A0C3GYY8_9PEZI/399-799               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--SSHKADLLQGAV.II.CS..C.IILMK....L.DA......SR.MYHSIR...GQ..AAIKLYVIYNVLEV.................CDKLFAALGQDI.FECLFSNET.................................LERDVD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFGM.FILA.....L....V..YN.........VIHA....AA.L.....L....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKS...........SVFKKIEKDNLF.QLTC..........A....DVVERFQ.....LW.LMLMIIALRNIVEvgglsilsssgtgpes......................................................................lketiptrsysmlpnsfTIL.PNWTG..EVLSPFLLVL..GSE.MLVDWIKHAY....INKFN..NVK..P.A.I.YQRYL.DVL..............AKDYYTN--------.......................................................----AFVNQ.N--LIKRLGLPVIPLSCLFI.RSSF......QTYNM.FLathlpppipsaatdlavesataspatmaafehf.......................................................dtiirkalgraaygipdptasnrwyipsaddviaAI.TMLV.FF.LGAFFVLLACKLVLGMLLLRFARNRYR.......................................................................................................................................................................
A0A0V0Y6M2_TRIPS/124-173               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................c-SPSERCDVLKIII.LI.VS..C.FLVNF....F.DT......SI.MYHMVR...GQ..AIVKLYIVFNMLE-.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------.......................................................................................................................................................................
G0N0K4_CAEBE/385-691                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................w-TSAETCDFLKIVI.IL.AA..S.MLIRE....I.DS......SF.LYHQVR...SQ..GTIKLYIFYNMLEV.................ADRLFSSLGQDI.FDALLFTAN.................................PDKKR-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................FSAGHIIR.TSGH.LIVA.....I....L..YA.........TLHS....FL.V.....I....LQATVLNV.AF..NSH.S..QTVLAIMMSNNFVELKG...........AVFKKFAKANLF.QMAC..........S....DVRERFH.....IF.ALLFVVMIRNMTA......................................................................................................vNWN.VDSFT..EMVPDILMVV..GCE.FFVDWLKHAF....ITKFN..EIN..S.E.V.YKDFT.ITI..............AFDVIRSREQN----.......................................................----AFSDH.SDQVSRRMGFIPIPLSIMII.RVLS......QTFTL.DN..........................................................................................................................-L.ASIL.IF.VIGWLLLLAIKVCNGVIMLGQACEH--vk.....................................................................................................................................................................
A0A1X6ND26_9APHY/187-550               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.II.VS..I.IILAP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEVISH.R....................K............................................................................................................................................................................................................................................................................................................................................R................................................-PTSYIFR.PVVF.FALA.....L....V..YT.........VAHT....LV.M.....I....YSMISLNV.AV..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLCIVAFRNLIElngsafaftd...................................................................................gfalpksfgwFRG.NNALW..TISYPVLTVM..ASE.MGVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAVG-RRG.......................................................ARKHTYVDQ.SPLVARRLGFASLPLAVLAV.LIGS......QSVNL.LIsmhtdgsvpwiwt................................................................................................rplydisegelvnAA.KWAA.LV.VLVWCCTVVIKIILGVQLLGYATRRR-a......................................................................................................................................................................
I1PIC8_ORYGL/275-583                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................NATFELMR.FILD.EAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IT.SFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASLVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKTD-----.......................................................---------.--DRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrVF.WILL.WS.VLTYFMLAVFKILVGLVLRCLATWY--vn.....................................................................................................................................................................
A0A0Q3JNF9_BRADI/274-582               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................NATFELMR.FLLD.EAIA.....V....V..LL.........LVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLVNASLVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNE--------.......................................................--------Q.SDDRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpvgp..................................................................................................................fiwrTF.WILL.WS.VLTYFMLAIFKILVGLVLRCLATWY--vn.....................................................................................................................................................................
A0A1D1UQX9_RAMVA/188-495               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fpt---TSACEIIKGTI.IL.AG..V.WLFTF....V.DL......SV.MYHFLR...GQ..AVVKLYIMFNMLEV.................ADRLCSSFGQDI.LESLFWTAS.................................PATPPN.E....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KRMTRLG.ILPQ.IIIT.....L....L..YV.........LVHS....LV.V.....L....IQITTLNI.AM..NSQ.N..RALLVILLSNNFVEIKG...........SVFKKFEKKNLY.QISC..........S....DVRERFQ.....FV.ILLLMVIIRNMTE......................................................................................................lGWK.MDNFV..ACLPDGALII..ASE.VVVDWTKHAF....ITKFN..EIP..M.G.V.YQDYT.YSL..............AYDFATTQLD-----.......................................................--TNAFTDQ.SDAVVRRMGFVPIPLAIIVI.RIVY......QSFRF.DD..........................................................................................................................-W.RDWL.LF.GLGYVSLMATKMLINVHLLRWCYN---li.....................................................................................................................................................................
A0A1B9GCW3_9TREE/335-694               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pla----HQHSILRMLL.LL.IP.tV.ILLGA....T.DS......SK.MYHSVR...GQ..DTIKLYVIFNALEI.................ADRLCCAFGQDV.LDTLFARETls.............................psI--RKR.G....................-............................................................................................................................................................................................................................................................................................................................................K................................................GRKRQQAR.PVFF.FALS.....L....G..YV.........LAHT....LI.F.....F....YMLVSLNV.AI..NSY.D..YTLLSLLISNQFVEIKG...........SVFKKFEKENLF.QIMC..........A....DIVERFQ.....LS.LMLFVIALRNMIEmagsei..........................................................................................aflpksfIRG.KNLVD..SILSPVLFVI..VSE.MIVDWLKHAF....ITKFN..HVR..A.S.V.YERFT.DVL..............AKDVLLAGSSGNGRGrm...................................................kgRNHQVLLDQ.SPLVARRLGFASIPLACLVL.RVSA......QAIGM.LStsshhdeslnd...................................................................................................ltagdwvwtilkWT.SWTG.VG.LCAWGCLVFLKVILGLALLSFSAIR--qe.....................................................................................................................................................................
A0A1Y2FHM2_9FUNG/439-844               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................fkl---RHKSDLLKCLL.IL.FC..C.IFLQY....I.DV......SR.LYHFIR...GQ..NIVKLYLIYNLMEN.................FDKLCSAFGHDV.LDSLLAENI.................................IKKSNK.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................---GSRFP.LIVH.FIVS.....L....A..YL.........ILHT....VV.L.....F....YLVVSLNV.AI..NSY.N..NALLSFLISNQFGEIKS...........SVFKRFERENLF.QLTC..........S....DIVERFQ.....ML.VFLTIITSRNFLElsgtgaetlshfytlfsksilspasfssmipk.......................................ldilqtfhssnfpefcekivnlivtkltnfinSPT.YQLLA..VLITPVVVIY..GSE.MFVDYLKHTF....ITKFN..QIK..P.S.V.YNKYR.DSL..............CKDFAGNKKYS----.......................................................--DNQILDR.SGYVSRRIGFVTLPLACLTI.RIFM......QTLKM.FGylyidgerlhgfsiqnf.......................................................................................fnddgtinvkfakhalinYV.MIFI.LI.MIIYICVLVFKLYLSLYIHKISYKR--lq.....................................................................................................................................................................
A0A091JFF5_EGRGA/89-393                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A024GSK8_9STRA/837-1065              ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....M....IEVVTVHV.AI..NSS.N..SSLLTLLISNNFAELKS...........CVFKKFEEQNLF.QVSC..........S....DIVERFK.....LL.LFLVLILLQSMTR.......................................................................................................---.-----..DAFYGTAMVM..LAE.MVIDWLKHAF....ITKFN..QIS..P.L.V.YSKFT.TIL..............CHDLTGWQNSN----.......................................................----TILDH.THHVSKRLGLLSLPLACVVI.RMLL......KTMCS.RFkqnpfnsdvsdpleiph........................................................................................giaafdiliapllatwsYL.PSIL.IF.FVSFLCLAALKMLLSLSLFIFAINAK-q......................................................................................................................................................................
S8BNT2_DACHA/396-802                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPNHKADLLKGAV.VI.FS..C.WILME....F.DA......SR.MYHSIR...GQ..NAIKLYVIYSVLEV.................GDKLLSAIGQDI.FECLFSRES.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--TSKVLR.PFGF.FLLA.....L....A..YN.........VLHA....TA.L.....F....YQVITLNV.AV..NSY.S..NSLITLLLSNQFVEIKT...........TVFKRIEKENLF.QMTC..........A....DIVERFQ.....LW.LMLIIIASRNLVEigldgllgvggfgltglvsaaglg......................................................mppttsvpnastasstsgmilpksfTIL.PKWTG..QVMGPFLLVL..GSE.MLVDWLKHAY....ITKFN..NIK..P.Q.I.YSRYF.DVL..............AKDYYTH--------.......................................................----AFAEE.N--LMRRLGLPVIPLACLFI.RSSL......QTYQM.FIsthfpspsfpitatndhttssspattaa.................................................................lhefdsvlqrafngaageggrdilntiteYV.TIAT.IF.VGIWLVFLVFKFILGMSLLAVARQRYK.......................................................................................................................................................................
H2PCZ0_PONAB/125-429                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FFHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..GSE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVIT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0D0BPM7_9AGAM/200-564               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRMML.LV.VS..I.MVLIP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.LDCLFSRST.................................LEVLSR.R....................-............................................................................................................................................................................................................................................................................................................................................V................................................PVTSNTLR.PFVF.FGLA.....T....L..YI.........VCHA....LV.M.....I....YQLLSLNV.AV..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LS.LMLLIVAFRNLIElsgsefdftggf...............................................................................vlpmsfgwfignNVL.WTISY..KLDQPVVTVM..ASE.ILVDWLKHAF....ISKFN..HIR..P.S.V.YERYT.DVL..............CRDLTSGSAIG-RLG.......................................................ARKHGYVDQ.SPLVARRLGFASLPLAVVVI.LVGL......QSLTL.VFslrfedewgwd...................................................................................................almdmtnaevvhLL.KWAV.MG.VAFWLCFLALKVLLGVNLISYAARR--ql.....................................................................................................................................................................
A0A443RW81_9ACAR/3-198                 .....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ilnstgakg--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-EKRKHLG.VIAH.LIMT.....I....V..Y-.........-THS....IL.V.....L....LQATTLNV.AI..NSN.N..KALLTIMLSNNFVELKG...........MVFKKLEKNNLF.QIRG..........N....DVKERLH.....YC.IVLKVVIIQTMKE......................................................................................................fSWN.EEQLR..ILIPNCVGVL..IAE.VLVDSLKHDF....ITRFN..EIY..H.D.V.YQDYS.TSL..............AYDLACSKL------.......................................................--ISAYSDY.SDHISRRMGFIPFLLALIVF.RIF-......-----.--..........................................................................................................................--.----.--.---------------------------sn.....................................................................................................................................................................
A0A397YPZ9_BRACM/279-587               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--SSELSDLACFLV.LA.SG..T.ILLGR....T.DI......SL.IYHMIR...GQ..STIKLYVVYNILEI.................FDRLCQSFCGDV.FGALFSSAAg...............................lA--ISP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................KLRFCTWR.FVSD.LALT.....M....V..AS.........ILHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........SVFKRFSKDNIH.GLVY..........A....DAIERFH.....IS.AFLVSVLAQNILE.......................................................................................................-AE.GPWLG..NFIYNATMVF..FCE.MMIDIIKHSF....LAKFN..GIR..P.I.A.YSEFL.QAL..............CEQTLNIRPED----.......................................................---------.---RKTNLTFVPIAPACVVI.RVLT......PVYAA.HVpcsp..................................................................................................................lpwrVM.WMVF.LF.VITCIMLTSLKVLIGMGLRKHATWY--in.....................................................................................................................................................................
A0A2A9M1U3_9APIC/2890-3207             ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAPADVCALVRFSL.LV.AS..V.SLFML....L.DT......SR.IYHYIR...AQ..PFMKLYVVFNMLEL.................FEKMWRSLGRDV.IDALMRTTW.................................-----W.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................-RSYQWRL.WVFQ.YFLV.....L....G..YV.........LVHT....FM.H.....L....VRVLSLNI.AI..NSS.E..SAMFLIVVTNNFGEIKS...........TVFKKFCSTTLY.SIVA..........A....DVVERFQ.....LC.CDAFIVSLKLATA......................................................................................................aSPR.ATSLA..AVCSWLCGVF..LLE.IAVDWVKFLS....LVKFN..NIR..A.T.A.FEQYQ.RVL..............LADVLLSRVPQAQAHllps...............................................tsfkVPCRRMYAF.SHIPTRRIGFMELPIVTLIV.ACLP......VVSWT.ST..........................................................................................................................--.STLV.CA.FFGWVCLFVSKVVLSLMIVAFATKRRK.......................................................................................................................................................................
A0A1V6QFZ1_9EURO/494-920               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILTGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVIR.PFWL.FLVA.....L....V..YT.........VSHS....LS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFRKFEKDNLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgnlglassfpgqsstitnstpl.............................................stpprtassilpqaftlfpssilssfnsvNSF.IPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NNR..P.A.I.YGRFL.DVL..............AKDYYTN--------.......................................................----AFGEQ.N--LTRRIGLPVIPLSCIFF.RVSV......QTYQM.FLaallpqhpsstamgatsltsihnnyapspvpsap......................................................pltlatllpasaahvsalfrtllenaipspaqsvHI.FTGI.LL.LTGFIVLLILKLLLGMALLAFARSRY-s......................................................................................................................................................................
A0A397U416_9GLOM/104-391               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ln--ISQKSDLLKGVL.II.LV..C.ISLQS....V.DA......AQ.MYHSIR...GQ..SVIKLYVIFNVLEI.................FDKLCCAFGGDI.LDSLFSKST.................................LGDKKS.T....................-............................................................................................................................................................................................................................................................................................................................................-................................................SNTNGHLW.PISH.FCAA.....Y....G..YI.........LFHT....II.L.....F....YLAITLNV.AI..NSY.S..NALLTLLLSNQFIEIKG...........SVFKRFEKENLF.QLSC..........S....DIVERFQ.....LA.LFLTVITVRNLIElsgsptspf....................................................................................silptsfiplFPA.MTTLE..TLLTPVIIVF..ASE.LMVDWLKHAF....ITKFN..QIR..P.S.I.YDRYI.DIL..............SRDLVDGNVQK---S.......................................................ENQKKFADS.SLMVSRRIGFAALPLACLV-.----......-----.--..........................................................................................................................--.----.--.---------------------------sf.....................................................................................................................................................................
A0A287N3M5_HORVV/270-502               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQVI----------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------r......................................................................................................................................................................
A0A423VWT2_9PEZI/90-522                .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSFHKADLLQGLI.II.CS..S.IALMN....L.DA......SR.MYHFIR...AQ..SAVKLYVIYNLVEV.................GDRLLSALGQDI.LECLFSSET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVML.PFGM.FLLS.....L....T..YN.........CAHA....IT.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........SVFKRFEKENLF.QITC..........A....DVVERFQ.....LW.LVLLIIGMRNVVEvgglsipaagvglgddtm..................................................................atakvplhshsilpmsftiLPS.WLWSG..EVLSPFLIVI..GSE.MLVDWIKHAY....INKFN..NIK..P.N.F.YNRIL.DIL..............CKDYYTNVSTVNDSHshl.................................................gisDALQAFVTP.S--LTRRLGLPLLPLSTLFI.RASF......QTYHM.FLathlpapvppssqtslsvesstasspavtaaldrldsi.............................................irnalgrsvygfdgdltntttsntsnfsflfwstddviaLV.TMLL.VF.FIAYLVLLILKLLLGMILLRYSRDRY-a......................................................................................................................................................................
A0A068RSS7_9FUNG/216-605               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-RPSQKCDLLKGFL.AM.IT..C.TVMSM....L.EP......SR.IYHSIR...GQ..AVLKLYVIFNCLEV.................FDKLCCSVGNDI.LDALFSKSTlg.............................nqL----Q.N....................T............................................................................................................................................................................................................................................................................................................................................Sas............................................stVYAKRQLR.PITL.FILA.....T....G..YM.........ILHT....SV.L.....F....FEMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........SVFKRFEKENLF.QLSC..........S....DMVERFQ.....QV.AFLLIITLRNVVElsesspssi....................................................................................lpstfvplikLPA.TATVS..ALMTPVMMVI..ASE.LIVDWLKHAF....ITKFN..QIR..P.S.I.YGKYI.DVL..............CKDLVVGSPG--RLS.......................................................GRRNAFVDQ.SPVVSRRIGFPALPLACLIV.RMFQ......QLMPM.IMgnsnggeqgsttlasilarnfldft........................................................................vflpshvvhalrdgwletvfdhaiqFV.GRII.VI.GVLLICLLAVKVFVGINLLGFAYRRY-a......................................................................................................................................................................
A0A2J5I289_9EURO/564-988               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.MI.AT..C.VVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....G..YT.........VTHA....TS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgalnfigelgtsfsgqattstnstpls...............................................tpprmassilpqsftivpssiiasfshvNSF.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.M.YHRFL.DIL..............AKDYYTN--------.......................................................----AFGDP.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLtallpqqpsstavdstslssihsqyapspqpslp......................................................pltlrtilpasaahagaffrqvlanaiptpaqsvYI.FTVV.LL.LTGFVLLLIVKLLLGMVLLTYSRGRY-k......................................................................................................................................................................
R1DFC0_EMIHU/125-247                   ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lvqfvfvqkeeltaarlhe--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.--VDWIKHAF....VTKFN..RMR..P.D.V.YAKFT.RIL..............CADTAASATTQER--.......................................................EPLANVAAR.R---GSADPFTHSSVTVSLL.TVLP......TLALH.HS..........................................................................................................................--.SGPL.LL.LLTWLLFCALKLLISI-----------aeeak..................................................................................................................................................................
A0A1M2VXF6_TRAPU/220-581               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRAML.LV.VS..V.VILAP....MtDA......SK.IYHFIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.IDCLFSRST.................................LEVISH.R....................K............................................................................................................................................................................................................................................................................................................................................R................................................-PTSHSLR.PFFY.FLLA.....V....S..YT.........VAHA....LV.M.....I....YQMICLNV.AV..NSY.D..NALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LV.LMLVVVAFRNLIElsgstfdfse...................................................................................gftlpksfgwFRG.NNVLW..TISYPVLTVL..ASE.TLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLSSGSAV-SRRG.......................................................AQKHTYVDQ.SPLVARRLGFASQPLAVLAV.LIGT......QSIGL.FIsmhadesspwlr..................................................................................................pweaytpddwinVA.KWGA.LA.VLFWACFLVIKIILGVQLLTYATRRR-a......................................................................................................................................................................
A0A179UL79_BLAGS/554-980               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNDKADILKGFL.MI.CT..C.LILMY....F.DA......SR.VYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFWL.FIIA.....L....I..YT.........VIHS....VS.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgifsfgsglslfagskptpsanatsfa...............................................tpprtassilpqaftilpssllsslskvNSF.LPTIG..HLLGPFLVVL..GSE.MIVDWLKHAY....INKFN..NIR..P.A.L.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LNRRLGLPVIPLACLFF.RVSI......QTYQM.FLtswlpqtpslvtqsnttsltsihdryspspspsps...................................................filplhpldpsfltklsslfqtmiahatpspaafipIF.TTIL.-V.LLLYLTLLFIKLILGIILLSYSRARYK.......................................................................................................................................................................
A0A1V6SNK5_9EURO/484-909               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILTGLL.MV.AT..C.CALMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAALGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIFR.PFWL.FLLA.....L....G..YT.........VAHS....TS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFRKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafsfigdlglgtsfsgqttstnstpl..............................................stpprtassilpqsftffpssilssvssvNSF.LPTLA..QVLGPFLVVL..GSE.MFVDWLKHAY....INKFN..NYR..P.A.L.YGRYL.DVL..............AKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FLasltpqhpsstamestslssihnhyapapmpstp......................................................pltfqtfipvsvahvnalfrtllanaipspaqsvQI.FTAI.LL.LTGFIVLLMLKLLLGMLLLAFARSRYK.......................................................................................................................................................................
A0A445I6Z5_GLYSO/221-527               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--TIELSDFGCFLI.MI.CG..V.VVLQQ....I.DI......SL.IYHMIR...GQ..ETIKLYVIYNMLEI.................FDKLCQNFIGDV.LPMLFHSAE.................................EFARCP.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................PETESMKF.WIWR.FISD.....Q....V..LA.........VVAS....NI.L.....F....LGAITLSA.CI..VSH.Y..NALPALLVSNNFSEIKS...........YVFKGYSKDNVH.SMVY..........S....DSIERFH.....IS.AFVLFVLAQNILE.......................................................................................................-AE.GPWFG..SFISNILLVY..LFE.MAIDVIKHSF....IAKFN..NIS..P.V.A.YSEFL.EVL..............CKQTLHMQTE-----.......................................................---------.--DAKKKLTFVPLAPACVVI.RVLA......PVYAA.SLpynp..................................................................................................................lpwrLF.WILL.FS.AITYIMLTSLKVLIGMVLRKHARC---tke....................................................................................................................................................................
G0W6C7_NAUDC/129-438                   ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ltkt-----YKERCLVFL.IG.VS..S.MFLSK....L.NT......SI.IYHRIK...RQ..SAMKLYMLFSVLEM.................ADILLASMGQSL.SAVVLSRIG.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-YGRKIYQ.KGLL.ISLS.....V....I..YI.........LLHG....YV.L.....V....YQAVALNV.AV..NSY.S..NSLLTLLLSMQFAEIKS...........AVLKKFDKEGLF.QITI..........A....DAVERFK.....LF.LLLMIIILRNISAnpiglp...........................................................................................tswsfkKSS.TVLMN..FLSGPFISVI..GSE.IIVDWVKHAY....INKFN..RIR..P.E.I.YDKFF.YIT..............YNDHTTS--------.......................................................---------.LRKFQDRMGLPIPAFVVLFI.VMVR......PTLFQ.IFqqs...................................................................................................................nfplIT.QSII.IL.IFSFWILVMMKFILHTILEKWGVQ---iqk....................................................................................................................................................................
W4K7G8_9AGAM/118-510                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRTLL.LA.LS..I.MILVP....LtDA......SK.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCASIGQDI.IDCLFSRST.................................LLLLSR.R....................-............................................................................................................................................................................................................................................................................................................................................V................................................PLSTHTLR.PILF.FGLA.....T....L..YI.........VVHA....LV.M.....V....YQLLCLNV.AI..NSY.D..NALLSLLMSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LC.LMLFFVAFRNLIElsgsefdfse..................................................................................gvflpksfgwfRGG.SNVLW..TISYPVMTVM..LSE.TLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASGSAFG-RLG.......................................................ARKHTYVDQ.SPLVARRLGFSALPLAVLTI.LIGS......QAVSL.VLsssfahgtsmprlsnltnliwrlsdve....................................................................wwkwaresaweellqrgrvvdweavvrWA.KWGT.LG.LTIWICFVVIKIIMGVNLVSYATKRK-a......................................................................................................................................................................
A0A1X2HQM7_SYNRA/224-607               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-RPSQKCDLLKGFL.II.IT..C.CVMWT....L.DP......SR.IYHTIR...GQ..AVLKLYVVFNVLEI.................FDKLCCSVGQDI.LDALFSKSTl..............................gnP-AQAL.G....................G............................................................................................................................................................................................................................................................................................................................................A................................................AYAKRQLR.PITL.FLLA.....T....V..YM.........SIHT....SV.L.....F....LQMITLNV.AI..NFY.S..NALLSLLISNQFVEIKQ...........AVFKKFEKENLF.QLSC..........S....DVVERFQ.....QF.AFLLIISLRNVIElsesspssi....................................................................................lpstfvpifkLPA.TTTLN..ALMTPVLMVV..ASE.LLVDWLKHAF....ITKFN..QIR..P.S.I.YEKYI.DVL..............CKDLVIGSPGR--TS.......................................................GRRNAFVDQ.SPVVSRRIGFPALPLACLHV.RMVQ......QLLPM.MFaphssqssstgditaltgfllkt............................................................................igsvfpnqaasewlehgldqgvrLL.SQFI.VL.AILMVCLLALKVLVGINLLGHAYKRY-a......................................................................................................................................................................
A0A0E0KI88_ORYPU/414-534               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lna--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..------SLVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............CKQILNDKTD-----.......................................................---------.--DRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrLF.WILL.WS.VLTYFMLAVFKILVGLVLRCLATWY--vn.....................................................................................................................................................................
B6H6D7_PENRW/429-804                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILTGLL.MI.AT..C.CVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIIR.PFWL.FLVA.....L....V..YT.........VSHA....LS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFRKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtga................................................................................................fnsvNSF.IPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NNR..P.A.I.YSRFL.DVL..............AKDYYTN--------.......................................................----AFGEQ.N--LTRRIGLPVIPLSCLFF.RVSV......QTYQM.FLaallpqhpsstangatsltsihnnygpspipsap......................................................pltfatllpasaahvsaffrtllenaipspaqsvHI.FTGI.LL.LTGFIVLLILKLLLGMVLLAFSRSRYR.......................................................................................................................................................................
A0A3G2S3S5_9BASI/240-591               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lt--ISNKCDILKGLL.VW.QT..C.YILSH....VaDA......SK.MYHSVR...GQ..DVLKLSVIFSVLEI.................SDRLCSSFGQDV.LDTLLSRYT.................................LGRRAD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SHAYLR.IAGY.YALC.....L....A..YM.........IFHT....FV.L.....L....YQLVTLNV.AI..NSY.D..NELLTLLLSNQFVEIKT...........TVFKRFEKETLF.QLAC..........A....DVVERFQ.....LG.VTLGTIGLRNLMElsgasamggtg.................................................................................algplptsfevYPY.VNVLF..RTLNPVLTVL..ISE.VLVDWLKHAF....IAKQN..HIR..P.A.V.YGRFV.DVL..............CRDILPPQSSVAMDGy.....................................................tQRQSSFVDQ.SPLVIRRLGLAVLPLVCVLI.RMAS......QVVYM.FLpkerts..............................................................................................................feyviqTT.AVFF.ST.LAVWLSLIVFKLLLGSYLVSYAKQRY-a......................................................................................................................................................................
A0A096NZH3_PAPAN/155-459               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LI.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSVKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A182VRU2_9DIPT/572-876               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAPAEICDLLKGTI.WI.IC..S.YTLLY....V.DT......NM.LYHMIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKRQHLG.TIPH.FLFA.....I....V..YV.........TMHS....VL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........S....DVRERFH.....LS.VLMLIVLIQTMKE......................................................................................................fSWK.PEQFF..VMFPDCVYVM..FTE.CVVDWIKHAF....ITRFN..EIP..C.D.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPYPLGVILV.KALY......HALSF.DN..........................................................................................................................-A.GSIV.IL.LVAFLALLSARVLNTICALGKAC----dltq...................................................................................................................................................................
A0A3B4V7L2_SERDU/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----vfvk...................................................................................................................................................................
A0A482VFV2_9CUCU/1-177                 ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------FVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERFH.....LI.VLLSIVVLQTMRE......................................................................................................ySWK.SDRLW..VLVPDCLIVL..IAE.MFVDWIKHAF....ITRFN..ELQ..L.D.V.YRDYT.TSL..............AYDMAQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPLPLGVVMI.RVLA......SAIHI.ND..........................................................................................................................-V.ASVI.LF.FLAYFCLASFKVLNSLLILGKACD---lit....................................................................................................................................................................
F9FMG0_FUSOF/457-865                   .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.MALMT....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILEV.................GDRLLSALGQDI.LECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FMLA.....L....V..YC.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFQ.....LW.IMLFIIGMRNVVEvgglsvpgagsesyde......................................................................tsvphhspsilphsftvLPS.WLMSG..EVLSPFFIVI..GSE.MLVDTIKHAY....VTKFN..NIK..P.A.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFMTP.S--LTKRLGLAVIPLSCLFI.RASI......QTYHM.LLsthlpmpmpmpipqstqtslseesatpsspamiaaln...............................................rfdslirdslgratygypygsplnsrpwyswtsddfiaAV.TMVV.VF.FIAFLVLLILKLLLGMVLLKYSRNRY-a......................................................................................................................................................................
A0A1Z5TB65_HORWE/439-848               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADILQGLL.II.TT..C.IFLMR....F.DA......SR.MYHFVR...GQ..SAIKLYVIYNVLEV.................FDRLFSAIGQDI.LECLFSKET.................................LERNEE.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVSQ.PLWM.FLGA.....L....V..YN.........VLHS....TA.L.....F....FQVVTLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKEALF.QITC..........A....DIVERFQ.....LW.LMLLIIALRNIVEvgglsisintafadtgsstd..............................................................tysantthlpllagfavpkafTLV.PKFCG..EVLGPFLIVL..GSE.ALVDWIKHCY....INKFN..NIK..P.K.V.YGRFL.DVL..............AKDYYSH--------.......................................................----AFADQ.N--LTKRFGLPVIPLSCLFI.RACI......QTYHM.FLathvpipipsvatavsveneaaatspatkaalqh......................................................idrvfrraigrssfgagadptsafswwsiddviaLA.TMII.FF.LALYLVLLACKLLLGMLLLSCARSRYK.......................................................................................................................................................................
A0A1L9TXZ8_9EURO/1110-1540             ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MV.TT..C.TVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKIFR.PLGL.FLLA.....L....A..YT.........VIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........SVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNMVEtgafqfgdsllstsasgaapvtnstpls...............................................tppksstsilpqaftlvpssvmasishvNSF.LPALA..QVLGPFLVVL..GSE.MFVDWLKHAY....INKFN..NTR..P.N.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPIIPLSCLFF.RVSV......QTYQM.FLaallpqspplspsssvavettslatihsqyvpagpvp................................................spppitlgnilpataahasvwfrralanampspahsvYI.FTVV.LV.LTGFVLLLILKLLLGMLLLTYSRSRYK.......................................................................................................................................................................
A0A0C3S780_PHLGI/218-578               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADILRALL.LI.IS..I.IILSP....LtDA......SM.IYHSIR...GQ..DTIKLYVIFNALEI.................ADRLCGSIGQDI.IDCLFSRST.................................LEVISH.R....................K............................................................................................................................................................................................................................................................................................................................................R................................................-PTSDILK.PFFY.FLLA.....L....V..YV.........VSHT....LV.M.....I....YQMISLNV.AV..NSY.D..HALLTLLVSNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFT.....LA.LMLLVVAFRNLIElsgssfnfse...................................................................................gfalpksfgwFRG.NNVLW..TISYPVVTVM..ISE.MLVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLASASGV-SRRG.......................................................ARKHTYVDQ.SPLVARRLGFASLPLAVLAI.LIGS......QSVVL.LVsmhtddaaprk...................................................................................................vvgslsnddwvnVG.KWMA.LA.TLFWVTFVVIKLILGVNLLSYATRRR-a......................................................................................................................................................................
A0A1V2L7Z8_CYBFA/120-447               .......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lrivnfk-------NLVFASL.II.LS..-.IVFAN....V.DT......SR.IYHTIR...AQ..SSIKLYVMFGVLEV.................SDKLLSTVGQDL.LNYIFSQDP.................................LVL-MR.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................RHPRLIAR.YTVF.YLLS.....L....L..YL.........TAHT....TT.L.....V....YQTIALNV.AA..NSY.S..NSLVTLLLSNQFAEIKG...........SVFKKLDREGLF.QMSC..........A....DVVERFQ.....LF.IMLSIISLRNMVQigadpns........................................................................................gllpnstlEKF.NKWFG..VLLGPTTIVI..GSE.LLVDWVKHSY....VTKFN..KIR..P.T.I.YRKYL.DIF..............SSDVIDNFRTQ----.......................................................----VSSND.PDRVQQRIGLPLPALFVLFI.VMSR......HSIQW.LFvde...................................................................................................................qkniII.PNMI.IG.IIAYFLLLLIQLLLELGLLKIST----ill....................................................................................................................................................................
A0A196SEK1_BLAHN/176-403               ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................yrsy-----VFDFVRLIL.VF.WG..C.FIISF....F.DM......SY.IYHYIR...SI..SGFKTYLIMNILGT.................FDHLFTSIEHNV.SDALFHSLR.................................Y-----.-....................-............................................................................................................................................................................................................................................................................................................................................K................................................PSVKSFFR.FLLD.FFFS.....L....I..FV.........SILA....SV.K.....F....LSFMTFNV.TL..DMN.P..QTNVIYIISRKFKYIRK...........TLYKKCDEMNLF.DHSC..........R....DIEERLS.....FL.I---NVVLSLCVL.......................................................................................................TYT.NGFQL..EFVYEIALLY..LVD.WAMVVLKHMI....LLKQN..RWP..P.E.I.YNNYT.ALL..............KRDVL----------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------ftilh..................................................................................................................................................................
A0A182XIS9_ANOQN/167-471               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAPAEICDLLKGTI.WI.IC..S.YTLLY....V.DT......NM.LYHMIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKRQHLG.TIPH.FLFA.....I....V..YV.........TMHS....VL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........S....DVRERFH.....LS.VLMLIVLIQTMKE......................................................................................................fSWK.SEQFF..VMFPDCLYVM..FTE.CLVDWIKHAF....ITRFN..EIP..C.E.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPYPLGVILV.KALY......HALSF.DN..........................................................................................................................-A.GSIV.IL.LVAFLALLSARVLNTICALGKAC----dltq...................................................................................................................................................................
F0UUA0_AJEC8/511-937                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNDKADILKGFL.MI.CT..C.LILMY....F.DA......SR.VYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFWL.FIIA.....L....I..YT.........VIHS....AA.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgifsfgsglslfagskpaananatsvf...............................................ntqratssilpqaftilpssllsslskvNSF.LPTIG..HLLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.A.M.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LNRRLGLPVIPLACLFF.RVSI......QTYQM.FLtswlpqtqsfvapsnttsltsihdhyspspspspp....................................................filplypldaslftkvsslfqtmiahttpspasfiPI.FTII.LV.LILYLTLLFTKLILSIILLSYARARYK.......................................................................................................................................................................
A0A146F8I1_9EURO/529-953               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-MPDDKADILKGLL.II.ST..C.CVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VIHA....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLLC..........A....DVVERFQ.....LW.LMLTIIASRNLVEtgafnalgslsfslggytstgtnstpls...............................................tpprtsssilpqaftivpssiiasfsqvNTY.LPTLA..QVLGPFLVVL..GSE.MLVDWLKHAY....IGKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFADQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.FItallpqqpsstaveattlsaihsqyvpapmpspp......................................................pltlrnfiptstayvgaffrqllantmpspaqsvYI.FTIV.LI.LTGFVVLLILKLLLGMVLLAYARSRYK.......................................................................................................................................................................
I3IYF3_ORENI/118-422                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDMLRGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDNIG.VIPH.FFMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVFMVV..TSE.VAVDVIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----ACTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVRL.QG..........................................................................................................................-A.LSYT.CV.LLFYLGLVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A0B4LH99_DROME/166-470               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEICDLLKGVI.WM.TV..T.LIMLL....V.DT......NR.VYHIIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................---EPK.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................-SKREHFG.VLTH.VLFT.....L....I..YV.........FLHS....GL.I.....M....FQATCLNV.AV..NSN.N..KGLLTIMISNNFVELKG...........SVFKKFDKNNLF.QLTC..........S....DVRERFH.....LS.VLLFIVVIQTMKE......................................................................................................fDWS.ITQFC..VMLPDCFAVL..FTE.ILIDWVKHAF....ITRFN..ELP..E.S.I.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPFPLAVVLI.KAIY......TAVSF.EN..........................................................................................................................-L.AAWL.LF.LLAYLFAMGLRICLTICALGKACK---lmk....................................................................................................................................................................
A0A091W4G3_OPIHO/90-394                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..AAE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-V.LAYV.CV.VLFYCGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A287N3T0_HORVV/301-457               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------yg.....................................................................................................................................................................
A0A095CDV6_CRYGR/399-626               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................v--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........SVFKKFEKENLF.QIMC..........A....DIVERFQ.....LS.LMLAVIAIRNMIEmsgsei..........................................................................................aflpksfMKG.KSLVD..SILSPVLFVI..MSE.MVVDWMKHAF....ISKFN..HVR..A.S.V.YERFT.DVL..............AKDVLLAGSITSSSSrrhr...............................................dgksRNHRILLDQ.SPLVARRLGFASIPLACLVL.RISW......QAIGM.LTmshshpeesefgd...............................................................................................ggeeglwgmvwwglKV.ASWI.GT.LKGKNSLVFLKIILGLSLLGFSAMRQ-e......................................................................................................................................................................
A0A3Q1I2Y6_ANATE/148-452               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.IC..Y.SMMSY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHFW..VLFPDVVMVI..ASE.VAVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSC----mfvk...................................................................................................................................................................
G8B5I0_CANPC/247-577                   ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lnsi-----KKDVVTLSL.IA.LA..L.FVLFSg..kL.DI......SK.MYHDVR...GQ..ADIKLYVMFGVLEV.................AEKLCSSIGQDI.INILFHISP.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--LDQMGR.FITF.YLIS.....V....F..YL.........SFHA....YI.L.....I....YQCVSLNV.AA..NSY.S..NALLTLLLSNQFAELKS...........SVFKKLDREGLF.QITM..........A....DLSERFQ.....LS.LMLAIIAVRNLLQlnsahg...........................................................................................lipdswKKW.NIWLG..AIFGPGVVVI..GSE.IFVDWLKHCF....ISKFN..KIK..P.R.V.YRNFL.YVS..............CLDFMQVFQTSSQSE.......................................................SGKSHEFTD.FIVLTRRIGLPLLASAVCFL.RMTI......GDFKQ.IFiiqcs................................................................................................................tnvrtVL.ASIV.FF.TTTIFTLLLIRIILVLLIFKIASR---lve....................................................................................................................................................................
B2VW91_PYRTR/519-925                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PSHKADILKGLL.VI.AS..C.FVLMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAVGQDV.LECLFSRET.................................LDRNPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PLGM.FVLA.....L....V..YT.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DVVERFQ.....LW.LMLLIIAMRNVVEvgglsiqssdtswtamftg................................................................sanassgtafkassiipmsfTIF.PKYIA..QVLNPFLLVL..GSE.MFVDWLKHAY....ITKFN..QYK..P.E.V.YSKFF.DVL..............AKDYYSN--------.......................................................----AFADA.D--LTRRLGLPVIPLSCLFI.RAAI......QTYHM.FIamhmppplhatstsltsdptsspvttaalahid.......................................................hvfrralgrssfgagipsqvwynplsynfddliaGS.TMLI.VF.LIIYLMFLAFKLVLGMLLLSVSRKRY-h......................................................................................................................................................................
G3JCG0_CORMM/763-1173                  .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STYHKADLLQGAV.IL.CS..S.FALMR....L.DA......SR.MYHFIR...AQ..SAIKLYVIFNILEV.................ADRLLSAIGQDI.LECLFSAET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILL.PLGM.FLLA.....L....A..YN.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFEKDNLF.QLTC..........A....DVVERFQ.....LW.IMLLIIAMRNIVEvggfsvpgagvgemdidg..................................................................ngsgvplhhpsslphsftaLPS.WLWSG..EVLSPFLIVV..GSE.MLVDTIKHAY....VTKFN..NIK..P.H.F.YSRTL.DIL..............CKDYYTH--------.......................................................----AFASP.S--LTRRLGLAVIPLSCLFI.RASV......QTYHM.FLasylpmplpqstqtslaeesarpsspammaalnrfd.................................................alirdslgratygpptgsafhhtvrpwyawtsddliaAL.TMVV.VF.FIAFLVLLILKLLLGMALLKYARGRY-a......................................................................................................................................................................
A0A251R761_PRUPE/288-523               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--AAELSDFGCFTI.MA.CG..V.TLLEQ....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNPDV.LQTLFNSAE.................................GLASCP.P....................-............................................................................................................................................................................................................................................................................................................................................E................................................NMRFWIWR.FICD.QALA.....V....A..AS.........IIHS....FI.L.....L....AQAITLST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRYSKDNIH.SLVY..........F....DSVERFH.....IS.AFVLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLSNALLVY..VCE.MIIDIIKHSF....IAKFN..DIK..P.I.A.YSEFL.EDL..............CKQVF----------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------ymyl...................................................................................................................................................................
E5AES4_LEPMJ/35-441                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPTHKADILKGLL.VI.AS..C.FVLMP....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAVGQDV.LECLFSRET.................................LDRNPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKILR.PFAM.FALA.....L....I..YT.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DIVERFQ.....LW.LMLLIIAMRNVVEvgglsiqssdtswtamfts................................................................anastatttftaskiipmsfTIF.PKYIA..QVLNPFLLVL..GSE.MAVDWLKHAY....ITKFN..QYK..P.E.V.YGKFF.DVL..............AKDYYSN--------.......................................................----AFVDA.N--LTRRLGLPVIPLCCLFV.RAAI......QTYHM.SIamymppplptmstsltsdsmsspsttaafdhid.......................................................rvfrralgrssfgagapaqawyypsswslddliaGS.TMLL.VF.LILYLIFLACKLLLGMLLLSISRKRY-h......................................................................................................................................................................
A0A3B1JHW8_ASTMX/387-453               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................dy--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.SDSVARRMGFIPLPLAVLLI.RVVI......SSVKI.QG..........................................................................................................................-A.LSLV.CL.LLFYLGLITLKVLNSIILLGKSCKYV-k......................................................................................................................................................................
A0A2A4J823_HELVI/141-444               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKPAETCDMLKGFI.LV.IC..S.ILMCY....I.DT......NM.MYHLVK...SQ..SVMKLYIFYNMLEV.................GDRLFSAFGQDT.IDALFWTAT.................................E---PR.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................DRRREHLG.VIPH.LLFA.....M....I..YV.........FLHS....LL.V.....L....FQATTLNV.AF..NSN.N..KSLLIIMMSNNFVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERLH.....LS.VLLFIVVLQTMKE......................................................................................................yMWR.EERFW..ILAPDCVLVL..TFE.VIIDWVKHAF....ITRFN..EIP..Y.G.V.YREYT.VSL..............AYDVAQTRQKY----.......................................................----AFSDH.SDLVARRMGFIPLPLGVVIT.RVLV......HAVKV.DG..........................................................................................................................-F.AAIF.LI.SIAYLCLISVRVLVSIVILGKAC----dli....................................................................................................................................................................
A0A368H075_ANCCA/156-507               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................w-TSAETCDFFKVWI.IV.FG..S.ILMQH....I.DT......SV.VYHQVR...GQ..GVIKLYIFYNMLEV.................ADKLFSSLGQDI.LDALFWTAN.................................E-----.-....................-............................................................................................................................................................................................................................................................................................................................................P................................................KTFRSLVR.TLCH.FAFA.....L....S..YA.........TIHT....FL.V.....L....LQATTLNV.AF..NSH.N..QALLAIMMSNNFVELKG...........SVFKKFAKANLF.QMAC..........S....DVRERFH.....II.ALLFVVMVRNMMA......................................................................................................vNWS.SEHLR..EMMPDILMVV..GAE.LLVDWLKHAF....ITKFN..EIN..A.E.V.YRDFT.ITI..............AYDVVRSRDT-----.......................................................---SAFSDY.SDQVSRRMGFIPIPLSIMLI.RVLS......QTFTL.QS..........................................................................................................................-K.TSIV.IC.VIAWLLMVSIKICNGIVLLGKAC----vhvtaykelqaraeydlyrkrmvekksksapssprislidfsdvlhqtagvk...................................................................................................................
A0A067FBI0_CITSI/1-152                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................s--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....--IERFH.....IS.AFLLFVLAQNILE.......................................................................................................-AE.GPWFE..SFLFNALLVF..VCE.MLIDIIKHSF....LAKFN..DIK..P.I.A.YSEFL.EDL..............CKQTLNMQTE-----.......................................................---------.--NGKKNLTFVPLAPACVVI.RVLT......PVFAA.RLpctp..................................................................................................................lpwrLF.WILL.LS.AMTYVMLASLKVMIGMGLQRHATWYV-k......................................................................................................................................................................
A0A0C7MZB0_9SACH/114-427               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................vqn----TRKEFIMLFV.IA.CA..S.AILLK....V.DT......SQ.VYHRIK...GQ..SAMKLYMMFGVLDM.................CDKMLSSFGQSV.LLVVGSKSR.................................Y---KT.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--GPAALQ.TLAL.NICA.....V....A..YL.........TFHG....FI.L.....M....YETIALNV.AV..NSY.S..NSLVTLLLSMQFAEIKA...........SVFKRFDKEGLF.QITI..........A....DIIERFQ.....MV.VLLIIIGIRNLIAstssfsad.......................................................................................tpyswswsLAS.YTIMG..ALGGPVITVV..GSE.IFVDWVKHAY....ITKFN..RVR..P.Q.M.YGTFL.RIL..............CADHTHNL-------.......................................................---------.-QKFQSRLGLPVPALVVLFL.VMIR......PALEI.GLsei....................................................................................................................sssVI.RTFS.IV.AMSFVCLLLSKFVLHLALSKWSQ----tlq....................................................................................................................................................................
A0A2T5M7A1_9EURO/485-916               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.TT..C.SVLMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLFAALGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........IIHS....TA.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........SVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafqlgssllstsvsgaasttnstpls...............................................tppkssssilpqaftllpssiiasfshvHSF.LPTLA..QVLGPFLVVL..GSE.MFVDWLKHCY....INKFN..NTR..P.A.I.YGRFL.DIL..............AKDYYTN--------.......................................................----AFGNQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYQM.LLasllpqspslspsssiaaestslatihsqhvpaagpi...............................................pslapitlgnllpataahaealvrqvlanampspaqsvYI.FTIV.LV.LTGFVVLLILKLLLGMVLLACARSRYK.......................................................................................................................................................................
A8Q818_MALGO/321-700                   ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ln--VSNKCDILKGLL.VI.QT..C.YILSR....IaDA......SK.MYHSVR...GQ..DTLKLSVIFSVLEI.................SDRLCSSFGQDV.LDTLFSRRT.................................LARRSD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--SHAYLR.IAGY.YTLC.....L....A..YI.........VFHT....FV.L.....L....YQLVTLNV.AI..NSY.D..NQLLTLLLSNQFVEIKT...........TVFKRFEKENLF.QLAC..........A....DIVERFQ.....LC.VVLAAIGLRNLLElsgafamggtg.................................................................................amgplptsfelYPY.VNVFF..RTLNPVLTVL..LSE.VLVDWLKHAF....IAKQN..HLR..P.A.L.YGRFV.DVL..............CRDILPPRSSVALDGh.....................................................tQRQSSFVDQ.SPLAIRRLGLAVLPLACVSI.RMAS......QIVSM.LLvkdvhtssdpqraarataaa..................................................................................sstayhqrgwlrrwteqhsqAC.MVCL.GL.VFVWLALVLLKLLLGAYLVSYAMRQY-t......................................................................................................................................................................
A0A1J7IRN0_LUPAN/304-383               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STIELSDFGCFLI.MS.CG..V.ILLER....T.DI......SL.IYHMIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFNGDV.LKTLFHTAE.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------glsscppe...............................................................................................................................................................
G3PY11_GASAC/113-417                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMSY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVIMVI..ASE.VTVDVVKHAF....ITKFN..DIS..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-S.LSFM.CV.LLFYLGMITLKVLNSIVLLGTSCA---fvk....................................................................................................................................................................
A0A1U8BP41_NELNU/313-619               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ps--ASELSDFGCFIV.LV.LG..V.TLLQE....T.DI......SL.IYHMIR...GQ..GTVKLYVVYNVLEI.................FDRIFQNFGGDI.LQTLFSSAE.................................GLASSS.P....................E............................................................................................................................................................................................................................................................................................................................................-................................................NMSFWLWR.FISD.EALA.....I....F..AS.........IGHS....FI.L.....L....AQAITFST.CI..VAH.N..NALLALLVSNNFAEIKS...........NVFKRFSKDNIH.SLVY..........S....DSVERFH.....IS.SFLLFVLAQNILE.......................................................................................................-AE.GPWLG..NFLSNALLVY..ICE.MSVDIIKHSF....VAKFN..EIK..P.I.A.FSEFL.EDL..............CKQVLKF-TPE----.......................................................---------.--DRKKNLTFVPLAPACVVI.RMLT......PVYGV.HLpyap..................................................................................................................flwrLF.WIFL.LS.TTTYIMLASLKVLIGMGLQRFAI----ck.....................................................................................................................................................................
A0A0D3K0T4_EMIHU/1-164                 .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.--LLIVLVQFVFVq....................................................................................................keELT.AARLH..EVSHAFLMIC..VCE.IMVDWIKHAF....VTKFN..RMR..P.D.V.YAKFT.RIL..............CADTAASATTQ--ER.......................................................EPLANSLSH.CLPSAARMGFVPLPLFCLAI.RVFGne.alpT----.-Laitvl...............................................................................................................ptlalhHS.SGPL.LL.LLTWLLFCALKLLISIAVLGFAT----lhie...................................................................................................................................................................
A0A1D6GJ47_MAIZE/282-478               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSACS.T....................D............................................................................................................................................................................................................................................................................................................................................N................................................-VTFELMR.FILD.EAIA.....V....V..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKRVSKENLH.NLVY..........Y....DIIERFH.....IM.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFL-------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------ivslaffhl..............................................................................................................................................................
A0A453H804_AEGTS/292-563               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQPDDRQKDlt..................................................fipL--------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------apacvvseqamllccqfvctyftn...............................................................................................................................................
A0A167J9Z1_CALVF/185-520               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSSKADLLRMAL.VI.CT..F.LIMYQ....WsDT......SR.IYHSIR...GQ..DTIKLYVIFNAVEV.................ADRLLCALGQDL.MDCLFSKGT.................................LAPSTS.Q....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KALRRIR.TTGY.FFLT.....L....L..YS.........CAHS....MI.L.....I....YYLTSLNV.AI..NSY.D..NALLTLLLSNQFVEIKG...........SVFKKFEKDNLF.QVTC..........A....DIVERFQ.....LA.IMLFAIALRNLIEmrgsefs.........................................................................................vlpsafsTKA.SNKMW..AIISPVAQVL..VSE.VGVDWLKHAF....ICKFN..SFR..V.S.V.YDRFT.DVL..............CHDLISLRPSR----.......................................................--KHTFVDH.SPLVSRRLGLATIPLACVLM.RVTW......QALVI.LHqqvqq...............................................................................................................qrdpylWL.WWTI.FG.LTVWFSAVACKVLLGLHLLTYAARRR-a......................................................................................................................................................................
E2B9V9_HARSA/158-452                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LSPAEVCDLLKGVV.VV.GC..W.AATWK....V.DT......SM.MYHLVK...SQ..SVIKLYIFYNMLEV.................GDRLFSAFGQDT.IDALLWTAT.................................EPRSRS.S....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.---R.....R....Q..HL.........VLHS....IL.V.....L....FQATTLNV.AI..NSS.N..KALLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLSC..........S....DVRERFH.....LT.MLLLAVSLQTMKE......................................................................................................yAWH.SDRLA..VLLPDCALVL..FAE.VLVDWVKHAF....ITRFN..ELR..S.T.V.YRDYT.VSL..............AYDMAQTRKE-----.......................................................---TAFSDP.SDLVARRMGFIPLPLGVAMA.RVLC......TTVTP.SA..........................................................................................................................RP.ANLI.LL.LLAYFVLVALRILNSIIILGRACD---lms....................................................................................................................................................................
A0A0V1N4Q9_9BILA/124-424               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................c-SPSERCDVLKIII.LI.VS..C.FLVNF....F.DT......SI.MYHMVR...GQ..AIVKLYIVFNMLEV.................ADKLFSSFGQDI.LDALFWTAN.................................EPMTGG.Q....................M............................................................................................................................................................................................................................................................................................................................................R................................................GAKQRCLK.LVPY.LAIA.....I....V..YV.........WLHA....LL.V.....L....LQATTLNV.AF..NSQ.N..KSLLTIMMSNNFVELKG...........SVFKKFARNNLF.QMAC..........S....DVRERFH.....YV.ILLGAVFVRNMSA......................................................................................................vSWR.RDDFF..DMAPDLVFVF..VAE.LLVDWVKHAF....ITKFN..EIP..A.D.V.YKDFT.ITI..............AYDVAKSRQVN----.......................................................----ALTDH.CDQVSRRMGFIPLPLSFK--.-IEP......TK---.--..........................................................................................................................--.-HWP.TL.ALVFVALLLLKLLISVVMMGKSAE---yie....................................................................................................................................................................
W5PKF0_SHEEP/54-358                    ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERRRAHIG.VAPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVV..ASE.IAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYLGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A0F4YFM4_TALEM/350-774               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDNKADILKGFL.MI.ST..C.IVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLSAIGQDV.LECLFSREA.................................LERKPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PFWL.FILA.....L....A..YT.........VLHA....TS.L.....F....YQVITLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLIIIGSRNIVEtgvfsswgslgsglkdqaaastnstpls...............................................ssprtstsilpqsftlfpssllsslsgaNSI.LPTVA..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NTR..P.S.I.YGRFL.DVL..............AKDYYTN--------.......................................................----AFADQ.N--LTRRLGLPVIPLACLFF.RVSV......QTYQM.FLtawlpqhpsptpnttslssihqqhyssrpspsas......................................................pfslqsaipasvnrlssfisfvinnaipsparsiPV.FTVT.LV.LTGYVILLLVKLTMGILLLSYARARYK.......................................................................................................................................................................
A0A1L8HKZ0_XENLA/136-440               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGVI.LV.IC..Y.FIMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHLG.VIPH.FFMA.....V....L..YV.........ILHA....IL.I.....L....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFELVSSRQKN----.......................................................----ACTDY.SDSVSRRMGFIPLPLAVLLI.RVVT......SSVKV.QG..........................................................................................................................-I.LAYS.CV.VLFYFGLITLKVLNSIVLLGKSCQY--ik.....................................................................................................................................................................
A0A3Q0EG93_TARSY/54-358                ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGVI.LV.IC..Y.FMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.VAVDIVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVT......SSIKV.QG..........................................................................................................................-I.LSYA.CV.ILFYFGLISLKVLNSIVLLGKSCQY--vk.....................................................................................................................................................................
A0A3B4DC98_PYGNA/157-461               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDLLKGLI.MV.LC..Y.FMMHY....V.DY......AM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E---PK.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................SRKRAHIG.VIPH.FIMA.....V....F..YV.........FLHA....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.ILLLIVCLRNMEQ......................................................................................................fSWN.SDHLW..VLLPDVLMVV..TSE.VAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYK.ASL..............AFELVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKI.QG..........................................................................................................................A-.LSSV.CL.LLFYLGMITLKVLNSIVLLGKSCHY--vk.....................................................................................................................................................................
A0A0G4LAF0_9PEZI/534-941               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-TSMHKADILQGAI.IL.FS..S.AFLMN....L.DA......SR.MYHVIR...GQ..DAIKLYVIYNVLEV.................GDRLLSALGQDI.FECLLSTEA.................................LSRNKS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKLLL.PFGL.FLLA.....L....V..YN.........CIHS....VA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEVKS...........TVFKRFEKDNLF.QLTC..........A....DITERFQ.....LW.LMLFIIGMRNVVEvgglsipgaglsgdlkv....................................................................sstkpqhspfilphsftvLPS.WLWSG..EALSPFLIVI..GSE.ILVDTIKHAY....INKFN..KIR..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFVRP.S--LTRRVGLATLPLACLFI.RASV......QTYHM.FVstrvaapiirstqtslseesatpsspamtaaldrld..................................................sllrdalgravygqqangssngkaswfswstddviaAV.TMLV.VF.FIAFLVLLVFKILLSMVLLRYSRDRY-a......................................................................................................................................................................
W5JUP6_ANODA/166-470                   ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LTPAEICDLLKGTI.WI.IC..S.YTLLY....V.DT......NM.LYHLIK...SQ..SIIKLYIFYNMLEV.................GDRLLSAFGQDT.IDALFWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................HSKRQHFG.TIPH.FLFA.....I....V..YV.........TLHS....GL.V.....M....FQATSLNV.AI..NSN.N..KGLLTIMMSNNFVELKG...........SVFKKFDKNNLF.QLAC..........S....DVRERFH.....LT.VLMVIVLIQTMKE......................................................................................................fNWK.SEQFF..IMLYDCMWVM..ATE.VLVDWIKHAF....ITRFN..EIP..S.D.V.YREYT.TSL..............AYDMTQTRQK-----.......................................................---HAFSDH.SDLVARRMGFIPYPLGVVLV.KALY......HALAF.DN..........................................................................................................................-A.GSVV.IL.FVAFLALLAGRVLNTIYTLGEAC----dltq...................................................................................................................................................................
A0A2G8KN22_STIJA/145-449               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAEISDLLKAVV.LL.VC..S.YVLGT....L.DI......SM.LYHIVR...GQ..AVIKLYIMYNMLDV.................ADKLFSSFGQDI.LDSLLWTAS.................................--KGK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................SRKRENLG.TIPH.LFLA.....I....I..YV.........FLHA....ML.V.....L....IQATTLNV.AF..NSH.N..KALLTIMMSNNFVELKG...........SVFKKFDKYNLF.QMTC..........S....DVRERYH.....YM.VLFMFVFLRNMNE......................................................................................................fSWS.RDHFW..ELLPDMGMVL..FAE.VVVDSTKHAF....ITKFN..LLS..A.E.V.YSEYR.ASL..............AYDMIVSRKQN----.......................................................----AFSDH.SDLVSRRMGFIPLPLGCLVY.RIVR......QTVCI.DG..........................................................................................................................-S.VAVV.LF.VLSFLCLVAFKVLVSIVLLVVASR---lvk....................................................................................................................................................................
A0A3P9NMX2_POERE/163-467               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDMLKGLI.LV.LC..F.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................E--PK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRDSIG.VIPH.FFMA.....V....F..YV.........FLHS....IL.I.....M....VQASTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....SY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..MLFPDVFMVV..MSE.VAVDIIKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVARRMGFIPLPLAVLLI.RVVM......SSVKV.QG..........................................................................................................................AL.SYTC.VF.L-FYLGMVTLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A0W4ZTZ1_PNEJ7/213-563               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LKSSEKIDLFEGLL.IL.GT..C.TILQK....L.DA......SR.IYHNIR...GQ..ATIKLYVIYSVLEI.................GDRLFSAFGQDV.VDFFFSKIS.................................NK---K.N....................-............................................................................................................................................................................................................................................................................................................................................-................................................SIKDYYLN.LIPY.FILT.....L....I..TN.........VLHT....TM.L.....F....YQVMTLNV.TV..NSY.S..NALLTLLISSQFVEIKG...........TVFKKFEKENVL.QMTL..........A....DIVERFQ.....LS.LILTIVLFRNLMEiyelestf......................................................................................slfpssffhFSS.YSVFF..MVTSPVLLVM..GSE.MIVDWIKHLF....VIKFN..HMQ..S.S.I.YQQFI.GVL..............SSYYVNFKNKK----.......................................................---NMYIKK.PYYVSRKIGLPILPLTCLII.QAFF......KIWKI.FYpnkpfktkisnda...............................................................................................flkypffickdnlfLF.HGTF.IV.ILFFLCLIIIKLVLSIILIKFSYTY--yd.....................................................................................................................................................................
A0A0L7L6X1_9NEOP/32-153                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................reh--------------.--.--..-.-----....-.--......--.------...--..--------------.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..-L.........VLHS....LL.V.....L....FQATTLNV.AF..NSN.N..KSLLIIMMSNNFVELKG...........SVFKKFDKNNLF.QVSC..........S....DVRERLH.....LS.VLLFIVVLQTMKE......................................................................................................fTWK.EERFW..ILAPDCILVL..TFE.VIIDWVKHAF....ITR--..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------vaavl..................................................................................................................................................................
A0A1S8BGD9_9PEZI/479-892               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PNHKADILKGLL.VL.AT..C.VVLMR....F.DA......SK.TYHNIR...GQ..AAIKLYVIYNVLEV.................CDRLFSALGQDI.LECLLSRET.................................LDRNAD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVIR.PFWM.FLLA.....L....A..YT.........SIHS....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QLTC..........A....DMVERFQ.....LW.LMLMIIACRNIVEvgglsilgdisgsssagl..................................................................ggngttapfrstsiipksfTIF.PKWTG..QVLGPFLLVL..GSE.MLVDWLKHAY....ITKFN..NTK..P.A.I.YGRFL.DVL..............AKDYYSN--------.......................................................----AFFDQ.N--LTKRLGLPVLPLACLFI.RATI......QTYHM.FLathmplpiaspatslsvdsggqatsssspattaalahi..............................................dhifrralgrssfgaggntasvpssyswqlwslddviaFT.TMIV.VF.LVAYFVLLACKLVLGMVLLGFARARYK.......................................................................................................................................................................
A0A0P7UT22_SCLFO/152-456               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDILKGFI.MI.IC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPKE.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-KKRAHIG.VIPH.FFMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLFPDVCMVI..ASE.IAVDVVKHAF....ITKFN..DIT..A.D.V.YSEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKV.QG..........................................................................................................................-S.LSCV.CV.LLFYLGMTTLKVLNSIVLLGRSC----lyvk...................................................................................................................................................................
A0A2H9TFH9_9FUNG/65-113                ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pyfg------FDLLRGLL.LF.TV..C.VLLQQ....I.DA......SR.VYHSIR...GQ..SVIKLYVIFNVFEV.................------------.---------.................................------.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------.......................................................................................................................................................................
S7W586_SPRLO/45-261                    .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ykkhd-----FLQISQSIA.IV.LS..F.FIVKN....I.DV......SY.MYHVIR...TQ..SLMKMYVLFNVLEL.................SEKLIGTLSSDL.LSFIKSFDI.................................A-----.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................-IKKNYKK.YYIS.TFFY.....S....I..ST.........IIET....VI.L.....S....MQYIVILQ.SI..HAC.S..NTLYALLISNLFLELKS...........SVFKRGDRKMVF.EVLH..........Q....DLLKRFN.....LF.LYVTLSFFHIYFE.......................................................................................................---.PNNVN..DFIKPLL-IL..LFK.LLADWVKHAF....ICRHN..NID..P.R.I.YALF-.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------dvefk..................................................................................................................................................................
A0A2K3QEI4_9HYPO/522-929               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-STFHKADLLQGAV.II.CS..S.VALMT....L.DA......SR.MYHFIR...AQ..STVKLYVIYNVLEV.................GDRLLSAMGQDI.FECLFSTET.................................LSRNAS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLL.PLGM.FLLA.....L....A..YN.........CLHS....IA.L.....Y....YQVITLNV.AV..NSY.S..NALLTLLLSNQFVEIKS...........TVFKRFDKDGLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNVVEvgglsvpgagiessyddg...................................................................tpavplhppsilphsftvLPS.WVMSG..EVLSPFLIVL..GSE.MLVDAIKHAY....VTKFN..NIK..P.T.F.YSRTL.DIL..............CKDYYTN--------.......................................................----AFVTP.S--LTRRLGLAVIPLSCLFI.RSSI......QTYHM.FLsthvpmpiprstqtslieesatpsspamtaalnrf...................................................daiirdslgratygypygsplnsrpwyawnsddfiaAL.TMVV.VF.FIAFLVLLILKLLLGMLLLKYARNRY-a......................................................................................................................................................................
A0A178EAI7_9PLEO/473-879               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PSHKADILKGLL.VI.AS..C.FVLMR....F.DA......SR.MYHGIR...GQ..SAIKLYVIYNVLEV.................CDRLLSAVGQDV.LECLFSRET.................................LDRNPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLR.PFGM.FALA.....L....V..YT.........VAHA....TA.L.....F....YQVITLNV.AV..NSY.S..NALLTLLMSNQFVEIKG...........TVFKKFEKENLF.QITC..........A....DIVERFQ.....LW.LMLLIIAMRNVVEvgglsirssdtswtamfsr................................................................agnatttstftasniipmsfTIF.PKYIA..QVLNPFLLVL..GSE.MFVDWLKHAY....ITKFN..QYK..P.E.V.YSKFF.DVL..............AKDYYSN--------.......................................................----AFADP.N--LTRRLGLPVLPLSCLFI.RAAI......QTYHM.FIamhmppplpassvsltsnpasspsttaalahid.......................................................qvfrralgrssfgagapsqswyqlsswsfddliaGS.TMLI.VF.LIVYLIFLAFKLILGMFLLSVSRKRY-h......................................................................................................................................................................
A0A0K6G2X9_9AGAM/228-577               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................lp--PSQKADLLRVLI.LV.LA..I.SILVP....LtDA......SK.IYHSIR...GQ..DNIKIYVIFNALEI.................ADRLCTSFGQDI.LDCLFSRST.................................LQVLTY.R....................-............................................................................................................................................................................................................................................................................................................................................L................................................PLTPYTLR.PFVY.FGLA.....S....C..YL.........VLHS....LV.L.....V....YQLISLNV.AI..NSY.D..NALLTLLISNQFVEIKG...........SVFKKFEKDNLF.QITC..........A....DIVERFQ.....LS.LMLLAVALRNTIElssdtfdmess................................................................................vlpqsfkvnflsGIG.GGTIW..AIFSPVLTVL..LSE.ILVDWLKHAF....ITKFN..HIR..P.S.V.YERYT.DVL..............CRDLLASGSGR---S.......................................................SHKNTYVDQ.SPLVARRLGLATLPLAVLVL.LIGS......QSAEL.ALavhgw...............................................................................................................nwtwerAT.QCAV.LG.VLVWLCLVTIKLMLGVNLLVYATSRRK.......................................................................................................................................................................
A0A1L9VPU6_ASPGL/586-1011              ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--PDDKADILKGLL.MI.VT..C.WVLMR....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................SDRLLGAIGQDV.LECLFSREA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVFR.PFGL.FLLA.....L....A..YT.........VLHS....TS.L.....F....YQVMTLNV.AV..NSY.S..NALITLLLSNQFVEIKS...........TVFKKFEKENLF.QLTC..........A....DVVERFQ.....LW.LMLTIIASRNIVEtgafnfvgslgstwsisgnsststnstpl.............................................stpprtassilpqsftilpssliasfsqvNTF.LPSLL..QVLGPFLVVL..GSE.MLVDWLKHAY....INKFN..NVR..P.N.I.YGRFL.DIL..............TKDYYTN--------.......................................................----AFGDQ.N--LTRRLGLPVIPLSCLFF.RVSV......QTYKM.FLaaslpqqpsstmqatslssihnhyapapaqsap.......................................................pltlktivpssmahisnifrsvlanamptpaqsvYI.FTVI.LL.ITLFLVLLIFKLLLGMGLLAYSRRRY-q......................................................................................................................................................................
A0A084Q927_STAC4/487-888               .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l-SAFHKADLLQGAV.II.CS..S.IALMG....L.DA......SR.MYHFIR...AQ..SAIKLYVIYNILET.................GDRLLSALGQDI.LECLFSTET.................................LSRNSS.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--RSKVLM.PLGM.FLLA.....L....A..YN.........CLHS....VT.L.....Y....YQVITLNV.AV..NSY.S..DALFTLLLSNQFTEVKS...........TVFKRFEKDNLF.QLTC..........A....DIVERFH.....LW.IMLLIIGMRNVVEvgglpwhsagsdgde........................................................................pvplhnpsilphsftvLPS.WITSA..AVLSPFLIVI..GSE.MLVDAIKHAY....VTKFN..NIK..P.T.F.YSRIL.DIL..............CKDYYTN--------.......................................................----AFTTP.T--LTRRLGLAVIPLSCLFI.RASV......QTYHM.FLsthlampipqsthtslteesaapsspaviaalnrf....................................................dalirdslgrhtygtppyhdeprpwyawtsddviaAL.TMVV.VF.FIAFLVLLIVKLLLGMLLLKYSRNRY-a......................................................................................................................................................................
A0A2D0QFX0_ICTPU/151-455               ..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LQPAQVCDVLKGFI.MV.LC..Y.SMMHY....V.DY......SM.MYHLIR...GQ..SVIKLYIIYNMLEV.................ADRLFSSFGQDI.LDALYWTAT.................................--EPK-.-....................-............................................................................................................................................................................................................................................................................................................................................-................................................ERKRAHIG.VIPH.FLMA.....V....L..YV.........FLHA....IL.I.....M....VQATTLNV.AF..NSH.N..KSLLTIMMSNNFVEIKG...........SVFKKFEKNNLF.QMSN..........S....DIKERFT.....NY.VLLLIVCLRNMEQ......................................................................................................fSWN.PDHLW..VLLPDVFMVI..TSE.MAVDVVKHAF....ITKFN..DIP..A.D.V.YGEYR.ASL..............AFDLVSSRQKN----.......................................................----AYTDY.SDSVSRRMGFIPLPLALLLI.RVVT......SSVKI.QG..........................................................................................................................-A.LSLV.CV.ILFYLGMITLKVLNSIVLLGKSC----vyvk...................................................................................................................................................................
A0A453H809_AEGTS/75-383                ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFVV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAE.................................GLSTCS.T....................-............................................................................................................................................................................................................................................................................................................................................D................................................RVTFELLR.FLLD.GAIA.....V....L..AF.........VVHS....FV.L.....L....AQAITLST.CI..IAH.N..NALLALLVSNNFAEIKS...........NVFKKVSKENLH.NLVY..........Y....DIIERFH.....IT.AFLLFVLAQNILE.......................................................................................................-AE.GPWFD..SFLINASYVF..MCE.VLIDAIKHSF....LAKFN..EIK..P.V.A.YSEFL.EDL..............SKQILNEQP------.......................................................---------.-DDRQKDLTFIPLAPACVVI.RVLT......PVYAT.LLpagp..................................................................................................................fiwrIF.WILL.WS.VLTYFMLAIFKILVGLILRCLATW---yin....................................................................................................................................................................
A0A178ERB1_TRIRU/619-701               ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ll--ENDKADILKGLL.MI.FT..C.TILMY....F.DA......SR.MYHWIR...GQ..AAIKLYVIYNVLEV.................GDRLLSAIGQDV.LECLFSQEA.................................LERRPD.G....................-............................................................................................................................................................................................................................................................................................................................................-................................................--------.----.----.....-....-..--.........----....--.-.....-....--------.--..---.-..-----------------...........------------.----..........-....-------.....--.-------------.......................................................................................................---.-----..----------..---.----------....-----..---..-.-.-.-----.---..............---------------.......................................................---------.--------------------.----......-----.--..........................................................................................................................--.----.--.---------------------------rskv...................................................................................................................................................................
A0A3L6TR03_PANMI/279-594               ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................pna---ADLSDYGCFIV.LA.LG..V.ASLQM....I.DI......SL.IYHVIR...GQ..GTIKLYVVYNVLEI.................FDKLCQSFGEDV.LQVLFNSAEg...............................lS--ACS.T....................D...............................