GenomeNet

Database: Pfam
Entry: Enoyl_reductase
LinkDB: Enoyl_reductase
Original site: Enoyl_reductase 
#=GF ID   Enoyl_reductase
#=GF AC   PF12241.8
#=GF DE   Trans-2-enoyl-CoA reductase catalytic region
#=GF AU   Vella Briffa B;0000-0003-4380-1783
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   Pfam-B_10602 (release 10.0)
#=GF GA   22.10 22.10;
#=GF TC   22.10 22.20;
#=GF NC   22.00 22.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   15569691
#=GF RT   Mitochondrial trans-2-enoyl-CoA reductase of wax ester
#=GF RT   fermentation from Euglena gracilis defines a new family of
#=GF RT   enzymes involved in lipid synthesis.
#=GF RA   Hoffmeister M, Piotrowski M, Nowitzki U, Martin W;
#=GF RL   J Biol Chem. 2005;280:4329-4338.
#=GF DR   INTERPRO; IPR024910;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of trans-2-enoyl-CoA reductases, EC:1.3.1.44,
#=GF CC   carries the the catalytic sites of the enzyme, characterised by
#=GF CC   the conserved sequence motifs: YNThhhFxK, and YShAPxR. In
#=GF CC   Euglena where the enzyme has been characterised it catalyses the
#=GF CC   reduction of enoyl-CoA to acyl-CoA in an unusual fatty acid
#=GF CC   pathway in mitochondria. the whole path performs a malonyl-CoA
#=GF CC   independent synthesis of fatty acids leading to accumulation of
#=GF CC   wax esters, which serve as the sink for electrons stemming from
#=GF CC   glycolytic ATP synthesis and pyruvate oxidation.
#=GF SQ   1114
#=GS E0I4S6_9BACL/81-316       AC E0I4S6.1
#=GS A0A0P0CD22_9BACT/81-316   AC A0A0P0CD22.1
#=GS F2RDG5_STRVP/12-248       AC F2RDG5.1
#=GS A0A0C1ZDM1_9DELT/103-343  AC A0A0C1ZDM1.1
#=GS A0A1Z9GF15_9BACT/81-313   AC A0A1Z9GF15.1
#=GS A0A0Q7S459_9BACL/81-316   AC A0A0Q7S459.1
#=GS G7F675_9GAMM/82-317       AC G7F675.1
#=GS A0A0M1NJL5_9BACL/81-316   AC A0A0M1NJL5.1
#=GS A0A1Q9GFM6_9GAMM/83-319   AC A0A1Q9GFM6.1
#=GS U2RCX4_9FUSO/81-318       AC U2RCX4.1
#=GS A0A0G3UQ08_9ACTN/85-321   AC A0A0G3UQ08.1
#=GS J2YGE5_9PSED/82-317       AC J2YGE5.1
#=GS L8XXC4_9GAMM/82-318       AC L8XXC4.1
#=GS F2NWU0_TRES6/91-326       AC F2NWU0.1
#=GS A0A0B8NYM4_9VIBR/82-213   AC A0A0B8NYM4.1
#=GS A0A135I9Q9_9GAMM/83-319   AC A0A135I9Q9.1
#=GS A0A075P9W4_9ALTE/82-317   AC A0A075P9W4.1
#=GS K8WJU7_PRORD/82-317       AC K8WJU7.1
#=GS A0A0J8V717_9GAMM/82-317   AC A0A0J8V717.1
#=GS R7C8S2_9CLOT/81-315       AC R7C8S2.1
#=GS K8P2G3_9BRAD/82-314       AC K8P2G3.1
#=GS I4VJT7_9GAMM/83-317       AC I4VJT7.1
#=GS R6NPD0_9FIRM/81-313       AC R6NPD0.1
#=GS W7QU64_9ALTE/81-316       AC W7QU64.1
#=GS A0A168HPY0_9BACL/81-316   AC A0A168HPY0.1
#=GS FABV1_VIBCH/82-317        AC Q9KRA3.2
#=GS FABV_CYTH3/81-316         AC Q11W68.1
#=GS A0A1H6KCW1_9FLAO/82-318   AC A0A1H6KCW1.1
#=GS A0A099Y0N4_9FLAO/81-316   AC A0A099Y0N4.1
#=GS A0A094JNB4_9BACL/81-317   AC A0A094JNB4.1
#=GS A0A0Q4QC26_9GAMM/82-316   AC A0A0Q4QC26.1
#=GS A0A090S7W9_9VIBR/83-135   AC A0A090S7W9.1
#=GS H8KSP8_SOLCM/81-316       AC H8KSP8.1
#=GS A0A0F4NJW3_9VIBR/82-317   AC A0A0F4NJW3.1
#=GS A0A0M2VRN7_9BACL/81-316   AC A0A0M2VRN7.1
#=GS A0A0L6JPA1_9FIRM/81-316   AC A0A0L6JPA1.1
#=GS R1GRV0_9GAMM/8-169        AC R1GRV0.1
#=GS A0A1I7GGG4_9BACL/81-316   AC A0A1I7GGG4.1
#=GS FABV_EDWI9/82-317         AC C5BFN7.1
#=GS A7N4Z7_VIBCB/83-319       AC A7N4Z7.1
#=GS A0A256BH25_9LACT/84-320   AC A0A256BH25.1
#=GS A0A1T4U5D4_9GAMM/82-317   AC A0A1T4U5D4.1
#=GS B5GA81_STRSH/125-361      AC B5GA81.1
#=GS A0A242L6C4_9ENTE/82-318   AC A0A242L6C4.1
#=GS F9T7Z3_9VIBR/82-317       AC F9T7Z3.1
#=GS A0A060B863_9GAMM/83-318   AC A0A060B863.1
#=GS A0A1H7WAX8_9GAMM/94-330   AC A0A1H7WAX8.1
#=GS A0A0R0D8S1_9GAMM/82-316   AC A0A0R0D8S1.1
#=GS A0A1I5EN51_9BURK/82-318   AC A0A1I5EN51.1
#=GS F0LQA9_VIBFN/82-317       AC F0LQA9.1
#=GS A0A0Q0I9X1_9GAMM/82-317   AC A0A0Q0I9X1.1
#=GS A0A1I1A909_9BACL/81-316   AC A0A1I1A909.1
#=GS A0A1E7RSY0_9GAMM/82-316   AC A0A1E7RSY0.1
#=GS A0A1V4SK47_CLOHU/81-316   AC A0A1V4SK47.1
#=GS C7N8Z3_LEPBD/81-318       AC C7N8Z3.1
#=GS A0A1M6RXY9_9BACT/89-325   AC A0A1M6RXY9.1
#=GS J3AJN8_9CAUL/82-314       AC J3AJN8.1
#=GS R5SBB0_9CLOT/81-313       AC R5SBB0.1
#=GS G4H853_9BACL/81-316       AC G4H853.1
#=GS A0A239SDH9_9BURK/82-317   AC A0A239SDH9.1
#=GS A0A1L6M0S3_9DELT/89-316   AC A0A1L6M0S3.1
#=GS A0A1X7I1Y5_9SPHI/82-318   AC A0A1X7I1Y5.1
#=GS U2DTM3_9BACT/90-327       AC U2DTM3.1
#=GS A4A5N1_9GAMM/82-317       AC A4A5N1.1
#=GS A0A1U7PWW2_9FLAO/82-318   AC A0A1U7PWW2.1
#=GS A0A1E5CK40_9GAMM/82-317   AC A0A1E5CK40.1
#=GS A0A1R4L749_9SPHI/82-318   AC A0A1R4L749.1
#=GS A0A1G1NHG0_9BACT/82-317   AC A0A1G1NHG0.1
#=GS A0A0P7XE60_9GAMM/81-316   AC A0A0P7XE60.1
#=GS A0A240UU21_9GAMM/82-318   AC A0A240UU21.1
#=GS A0A1H0DHJ9_9GAMM/83-318   AC A0A1H0DHJ9.1
#=GS A0A226INX1_9FLAO/81-316   AC A0A226INX1.1
#=GS A0A0Q0VAS6_9SPHI/81-316   AC A0A0Q0VAS6.1
#=GS J7TL49_MORMO/82-317       AC J7TL49.1
#=GS A0A1B1MWB0_9BACL/81-316   AC A0A1B1MWB0.1
#=GS A0A081KBW9_9GAMM/82-317   AC A0A081KBW9.1
#=GS A0A238YIP7_9PROT/81-316   AC A0A238YIP7.1
#=GS A0A1S6IR34_9LACT/83-319   AC A0A1S6IR34.1
#=GS A0A1H7ITK6_9GAMM/91-326   AC A0A1H7ITK6.1
#=GS A0A1Y6HE07_9XANT/82-318   AC A0A1Y6HE07.1
#=GS C4SE96_YERMO/108-344      AC C4SE96.1
#=GS A0A244CU57_9GAMM/82-317   AC A0A244CU57.1
#=GS S5ZPF0_9SPIO/86-321       AC S5ZPF0.1
#=GS A0A1Q9HEC9_9VIBR/82-317   AC A0A1Q9HEC9.1
#=GS A0A136Q4J4_9FIRM/81-313   AC A0A136Q4J4.1
#=GS A0A1B8W8Y3_9BACI/81-316   AC A0A1B8W8Y3.1
#=GS A0A285R9F2_9ACTN/86-322   AC A0A285R9F2.1
#=GS A0A2A5W325_9BACT/81-313   AC A0A2A5W325.1
#=GS A0A1H2TG32_9BACL/81-316   AC A0A1H2TG32.1
#=GS A9GCU7_SORC5/91-319       AC A9GCU7.1
#=GS A0A1N6JZI9_9BURK/82-317   AC A0A1N6JZI9.1
#=GS A0A017SW55_9DELT/91-317   AC A0A017SW55.1
#=GS A0A1N6NCT4_9SPIO/81-316   AC A0A1N6NCT4.1
#=GS A0A1H8DLD3_9BACL/81-316   AC A0A1H8DLD3.1
#=GS FABV_IDILO/82-317         AC Q5QYR6.1
#=GS D8ICF9_BRAP9/82-319       AC D8ICF9.1
#=GS A0A1S2TUE1_9GAMM/82-317   AC A0A1S2TUE1.1
#=GS A0A1V9EA78_9BACT/81-316   AC A0A1V9EA78.1
#=GS C9MUR8_9FUSO/81-318       AC C9MUR8.1
#=GS A0A150ANY1_9BACT/81-316   AC A0A150ANY1.1
#=GS A0A136A578_9ALTE/82-317   AC A0A136A578.1
#=GS A0A1M4T5E4_9GAMM/84-319   AC A0A1M4T5E4.1
#=GS A0A1K1N9S9_9GAMM/82-318   AC A0A1K1N9S9.1
#=GS A0A068Z3W5_9GAMM/82-317   AC A0A068Z3W5.1
#=GS A0A2A3VIR5_9GAMM/82-318   AC A0A2A3VIR5.1
#=GS W7YJC8_9BACL/81-316       AC W7YJC8.1
#=GS A0A117KEP5_9FLAO/81-316   AC A0A117KEP5.1
#=GS A0A0C3DHQ7_9VIBR/82-317   AC A0A0C3DHQ7.1
#=GS A0A0M0HR65_VIBNE/83-319   AC A0A0M0HR65.1
#=GS A0A1G7TTP6_9BACL/81-316   AC A0A1G7TTP6.1
#=GS FABV2_VIBVY/83-320        AC Q7ME99.1
#=GS Q2BLL7_NEPCE/82-317       AC Q2BLL7.1
#=GS A0A0A8EJM8_9ACTN/87-323   AC A0A0A8EJM8.1
#=GS A0A0J6XIK1_9ACTN/88-324   AC A0A0J6XIK1.1
#=GS A0A1C4NW38_9ACTN/84-320   AC A0A1C4NW38.1
#=GS C9QJT5_VIBOR/82-317       AC C9QJT5.1
#=GS A0A1X9NEV0_9GAMM/82-317   AC A0A1X9NEV0.1
#=GS D0I6P4_GRIHO/82-317       AC D0I6P4.1
#=GS D3EDL3_GEOS4/81-316       AC D3EDL3.1
#=GS FABV_PSEAE/82-317         AC Q9HZP8.1
#=GS Q1I4Y5_PSEE4/97-330       AC Q1I4Y5.1
#=GS A0A1N6FAZ9_9BURK/82-317   AC A0A1N6FAZ9.1
#=GS A0A0F4R872_9GAMM/82-317   AC A0A0F4R872.1
#=GS A0A0C1G605_9SPHI/81-316   AC A0A0C1G605.1
#=GS A0A098QV08_9SPIO/82-317   AC A0A098QV08.1
#=GS H7EIT3_9SPIO/86-322       AC H7EIT3.1
#=GS A0A1M7BXT3_9FLAO/81-316   AC A0A1M7BXT3.1
#=GS A0A1X1MSC7_9VIBR/82-317   AC A0A1X1MSC7.1
#=GS A0A1E5IW19_SHECO/82-317   AC A0A1E5IW19.1
#=GS F9T2M4_9VIBR/83-319       AC F9T2M4.1
#=GS A0A0R0E151_9GAMM/82-316   AC A0A0R0E151.1
#=GS A0A1E7ZB55_9ALTE/82-317   AC A0A1E7ZB55.1
#=GS FABV_SHELP/82-317         AC A3QFX1.1
#=GS FABV_XYLFA/82-318         AC Q9PCE6.2
#=GS A0A257K3F2_9FLAO/81-316   AC A0A257K3F2.1
#=GS A8FTI5_SHESH/82-317       AC A8FTI5.1
#=GS A0A173MKI5_9BACT/81-316   AC A0A173MKI5.1
#=GS A0A0M9ZFM0_9ACTN/12-248   AC A0A0M9ZFM0.1
#=GS A0A0D5LCI2_9BURK/82-317   AC A0A0D5LCI2.1
#=GS A0A0W1SQ07_9GAMM/83-318   AC A0A0W1SQ07.1
#=GS U1KWG5_9GAMM/82-317       AC U1KWG5.1
#=GS A0A1A5YNZ9_9BACL/81-316   AC A0A1A5YNZ9.1
#=GS A0A0W7TXF6_9GAMM/81-315   AC A0A0W7TXF6.1
#=GS A0A285NN78_9PSED/94-330   AC A0A285NN78.1
#=GS A0A0E3UHQ3_9BACT/82-318   AC A0A0E3UHQ3.1
#=GS A0A0M8MLL1_9FLAO/82-317   AC A0A0M8MLL1.1
#=GS A0A0M2XVI3_9SPHI/82-318   AC A0A0M2XVI3.1
#=GS K2JTD2_9GAMM/82-317       AC K2JTD2.1
#=GS A0A1Y2PCH6_9FLAO/81-316   AC A0A1Y2PCH6.1
#=GS A0A1M6TAU3_9BACT/86-321   AC A0A1M6TAU3.1
#=GS A0A1G8CJR9_9PSED/82-317   AC A0A1G8CJR9.1
#=GS A0A0N0HDA7_THEVU/81-316   AC A0A0N0HDA7.1
#=GS A0A0A7EI15_9GAMM/82-317   AC A0A0A7EI15.1
#=GS A0A084A6L0_9GAMM/82-317   AC A0A084A6L0.1
#=GS FABV_CHRSD/85-320         AC Q1QTN9.1
#=GS A0A259R435_9GAMM/82-316   AC A0A259R435.1
#=GS G8X5K2_FLACA/81-316       AC G8X5K2.1
#=GS A0A0U4XA15_9GAMM/82-317   AC A0A0U4XA15.1
#=GS K6YLI8_9ALTE/82-317       AC K6YLI8.1
#=GS A0A1M6L5Y3_9FLAO/81-316   AC A0A1M6L5Y3.1
#=GS A0A1H6S6N4_9LACT/82-318   AC A0A1H6S6N4.1
#=GS A0A0R2FQB0_9LACO/89-326   AC A0A0R2FQB0.1
#=GS A0A162P9V1_9FLAO/81-316   AC A0A162P9V1.1
#=GS A0A1G0AJ16_9BACT/81-316   AC A0A1G0AJ16.1
#=GS A0A090R4J3_9VIBR/1-73     AC A0A090R4J3.1
#=GS A0A089IGU8_9BACL/81-316   AC A0A089IGU8.1
#=GS A0A1Q4VPN3_9ACTN/87-322   AC A0A1Q4VPN3.1
#=GS A0A1G0JEN1_9GAMM/82-317   AC A0A1G0JEN1.1
#=GS A0A0N0NG46_9ACTN/90-326   AC A0A0N0NG46.1
#=GS A0A1Y5EKJ3_9GAMM/82-317   AC A0A1Y5EKJ3.1
#=GS A0A250B8A0_9ENTR/82-317   AC A0A250B8A0.1
#=GS A0A1I7C867_9GAMM/88-323   AC A0A1I7C867.1
#=GS S6GE70_9GAMM/82-317       AC S6GE70.1
#=GS W7Q346_9GAMM/83-318       AC W7Q346.1
#=GS A0A2A2YDH6_9BACT/82-317   AC A0A2A2YDH6.1
#=GS A0A1Q4V8Z5_9ACTN/84-321   AC A0A1Q4V8Z5.1
#=GS A0A066UZT9_9VIBR/82-317   AC A0A066UZT9.1
#=GS A0A0Q4RWY2_9FLAO/81-316   AC A0A0Q4RWY2.1
#=GS A0A0J1JAN1_9GAMM/83-145   AC A0A0J1JAN1.1
#=GS A0A0S2KGV5_9GAMM/82-318   AC A0A0S2KGV5.1
#=GS E6WW19_PSEUU/82-317       AC E6WW19.1
#=GS A0A1M5Y8T9_9GAMM/82-317   AC A0A1M5Y8T9.1
#=GS A0A2D1U4E3_9SPHI/81-317   AC A0A2D1U4E3.1
#=GS A0A090RM62_9VIBR/1-162    AC A0A090RM62.1
#=GS A0A2D8RDP0_9GAMM/82-319   AC A0A2D8RDP0.1
#=GS H2J1K0_RAHAC/82-317       AC H2J1K0.1
#=GS A0A1S8CQ55_9GAMM/82-317   AC A0A1S8CQ55.1
#=GS A0A246FYX5_9PSED/82-316   AC A0A246FYX5.1
#=GS V9G7M8_9BACL/81-316       AC V9G7M8.1
#=GS A0A0C1EW28_9FLAO/81-316   AC A0A0C1EW28.1
#=GS A0A1N7JWN6_9GAMM/82-317   AC A0A1N7JWN6.1
#=GS A0A1Q4YCC6_9ACTN/96-332   AC A0A1Q4YCC6.1
#=GS A0A0X1T6R8_PSEAA/82-317   AC A0A0X1T6R8.1
#=GS A0A268SF77_9BACL/81-316   AC A0A268SF77.1
#=GS A0A241R4N7_9GAMM/82-317   AC A0A241R4N7.1
#=GS H1G6K7_9GAMM/82-317       AC H1G6K7.1
#=GS E8LQN9_9VIBR/82-317       AC E8LQN9.1
#=GS A0A1E5CWK1_9VIBR/82-317   AC A0A1E5CWK1.1
#=GS A0A1V4J0V2_9CLOT/82-318   AC A0A1V4J0V2.1
#=GS A0A1B8TWU8_9FLAO/81-316   AC A0A1B8TWU8.1
#=GS A0A084CMY4_9GAMM/82-316   AC A0A084CMY4.1
#=GS A0A1Z9TA75_9PROT/83-319   AC A0A1Z9TA75.1
#=GS A0A0B8Q8W9_9VIBR/82-238   AC A0A0B8Q8W9.1
#=GS A4C6S2_9GAMM/82-317       AC A4C6S2.1
#=GS A0A081N8G6_9GAMM/82-317   AC A0A081N8G6.1
#=GS A0A1M6YV40_9FLAO/81-316   AC A0A1M6YV40.1
#=GS I2JPG1_9GAMM/82-317       AC I2JPG1.1
#=GS H8XUN1_FLAIG/81-316       AC H8XUN1.1
#=GS A0A0M2NI98_9FIRM/81-313   AC A0A0M2NI98.1
#=GS A0A1G4YQC5_9BURK/82-317   AC A0A1G4YQC5.1
#=GS A0KLI7_AERHH/82-317       AC A0KLI7.1
#=GS A0A095XFJ6_9BURK/82-317   AC A0A095XFJ6.1
#=GS A0A1Q4W6M6_9ACTN/84-318   AC A0A1Q4W6M6.1
#=GS FABV_FLAJ1/81-316         AC A5FE91.1
#=GS A0A139SI75_9BACT/82-317   AC A0A139SI75.1
#=GS F2JXC0_MARM1/82-317       AC F2JXC0.1
#=GS R5C7K4_9FIRM/81-312       AC R5C7K4.1
#=GS A0A1H1LWM9_9FLAO/81-316   AC A0A1H1LWM9.1
#=GS A0A1I3P1R6_9BACL/81-316   AC A0A1I3P1R6.1
#=GS A0A1Y5K6M3_9GAMM/82-317   AC A0A1Y5K6M3.1
#=GS FABV_XANAC/82-318         AC Q8PR25.1
#=GS E6U895_ETHHY/81-314       AC E6U895.1
#=GS A0A2A9G5U8_9VIBR/83-319   AC A0A2A9G5U8.1
#=GS A0A1M4VNG1_9CLOT/81-313   AC A0A1M4VNG1.1
#=GS A0A0T1Q407_9ACTN/86-322   AC A0A0T1Q407.1
#=GS A0A024FLR0_9FLAO/81-316   AC A0A024FLR0.1
#=GS A0A0R1GYB5_9LACO/89-325   AC A0A0R1GYB5.1
#=GS A0A1X1QH81_9GAMM/82-317   AC A0A1X1QH81.1
#=GS A0A095SSY9_9FLAO/81-316   AC A0A095SSY9.1
#=GS F4LKL1_TREBD/91-327       AC F4LKL1.1
#=GS A0A0A7JRB5_9PSED/83-320   AC A0A0A7JRB5.1
#=GS A0A178ID75_9BACT/82-318   AC A0A178ID75.1
#=GS A0A1L4BWQ0_9LACT/83-319   AC A0A1L4BWQ0.1
#=GS F9R7T7_VIBSN/83-319       AC F9R7T7.1
#=GS A0A1M6EZ66_9FLAO/81-316   AC A0A1M6EZ66.1
#=GS A0A1Q6A557_9SPHI/59-294   AC A0A1Q6A557.1
#=GS A0A2A2YU59_9ACTN/90-325   AC A0A2A2YU59.1
#=GS A0A090T4M0_9VIBR/82-317   AC A0A090T4M0.1
#=GS A0A1B8U5N5_9FLAO/81-316   AC A0A1B8U5N5.1
#=GS A0A1R4KWD5_9SPHI/82-318   AC A0A1R4KWD5.1
#=GS A0A090SET2_9VIBR/83-318   AC A0A090SET2.1
#=GS A0A1R4HSQ3_9GAMM/83-318   AC A0A1R4HSQ3.1
#=GS I8T4D1_9GAMM/82-317       AC I8T4D1.1
#=GS A0A0B8PGY2_9VIBR/1-146    AC A0A0B8PGY2.1
#=GS K0P5N8_9BACT/82-318       AC K0P5N8.1
#=GS W4AEL9_9BACL/81-316       AC W4AEL9.1
#=GS A8FZ69_SHESH/83-319       AC A8FZ69.1
#=GS A0A0J1HGQ4_9GAMM/82-317   AC A0A0J1HGQ4.1
#=GS A0A0F5FX35_9RHIZ/82-315   AC A0A0F5FX35.1
#=GS C6CTR2_PAESJ/81-316       AC C6CTR2.1
#=GS R7CNK0_9FIRM/81-313       AC R7CNK0.1
#=GS A0A1I1JL78_9LACT/83-319   AC A0A1I1JL78.1
#=GS A0A0F3L0B8_9GAMM/82-324   AC A0A0F3L0B8.1
#=GS A0A0N0MRP7_9ACTN/86-322   AC A0A0N0MRP7.1
#=GS J2SPI4_9BURK/82-317       AC J2SPI4.1
#=GS FABV_PARPJ/82-317         AC B2T4A8.1
#=GS A0A1H7PUM6_9FLAO/81-316   AC A0A1H7PUM6.1
#=GS A0A0E4CYR4_9BACL/81-316   AC A0A0E4CYR4.1
#=GS H3K5Z3_9FIRM/81-311       AC H3K5Z3.1
#=GS A0A1I5XBW0_9LACT/83-319   AC A0A1I5XBW0.1
#=GS R6MZF4_9CLOT/81-315       AC R6MZF4.1
#=GS C6XYJ7_PEDHD/81-317       AC C6XYJ7.1
#=GS A0A023C6A2_9PSED/82-316   AC A0A023C6A2.1
#=GS A0A066WRK0_9FLAO/81-316   AC A0A066WRK0.1
#=GS A0A1B7K2C5_9GAMM/82-317   AC A0A1B7K2C5.1
#=GS A0A1T1HXU6_9PSED/82-317   AC A0A1T1HXU6.1
#=GS A0A094K075_9GAMM/82-317   AC A0A094K075.1
#=GS FABV1_VIBVY/82-317        AC Q7MLJ0.1
#=GS B3PD46_CELJU/105-337      AC B3PD46.1
#=GS A0A0B1YT09_9BURK/82-317   AC A0A0B1YT09.1
#=GS A0A1K1ZY07_9GAMM/82-318   AC A0A1K1ZY07.1
#=GS L8JJ42_9GAMM/82-317       AC L8JJ42.1
#=GS A0A167VYQ7_9BURK/82-317   AC A0A167VYQ7.1
#=GS A0A2A3LK74_9GAMM/82-318   AC A0A2A3LK74.1
#=GS I3IC08_9GAMM/82-314       AC I3IC08.1
#=GS D0Z3V9_PHODD/83-319       AC D0Z3V9.1
#=GS A0A1I2ZSH6_9SPHI/81-316   AC A0A1I2ZSH6.1
#=GS A0A172U3R6_9GAMM/82-317   AC A0A172U3R6.1
#=GS A0A1G8VTE8_9GAMM/82-314   AC A0A1G8VTE8.1
#=GS K4KRF4_SIMAS/82-317       AC K4KRF4.1
#=GS A0A160DVI2_9GAMM/82-318   AC A0A160DVI2.1
#=GS A0A090T1G2_9VIBR/83-318   AC A0A090T1G2.1
#=GS A0A139CBH8_9GAMM/86-321   AC A0A139CBH8.1
#=GS A0A1H2ZQJ2_9GAMM/83-318   AC A0A1H2ZQJ2.1
#=GS A0A0P4R4Z6_9ACTN/85-321   AC A0A0P4R4Z6.1
#=GS A0A248KM97_9ENTR/82-317   AC A0A248KM97.1
#=GS A0A0F4PT72_9GAMM/82-317   AC A0A0F4PT72.1
#=GS A0A0U2Y7F0_9BURK/82-317   AC A0A0U2Y7F0.1
#=GS E8LQH8_9VIBR/82-318       AC E8LQH8.1
#=GS A0A1I6QVR3_9BACL/81-316   AC A0A1I6QVR3.1
#=GS A0A1V3PZT9_9GAMM/83-317   AC A0A1V3PZT9.1
#=GS K6YFL0_9ALTE/82-317       AC K6YFL0.1
#=GS A0A1M7FVK4_9GAMM/83-318   AC A0A1M7FVK4.1
#=GS U2EW76_CLOS4/81-313       AC U2EW76.1
#=GS C0EHW6_9FIRM/81-313       AC C0EHW6.1
#=GS A0A165S0D8_9GAMM/82-317   AC A0A165S0D8.1
#=GS A0A069IKJ9_9BURK/82-317   AC A0A069IKJ9.1
#=GS A0A081FU68_9GAMM/113-348  AC A0A081FU68.1
#=GS A0A0F5AT72_9GAMM/82-317   AC A0A0F5AT72.1
#=GS A0A1G7YWQ0_9VIBR/83-319   AC A0A1G7YWQ0.1
#=GS A0A0F5QY73_9BACL/81-316   AC A0A0F5QY73.1
#=GS A0A0Q4GA42_9SPHI/81-316   AC A0A0Q4GA42.1
#=GS E3EFV0_PAEPS/81-315       AC E3EFV0.1
#=GS A0A0Q4MPJ4_9GAMM/82-317   AC A0A0Q4MPJ4.1
#=GS FABV2_VIBCH/83-323        AC Q9KLG0.1
#=GS A0A291P3M2_9GAMM/83-318   AC A0A291P3M2.1
#=GS I1DTC9_9GAMM/82-317       AC I1DTC9.1
#=GS A0A011RN20_9LACT/83-319   AC A0A011RN20.1
#=GS FABV_SHEON/82-317         AC Q8EG14.1
#=GS FABV_PSEHT/82-317         AC Q3IHQ9.1
#=GS A0A0R1L9F5_9LACO/85-321   AC A0A0R1L9F5.1
#=GS A0A0Q7KUH7_9BURK/82-317   AC A0A0Q7KUH7.1
#=GS A0A1H9HZW7_9GAMM/82-318   AC A0A1H9HZW7.1
#=GS A0A0M3CGI5_9SPHI/82-318   AC A0A0M3CGI5.1
#=GS A0A0Q5TIP0_9SPHI/81-316   AC A0A0Q5TIP0.1
#=GS A0A0S2DZS3_9GAMM/82-318   AC A0A0S2DZS3.1
#=GS A0A1V3PYY8_9GAMM/83-317   AC A0A1V3PYY8.1
#=GS A0A1E5P249_9ACTN/84-320   AC A0A1E5P249.1
#=GS A0A069DHR0_9BACL/59-294   AC A0A069DHR0.1
#=GS FABV_SHEAM/82-317         AC A1S4Y1.1
#=GS E3H714_ILYPC/82-319       AC E3H714.1
#=GS A0A0B0HW71_9BACL/81-241   AC A0A0B0HW71.1
#=GS A0A1I4Z437_9FLAO/82-318   AC A0A1I4Z437.1
#=GS A0A0A2MJM4_9FLAO/81-316   AC A0A0A2MJM4.1
#=GS A0A0J8GSM2_9ALTE/81-316   AC A0A0J8GSM2.1
#=GS R1F4C0_9GAMM/82-317       AC R1F4C0.1
#=GS A6G626_9DELT/100-340      AC A6G626.1
#=GS A0A089WSN7_9PSED/83-320   AC A0A089WSN7.1
#=GS A0A1G5BJY8_9BACL/81-316   AC A0A1G5BJY8.1
#=GS FABV_MARMS/82-317         AC A6VZ98.1
#=GS A0A0J1JR53_9GAMM/82-317   AC A0A0J1JR53.1
#=GS A0A0S2SKC0_9GAMM/82-317   AC A0A0S2SKC0.1
#=GS A0A1G7GZJ5_9FLAO/82-318   AC A0A1G7GZJ5.1
#=GS A0A0M8SL48_9ACTN/70-303   AC A0A0M8SL48.1
#=GS A0A1M6F7B8_9FLAO/81-316   AC A0A1M6F7B8.1
#=GS A0A090V5C0_ESCVU/82-317   AC A0A090V5C0.1
#=GS A0A1Z9L2T0_9GAMM/82-316   AC A0A1Z9L2T0.1
#=GS A4C220_9FLAO/102-337      AC A4C220.1
#=GS F0M0E8_VIBFN/83-319       AC F0M0E8.1
#=GS A0A0D6TJN8_9FLAO/81-316   AC A0A0D6TJN8.1
#=GS A0A0D1PDK9_BRAEL/82-314   AC A0A0D1PDK9.1
#=GS A0A2A5T7Y3_9BACT/82-317   AC A0A2A5T7Y3.1
#=GS A0A1G7ZLA9_9VIBR/82-317   AC A0A1G7ZLA9.1
#=GS A0A1X1MYI4_9VIBR/83-318   AC A0A1X1MYI4.1
#=GS A0A0M2K5B8_9GAMM/82-317   AC A0A0M2K5B8.1
#=GS E8M5U3_9VIBR/83-319       AC E8M5U3.1
#=GS A0A0F5PX83_9RHIZ/82-315   AC A0A0F5PX83.1
#=GS A0A0K6GY61_9GAMM/82-317   AC A0A0K6GY61.1
#=GS A0A0N8HJI0_9GAMM/84-319   AC A0A0N8HJI0.1
#=GS A0A1I6P1R8_9BACL/81-316   AC A0A1I6P1R8.1
#=GS A0A227NN83_9FLAO/81-316   AC A0A227NN83.1
#=GS A0A1B8ZGZ6_9FLAO/82-317   AC A0A1B8ZGZ6.1
#=GS E9CJW7_9GAMM/82-317       AC E9CJW7.1
#=GS A0A1H3XEU2_ALKAM/82-317   AC A0A1H3XEU2.1
#=GS G7UUB8_PSEUP/82-318       AC G7UUB8.1
#=GS A0A1Y6C3V2_9ALTE/82-317   AC A0A1Y6C3V2.1
#=GS A0A0L8EXI3_9CLOT/82-318   AC A0A0L8EXI3.1
#=GS A0A0N8P2U0_9GAMM/82-317   AC A0A0N8P2U0.1
#=GS A0A101XRS1_9BACL/81-316   AC A0A101XRS1.1
#=GS A0A1I2CQU1_9GAMM/82-316   AC A0A1I2CQU1.1
#=GS A0A085GB46_9GAMM/82-317   AC A0A085GB46.1
#=GS A0A0G3LMK9_XANCT/82-318   AC A0A0G3LMK9.1
#=GS C9P431_VIBME/82-317       AC C9P431.1
#=GS I8UAZ4_9ALTE/82-317       AC I8UAZ4.1
#=GS A0A1B8P6X0_HALEL/83-318   AC A0A1B8P6X0.1
#=GS A0A1R1CAT1_9BACL/81-316   AC A0A1R1CAT1.1
#=GS A0A0D5VCF0_9BURK/82-317   AC A0A0D5VCF0.1
#=GS A0A1B7GS11_9BACT/82-318   AC A0A1B7GS11.1
#=GS R5L5A6_9SPIR/82-319       AC R5L5A6.1
#=GS A0A1H8VRB3_9FIRM/81-316   AC A0A1H8VRB3.1
#=GS A0A108U680_9GAMM/82-319   AC A0A108U680.1
#=GS F8EZE4_TRECH/86-327       AC F8EZE4.1
#=GS A0A1H9V9D3_9SPHI/81-316   AC A0A1H9V9D3.1
#=GS A0A1H6IB36_9FLAO/82-318   AC A0A1H6IB36.1
#=GS L0MEZ9_9GAMM/82-317       AC L0MEZ9.1
#=GS A0A0F4J0D9_9ACTN/83-319   AC A0A0F4J0D9.1
#=GS U3AHQ2_9VIBR/82-317       AC U3AHQ2.1
#=GS A0A1Y0MYY0_9FLAO/81-316   AC A0A1Y0MYY0.1
#=GS A0A0W8JD56_9VIBR/83-320   AC A0A0W8JD56.1
#=GS A0A0G9H8Y2_9GAMM/82-316   AC A0A0G9H8Y2.1
#=GS A0A1M5CS16_9GAMM/82-314   AC A0A1M5CS16.1
#=GS A0A125Y669_AERCA/81-315   AC A0A125Y669.1
#=GS W4S955_9XANT/82-318       AC W4S955.1
#=GS A0A010SJ80_PSEFL/82-317   AC A0A010SJ80.1
#=GS B5JM92_9BACT/82-318       AC B5JM92.1
#=GS A0A0L0JCE3_9ACTN/86-322   AC A0A0L0JCE3.1
#=GS A0A1I2YTP7_9GAMM/85-320   AC A0A1I2YTP7.1
#=GS C5AK57_BURGB/82-317       AC C5AK57.1
#=GS A0A0P9GU56_9BACL/81-316   AC A0A0P9GU56.1
#=GS A0A1I5N664_9BACT/81-316   AC A0A1I5N664.1
#=GS R9PNE6_AGAAL/82-317       AC R9PNE6.1
#=GS A0A090P405_9VIBR/82-317   AC A0A090P405.1
#=GS A0A078KT49_9FIRM/81-315   AC A0A078KT49.1
#=GS G4F736_9GAMM/83-318       AC G4F736.1
#=GS W0LJL2_9GAMM/82-317       AC W0LJL2.1
#=GS A0A209DCV8_9BACL/82-317   AC A0A209DCV8.1
#=GS A0A1S1J268_9FLAO/81-316   AC A0A1S1J268.1
#=GS A0A1E4IV69_9BURK/82-317   AC A0A1E4IV69.1
#=GS A0A0T9PEP0_9GAMM/82-318   AC A0A0T9PEP0.1
#=GS H0J5I0_9GAMM/83-318       AC H0J5I0.1
#=GS A0A1J5MRD1_9GAMM/82-317   AC A0A1J5MRD1.1
#=GS A0A0X8H206_9FIRM/82-317   AC A0A0X8H206.1
#=GS G4QJ38_GLANF/86-321       AC G4QJ38.1
#=GS A0A257M0C9_9BACT/82-317   AC A0A257M0C9.1
#=GS A0A291QJX2_9ACTN/84-319   AC A0A291QJX2.1
#=GS A0A1M4WD50_9LACT/83-319   AC A0A1M4WD50.1
#=GS A0A1E2V400_9GAMM/83-318   AC A0A1E2V400.1
#=GS FABV_PSEFS/82-316         AC C3K5J5.1
#=GS A0A0N8TXB1_9GAMM/82-317   AC A0A0N8TXB1.1
#=GS A0A1M5DPD6_9BACT/88-324   AC A0A1M5DPD6.1
#=GS V5UC99_9BURK/82-317       AC V5UC99.1
#=GS A0A209DM51_9BACL/81-316   AC A0A209DM51.1
#=GS E3E5Q6_PAEPS/81-316       AC E3E5Q6.1
#=GS FABV_CLOPE/81-315         AC Q8XIP1.1
#=GS A8UPL9_9FLAO/81-316       AC A8UPL9.1
#=GS A0A1V2AX90_9BACT/81-316   AC A0A1V2AX90.1
#=GS A0A1T1BJ15_9FLAO/81-316   AC A0A1T1BJ15.1
#=GS A0A1G1LKZ6_9BACT/82-318   AC A0A1G1LKZ6.1
#=GS A0A1M5SYH6_FLAFR/81-316   AC A0A1M5SYH6.1
#=GS V9QSG3_9PSED/82-316       AC V9QSG3.1
#=GS A0A0A8DXP1_9XANT/82-318   AC A0A0A8DXP1.1
#=GS A0A0J8YL42_9BACT/82-318   AC A0A0J8YL42.1
#=GS A0A1V3P8X5_9GAMM/83-317   AC A0A1V3P8X5.1
#=GS A0A1X7MT95_9LACT/83-319   AC A0A1X7MT95.1
#=GS D7VRB1_9SPHI/82-318       AC D7VRB1.1
#=GS A0A0S2K4A1_9GAMM/82-317   AC A0A0S2K4A1.1
#=GS A0A178HYJ7_9RHIZ/82-315   AC A0A178HYJ7.1
#=GS A0A085BH00_9FLAO/82-318   AC A0A085BH00.1
#=GS R6WHE9_9FIRM/81-313       AC R6WHE9.1
#=GS F7QI69_9BRAD/82-314       AC F7QI69.1
#=GS A0A0J1HEB4_9GAMM/83-319   AC A0A0J1HEB4.1
#=GS A0A1X9ZBM2_9SPHI/81-316   AC A0A1X9ZBM2.1
#=GS A0A0L0TKU6_9BURK/97-332   AC A0A0L0TKU6.1
#=GS A0KEB7_AERHH/81-315       AC A0KEB7.1
#=GS A0A0F4NM35_9VIBR/83-319   AC A0A0F4NM35.1
#=GS A0A1M7NJS8_9FLAO/81-316   AC A0A1M7NJS8.1
#=GS A0A0U2VMB4_9LACT/83-319   AC A0A0U2VMB4.1
#=GS A0A246AH21_9SPHI/81-316   AC A0A246AH21.1
#=GS R5SGL9_9CLOT/81-313       AC R5SGL9.1
#=GS A0A0X8FD63_9LACT/82-318   AC A0A0X8FD63.1
#=GS A0A1R1EJ85_9BACL/81-317   AC A0A1R1EJ85.1
#=GS A0A1G1KYA2_9BACT/83-318   AC A0A1G1KYA2.1
#=GS A0A1D7QBE6_9SPHI/81-316   AC A0A1D7QBE6.1
#=GS A0A1E5DZT6_9VIBR/82-317   AC A0A1E5DZT6.1
#=GS A0A1X7AP76_9GAMM/82-317   AC A0A1X7AP76.1
#=GS A0A1G9CHP2_9SPHI/81-317   AC A0A1G9CHP2.1
#=GS A0A1S1N0A2_9GAMM/82-317   AC A0A1S1N0A2.1
#=GS C9QFH2_VIBOR/83-317       AC C9QFH2.1
#=GS A0A0P0NK30_9SPHI/81-316   AC A0A0P0NK30.1
#=GS A0A1E7NCI8_KITAU/86-322   AC A0A1E7NCI8.1
#=GS A0A1H6US87_9FLAO/81-316   AC A0A1H6US87.1
#=GS A0A1T4VMC9_9GAMM/83-319   AC A0A1T4VMC9.1
#=GS A0YG50_9GAMM/62-297       AC A0YG50.1
#=GS W0JAL1_9BACT/82-318       AC W0JAL1.1
#=GS FABV_STRAW/79-313         AC Q93HE4.2
#=GS A0A1H5K787_9FLAO/81-316   AC A0A1H5K787.1
#=GS FABV_ALISL/82-317         AC B6EHQ2.1
#=GS FABV_PARXL/82-317         AC Q13YR8.1
#=GS A0A1B9XXE6_9FLAO/81-316   AC A0A1B9XXE6.1
#=GS A0A095XYB5_9GAMM/82-317   AC A0A095XYB5.1
#=GS A6D1N1_9VIBR/83-318       AC A6D1N1.1
#=GS S0FMA9_9FIRM/81-316       AC S0FMA9.1
#=GS A0A0W1L771_9GAMM/82-317   AC A0A0W1L771.1
#=GS A0A1B1VDT9_9VIBR/82-317   AC A0A1B1VDT9.1
#=GS E3BED3_9VIBR/82-317       AC E3BED3.1
#=GS A0A0F5VF13_9GAMM/82-317   AC A0A0F5VF13.1
#=GS A0A238VRU1_9FLAO/81-316   AC A0A238VRU1.1
#=GS A0A014M2J8_9GAMM/82-317   AC A0A014M2J8.1
#=GS F9YST5_CAPCC/82-318       AC F9YST5.1
#=GS A0A0Q8ZXV1_9FLAO/81-316   AC A0A0Q8ZXV1.1
#=GS A0A1N6WBM0_9GAMM/82-317   AC A0A1N6WBM0.1
#=GS A0A1J8QD80_9GAMM/83-318   AC A0A1J8QD80.1
#=GS A0A0C3IC83_9VIBR/83-319   AC A0A0C3IC83.1
#=GS A0A158IV10_9BURK/82-317   AC A0A158IV10.1
#=GS U2KH51_TRELE/82-317       AC U2KH51.1
#=GS A0A1T5GQ59_9FLAO/82-318   AC A0A1T5GQ59.1
#=GS F0GHF2_9BURK/82-317       AC F0GHF2.1
#=GS A0A0Q4RBN1_9BACL/81-316   AC A0A0Q4RBN1.1
#=GS A9KNR3_LACP7/81-315       AC A9KNR3.1
#=GS A0A257X7Q9_9BACT/82-318   AC A0A257X7Q9.1
#=GS A0A1C7I9S6_9FIRM/81-313   AC A0A1C7I9S6.1
#=GS A0A1G9A4V3_9GAMM/83-318   AC A0A1G9A4V3.1
#=GS A0A0F5Q785_9RHIZ/82-315   AC A0A0F5Q785.1
#=GS A0A0F2P3R0_9GAMM/82-317   AC A0A0F2P3R0.1
#=GS A0A1I0NCC9_9GAMM/111-351  AC A0A1I0NCC9.1
#=GS A0A1I2EP46_9FLAO/81-316   AC A0A1I2EP46.1
#=GS S3L4T2_TREMA/85-320       AC S3L4T2.1
#=GS H5TD44_9ALTE/88-323       AC H5TD44.1
#=GS U2J3V2_9SPHI/82-318       AC U2J3V2.1
#=GS A0A0H2MA09_VARPD/82-317   AC A0A0H2MA09.1
#=GS U2N2D0_9CLOT/81-316       AC U2N2D0.1
#=GS A0A0R0C8M1_9GAMM/82-316   AC A0A0R0C8M1.1
#=GS FABV_TOLAT/82-317         AC C4LB77.1
#=GS S6GE48_9GAMM/1-183        AC S6GE48.1
#=GS A0A1S1XZC4_9GAMM/82-317   AC A0A1S1XZC4.1
#=GS A0A1K1XQM1_9BACL/82-317   AC A0A1K1XQM1.1
#=GS F0RUD8_SPHGB/93-328       AC F0RUD8.1
#=GS A0A0Q8EI47_9GAMM/82-318   AC A0A0Q8EI47.1
#=GS A0A1G8BDJ9_9PSED/82-318   AC A0A1G8BDJ9.1
#=GS R5EMM8_9GAMM/82-317       AC R5EMM8.1
#=GS K6ZJ58_9ALTE/82-317       AC K6ZJ58.1
#=GS A0A1Y4MF02_9FIRM/81-311   AC A0A1Y4MF02.1
#=GS A0A0G9HKA9_9XANT/82-318   AC A0A0G9HKA9.1
#=GS U3BG67_VIBPR/82-317       AC U3BG67.1
#=GS A0A1R1AM43_9BACL/81-316   AC A0A1R1AM43.1
#=GS A0A261TRG7_9BORD/82-317   AC A0A261TRG7.1
#=GS A0A1I6GNZ5_9GAMM/82-317   AC A0A1I6GNZ5.1
#=GS E1R1P1_SEDSS/83-318       AC E1R1P1.1
#=GS A0A0F4NVL9_PSEO7/82-317   AC A0A0F4NVL9.1
#=GS A0A0A0DKU2_9SPIO/81-316   AC A0A0A0DKU2.1
#=GS A0A0F7M2D6_9GAMM/82-317   AC A0A0F7M2D6.1
#=GS A0A1V4IG30_9CLOT/81-316   AC A0A1V4IG30.1
#=GS A0A1Y0M7N1_9FLAO/81-316   AC A0A1Y0M7N1.1
#=GS A0A098M9Q8_9BACL/81-316   AC A0A098M9Q8.1
#=GS A0A286A862_9SPHI/81-316   AC A0A286A862.1
#=GS A0A0R0BX63_9GAMM/82-316   AC A0A0R0BX63.1
#=GS A0A0W1SDF7_9GAMM/82-317   AC A0A0W1SDF7.1
#=GS A0A1G7CAU4_9FLAO/81-316   AC A0A1G7CAU4.1
#=GS U2ZI73_VIBPR/98-334       AC U2ZI73.1
#=GS A0A1E2VBJ0_9GAMM/82-317   AC A0A1E2VBJ0.1
#=GS A0A0H3J994_CLOPA/95-328   AC A0A0H3J994.1
#=GS U1FL06_TRESO/91-327       AC U1FL06.1
#=GS F7YPZ0_VIBA7/84-319       AC F7YPZ0.1
#=GS A0A1U9N8L5_9GAMM/82-314   AC A0A1U9N8L5.1
#=GS A0A231MZV8_9GAMM/82-317   AC A0A231MZV8.1
#=GS FABV_COXBU/82-319         AC Q83EP5.1
#=GS A0A0D6SAB6_9PSED/82-317   AC A0A0D6SAB6.1
#=GS A0A1B7UHJ5_9GAMM/82-317   AC A0A1B7UHJ5.1
#=GS L8JCF9_9GAMM/83-319       AC L8JCF9.1
#=GS A0A1B1FYG3_9BACT/81-316   AC A0A1B1FYG3.1
#=GS A0A0D0K857_9FLAO/81-316   AC A0A0D0K857.1
#=GS A0A0C1DKX4_9FLAO/81-316   AC A0A0C1DKX4.1
#=GS F6CVE2_MARPP/82-317       AC F6CVE2.1
#=GS A0A193KBH8_9VIBR/82-317   AC A0A193KBH8.1
#=GS A0A0D3VCM0_9BACL/81-316   AC A0A0D3VCM0.1
#=GS FABV1_PHOPR/82-317        AC Q6LPG9.2
#=GS D4ZAB7_SHEVD/82-317       AC D4ZAB7.1
#=GS A0A0A5HZ93_9VIBR/83-319   AC A0A0A5HZ93.1
#=GS J3C3J0_FLASC/81-316       AC J3C3J0.1
#=GS A0A0W8JGR3_9VIBR/82-317   AC A0A0W8JGR3.1
#=GS A0A0L0WDE5_CLOPU/81-314   AC A0A0L0WDE5.1
#=GS A0A1B8WRJ0_9BACI/81-316   AC A0A1B8WRJ0.1
#=GS A0A090IJB8_9GAMM/82-317   AC A0A090IJB8.1
#=GS A0A1H4B4L6_9FLAO/81-316   AC A0A1H4B4L6.1
#=GS A6CX48_9VIBR/83-319       AC A6CX48.1
#=GS A0A0R2UC91_9GAMM/81-316   AC A0A0R2UC91.1
#=GS A0A085F744_9RHIZ/82-315   AC A0A085F744.1
#=GS A0A0C5VPQ2_9GAMM/82-317   AC A0A0C5VPQ2.1
#=GS A0A0F4R1I7_9GAMM/82-317   AC A0A0F4R1I7.1
#=GS A0A1Y4FCX4_9FIRM/82-313   AC A0A1Y4FCX4.1
#=GS A0A0C5WK54_9GAMM/83-319   AC A0A0C5WK54.1
#=GS A0A1M7LC75_9FIRM/87-321   AC A0A1M7LC75.1
#=GS A0A167FGJ7_9BACL/81-316   AC A0A167FGJ7.1
#=GS R5VRV6_9FIRM/84-316       AC R5VRV6.1
#=GS A0A1U7JIH9_9RHOB/83-319   AC A0A1U7JIH9.1
#=GS A0A1R1LEB4_9GAMM/82-317   AC A0A1R1LEB4.1
#=GS A0A1Y6IWM9_9VIBR/83-320   AC A0A1Y6IWM9.1
#=GS K2JK91_9GAMM/82-317       AC K2JK91.1
#=GS FABV_XANCP/82-318         AC Q8PE66.1
#=GS V6S195_9FLAO/81-316       AC V6S195.1
#=GS A0A1M7H6A9_9FLAO/81-316   AC A0A1M7H6A9.1
#=GS A0A143XGL5_9FIRM/81-311   AC A0A143XGL5.1
#=GS A0A1G8D9A1_9FLAO/81-316   AC A0A1G8D9A1.1
#=GS A0A1M7BKU9_9GAMM/83-317   AC A0A1M7BKU9.1
#=GS I0QW63_9GAMM/82-317       AC I0QW63.1
#=GS R5K1M3_9CLOT/81-313       AC R5K1M3.1
#=GS A0A1N6FAW8_9LACT/83-319   AC A0A1N6FAW8.1
#=GS A0A0J1HD48_9GAMM/83-323   AC A0A0J1HD48.1
#=GS A0A085HMT1_9ENTR/82-317   AC A0A085HMT1.1
#=GS E3G636_ENTLS/82-317       AC E3G636.1
#=GS E8M6W6_9VIBR/82-317       AC E8M6W6.1
#=GS A0A1W9N8P8_9SPIO/81-316   AC A0A1W9N8P8.1
#=GS FABV_PSEA6/82-317         AC Q15YQ7.1
#=GS G8QV68_SPHPG/93-328       AC G8QV68.1
#=GS A0A1L8PPP6_9LACT/82-318   AC A0A1L8PPP6.1
#=GS FABV_BURCJ/82-317         AC B4EKD5.1
#=GS A0A0Q5VA17_9FLAO/81-316   AC A0A0Q5VA17.1
#=GS K6YID4_9ALTE/82-317       AC K6YID4.1
#=GS H2ILF3_VIBSJ/83-319       AC H2ILF3.1
#=GS R1GZT5_9GAMM/81-288       AC R1GZT5.1
#=GS A0A0J1J3R6_9FIRM/106-340  AC A0A0J1J3R6.1
#=GS A0A1Q5XTI4_9BACL/81-316   AC A0A1Q5XTI4.1
#=GS E1V6G5_HALED/83-318       AC E1V6G5.1
#=GS A0A1M5XTH1_9VIBR/82-317   AC A0A1M5XTH1.1
#=GS A0A0K2L9F8_9LACO/87-324   AC A0A0K2L9F8.1
#=GS A0A1Q9GG88_9GAMM/82-317   AC A0A1Q9GG88.1
#=GS A0A1I1L8D1_9PSED/82-317   AC A0A1I1L8D1.1
#=GS A0A0F4IQR4_9ACTN/86-322   AC A0A0F4IQR4.1
#=GS B1TB16_9BURK/82-317       AC B1TB16.1
#=GS A0A099KIM3_9GAMM/82-317   AC A0A099KIM3.1
#=GS A0A1I5IQP7_9RHIZ/83-319   AC A0A1I5IQP7.1
#=GS A0A1W9JIC2_9PROT/82-317   AC A0A1W9JIC2.1
#=GS A0A1T5C779_9SPHI/82-318   AC A0A1T5C779.1
#=GS M4UNK9_9GAMM/82-317       AC M4UNK9.1
#=GS A0A066USW7_9VIBR/83-319   AC A0A066USW7.1
#=GS A0A239NDM9_9ACTN/86-322   AC A0A239NDM9.1
#=GS A0A1Y3YI53_9FIRM/81-313   AC A0A1Y3YI53.1
#=GS A0A1H9E634_9SPIO/91-336   AC A0A1H9E634.1
#=GS A0A1Y5G010_9GAMM/82-317   AC A0A1Y5G010.1
#=GS A0A1I2DC21_9DELT/100-341  AC A0A1I2DC21.1
#=GS A0A1W1XQ11_9CLOT/81-314   AC A0A1W1XQ11.1
#=GS A0A0R0C6W3_9GAMM/82-316   AC A0A0R0C6W3.1
#=GS A0A090INR5_9GAMM/82-317   AC A0A090INR5.1
#=GS A0A0F0F824_9PSED/83-321   AC A0A0F0F824.1
#=GS A0A023Y4U1_9GAMM/82-316   AC A0A023Y4U1.1
#=GS A0A1I0GG31_9BACL/81-316   AC A0A1I0GG31.1
#=GS A0A1H8CQS1_9FIRM/81-313   AC A0A1H8CQS1.1
#=GS A0A0S2GC74_9GAMM/82-318   AC A0A0S2GC74.1
#=GS A0A126T7E9_9GAMM/82-317   AC A0A126T7E9.1
#=GS A0A0R1RMF2_9LACO/87-324   AC A0A0R1RMF2.1
#=GS A0A1I7I8Y3_9GAMM/88-323   AC A0A1I7I8Y3.1
#=GS A0A269VWJ0_9BACL/81-316   AC A0A269VWJ0.1
#=GS A0A2C6MSU9_9VIBR/83-319   AC A0A2C6MSU9.1
#=GS A0A125JSE7_9BURK/82-317   AC A0A125JSE7.1
#=GS I0QLF0_9GAMM/81-316       AC I0QLF0.1
#=GS D2Q3D1_KRIFD/83-313       AC D2Q3D1.1
#=GS A7MYD8_VIBCB/82-317       AC A7MYD8.1
#=GS A0A0R2A6V4_9LACO/87-324   AC A0A0R2A6V4.1
#=GS A0A1E8CM61_9GAMM/82-318   AC A0A1E8CM61.1
#=GS A0A1Q3H4D9_9BACT/81-316   AC A0A1Q3H4D9.1
#=GS A0A1D9PDU5_9FLAO/81-316   AC A0A1D9PDU5.1
#=GS A0A160N0S2_9GAMM/82-318   AC A0A160N0S2.1
#=GS FABV_PSEF5/82-317         AC Q4KBE3.1
#=GS W1FXH8_ECOLX/59-294       AC W1FXH8.1
#=GS A0A0A2MH44_9FLAO/81-316   AC A0A0A2MH44.1
#=GS F3LGH2_9GAMM/87-322       AC F3LGH2.1
#=GS A0A1H8ZCU8_9RHIZ/82-315   AC A0A1H8ZCU8.1
#=GS A0A0R3MIX5_9BRAD/82-314   AC A0A0R3MIX5.1
#=GS G8LSH4_CLOCD/81-316       AC G8LSH4.1
#=GS A0A0U2PE98_9ALTE/82-317   AC A0A0U2PE98.1
#=GS A0A0B8PJ22_9VIBR/86-183   AC A0A0B8PJ22.1
#=GS A0A1V3I4S4_9GAMM/82-317   AC A0A1V3I4S4.1
#=GS J8V7Z8_PSEPU/35-272       AC J8V7Z8.1
#=GS R5LP52_9SPIR/82-319       AC R5LP52.1
#=GS A0A143HND5_9GAMM/82-314   AC A0A143HND5.1
#=GS A0A267TG48_9BACT/81-316   AC A0A267TG48.1
#=GS A0A1I6MWP5_9GAMM/219-453  AC A0A1I6MWP5.1
#=GS A0A0F2TE62_STRR3/86-322   AC A0A0F2TE62.1
#=GS A0A1I1VGT8_9FLAO/81-316   AC A0A1I1VGT8.1
#=GS A0A085ZJ24_9FLAO/81-316   AC A0A085ZJ24.1
#=GS A0A1D8YE49_9GAMM/82-316   AC A0A1D8YE49.1
#=GS A0A1I0T9E4_9SPHI/81-316   AC A0A1I0T9E4.1
#=GS K0C4G8_CYCSP/86-321       AC K0C4G8.1
#=GS A0A0C2F4M2_9PSED/82-313   AC A0A0C2F4M2.1
#=GS F7RUU7_9GAMM/82-317       AC F7RUU7.1
#=GS FABV_BURPS/82-317         AC Q63TE9.1
#=GS G2NR66_STREK/86-322       AC G2NR66.1
#=GS R5W6E0_9CLOT/81-315       AC R5W6E0.1
#=GS A0A1M5ZVY1_9VIBR/84-320   AC A0A1M5ZVY1.1
#=GS I9B288_9FIRM/81-316       AC I9B288.1
#=GS A0A0Q7I8U0_9RHIZ/82-315   AC A0A0Q7I8U0.1
#=GS A0A0R1WAF1_9LACO/88-325   AC A0A0R1WAF1.1
#=GS Q1ZX93_PHOAS/83-320       AC Q1ZX93.1
#=GS A0A1L3JI91_9FLAO/81-316   AC A0A1L3JI91.1
#=GS A0A0P7GXZ8_9XANT/82-318   AC A0A0P7GXZ8.1
#=GS A0A1R4B1Z3_9VIBR/82-317   AC A0A1R4B1Z3.1
#=GS A0A1E5DZ61_9VIBR/83-319   AC A0A1E5DZ61.1
#=GS A0A1A9MY60_9BURK/82-317   AC A0A1A9MY60.1
#=GS A0A1E3GA56_9GAMM/81-317   AC A0A1E3GA56.1
#=GS A0A0F4IZR1_9ACTN/83-319   AC A0A0F4IZR1.1
#=GS A0A1Q4X2A4_9ACTN/86-322   AC A0A1Q4X2A4.1
#=GS A0A0B8T686_9SPHI/82-318   AC A0A0B8T686.1
#=GS A0A0F5LDE5_9RHIZ/82-315   AC A0A0F5LDE5.1
#=GS A0A0B0HPM4_9BACL/1-50     AC A0A0B0HPM4.1
#=GS A0A1N6QRE9_9GAMM/82-317   AC A0A1N6QRE9.1
#=GS G8PEI0_PEDCP/86-323       AC G8PEI0.1
#=GS F7NRI3_9GAMM/82-317       AC F7NRI3.1
#=GS C7R9D9_KANKD/84-320       AC C7R9D9.1
#=GS A0A1Z8UFG1_9PROT/82-317   AC A0A1Z8UFG1.1
#=GS S7XET4_9FLAO/81-316       AC S7XET4.1
#=GS A0A1T1CBA8_9FLAO/81-316   AC A0A1T1CBA8.1
#=GS A0A290QA68_9BACT/82-318   AC A0A290QA68.1
#=GS A0A0R2W4T8_9GAMM/81-316   AC A0A0R2W4T8.1
#=GS F5Z979_ALTNA/82-317       AC F5Z979.1
#=GS A0A229UID4_9BACL/82-317   AC A0A229UID4.1
#=GS A0A1X7J2P2_9BURK/82-317   AC A0A1X7J2P2.1
#=GS A0A098M4B2_9BACL/81-316   AC A0A098M4B2.1
#=GS W4AL42_9BACL/81-316       AC W4AL42.1
#=GS A0A1T4RQR1_9GAMM/82-317   AC A0A1T4RQR1.1
#=GS A0A154QWL3_9GAMM/83-317   AC A0A154QWL3.1
#=GS A0A1V3R455_9FLAO/81-316   AC A0A1V3R455.1
#=GS D4XDT0_9BURK/101-336      AC D4XDT0.1
#=GS A0A0H4UUM6_9COXI/82-319   AC A0A0H4UUM6.1
#=GS A0A1B9E9N6_9FLAO/81-316   AC A0A1B9E9N6.1
#=GS G0GBE1_SPITZ/82-317       AC G0GBE1.1
#=GS FABV_BURVG/82-317         AC A4JK23.1
#=GS Q03TR0_LACBA/85-322       AC Q03TR0.1
#=GS A0A1H7QTZ5_9GAMM/83-318   AC A0A1H7QTZ5.1
#=GS H2G171_OCESG/82-317       AC H2G171.1
#=GS A0A1I4YRH5_9FLAO/82-318   AC A0A1I4YRH5.1
#=GS R4K4G8_CLOPA/81-314       AC R4K4G8.1
#=GS A0A1Q9H9R6_9VIBR/83-319   AC A0A1Q9H9R6.1
#=GS S4Y3R8_SORCE/91-319       AC S4Y3R8.1
#=GS R4I195_9GAMM/82-317       AC R4I195.1
#=GS A0A1H2M4U0_9PSED/82-316   AC A0A1H2M4U0.1
#=GS F9ZYG7_METMM/82-317       AC F9ZYG7.1
#=GS A0A0F5FER9_9RHIZ/82-315   AC A0A0F5FER9.1
#=GS H2IA80_VIBSJ/82-317       AC H2IA80.1
#=GS F9RCC8_VIBSN/83-319       AC F9RCC8.1
#=GS A0A2A5GHZ5_9GAMM/81-316   AC A0A2A5GHZ5.1
#=GS A0A1H2ETZ7_9BACT/82-315   AC A0A1H2ETZ7.1
#=GS X7E1U3_9GAMM/82-317       AC X7E1U3.1
#=GS A0A239TJU4_9FIRM/81-311   AC A0A239TJU4.1
#=GS A0A231RHU1_9BACL/81-316   AC A0A231RHU1.1
#=GS H3NX80_9GAMM/82-317       AC H3NX80.1
#=GS I4VM36_9GAMM/82-316       AC I4VM36.1
#=GS A0A2C6V800_NOSLI/81-316   AC A0A2C6V800.1
#=GS A0A248VJY8_9BURK/82-317   AC A0A248VJY8.1
#=GS A0A0H1ATH3_9GAMM/82-318   AC A0A0H1ATH3.1
#=GS A0A0Q8F988_9GAMM/82-318   AC A0A0Q8F988.1
#=GS A0A120FPV4_9BRAD/82-314   AC A0A120FPV4.1
#=GS A0A2A4GC18_9FLAO/81-316   AC A0A2A4GC18.1
#=GS K0D1M0_ALTMS/82-317       AC K0D1M0.1
#=GS A0A0P0G8I4_9BACT/82-315   AC A0A0P0G8I4.1
#=GS A0A1J0VEG0_9GAMM/83-318   AC A0A1J0VEG0.1
#=GS R6DTG9_9CLOT/81-313       AC R6DTG9.1
#=GS A0A094J048_9GAMM/82-317   AC A0A094J048.1
#=GS A0A0Q9YN56_9COXI/82-318   AC A0A0Q9YN56.1
#=GS A0A1E8FK06_9ALTE/82-317   AC A0A1E8FK06.1
#=GS A0A0N0E1S7_9PSED/82-317   AC A0A0N0E1S7.1
#=GS A0A0A8E8Y4_9COXI/83-320   AC A0A0A8E8Y4.1
#=GS A0A0B5RZW4_9FLAO/82-318   AC A0A0B5RZW4.1
#=GS A0A1A8TE12_9GAMM/82-317   AC A0A1A8TE12.1
#=GS A0A1M6YBU0_9BURK/82-317   AC A0A1M6YBU0.1
#=GS A0A071LRZ7_9ENTR/82-317   AC A0A071LRZ7.1
#=GS A0A1G8VZW0_9ACTN/86-321   AC A0A1G8VZW0.1
#=GS A0A1Y6FDK7_9RHIZ/82-315   AC A0A1Y6FDK7.1
#=GS A0A178K8M0_9GAMM/82-317   AC A0A178K8M0.1
#=GS G2Z1W7_FLABF/81-316       AC G2Z1W7.1
#=GS A0A0A2LQN6_9FLAO/81-316   AC A0A0A2LQN6.1
#=GS A0A212T339_9ACTN/85-320   AC A0A212T339.1
#=GS A0A1T1HCG6_OCELI/82-317   AC A0A1T1HCG6.1
#=GS A0A0N1MV51_9GAMM/82-317   AC A0A0N1MV51.1
#=GS G7M8L6_9CLOT/81-316       AC G7M8L6.1
#=GS A0A146G5F5_9BACT/82-314   AC A0A146G5F5.1
#=GS A0A1Y6EKQ6_9GAMM/82-317   AC A0A1Y6EKQ6.1
#=GS FABV_TERTT/82-317         AC C5BQC9.1
#=GS A0A0S4I6I5_9PSED/116-353  AC A0A0S4I6I5.1
#=GS A0A1U7EFE6_9LACT/82-318   AC A0A1U7EFE6.1
#=GS FABV_CLOB8/82-318         AC A6LV73.1
#=GS Q1N691_9GAMM/83-317       AC Q1N691.1
#=GS A0A254SJ81_9BACT/93-329   AC A0A254SJ81.1
#=GS R8ASD3_PLESH/83-316       AC R8ASD3.1
#=GS A0A0D0F1K4_9FLAO/81-316   AC A0A0D0F1K4.1
#=GS A0A1X1QKE9_9GAMM/82-317   AC A0A1X1QKE9.1
#=GS I4MXJ3_9PSED/82-317       AC I4MXJ3.1
#=GS A0A261Q3K5_9BACT/81-316   AC A0A261Q3K5.1
#=GS A0A1H6ZYQ6_9BURK/82-317   AC A0A1H6ZYQ6.1
#=GS R5GY12_9FIRM/84-317       AC R5GY12.1
#=GS A0A0Q8BRR2_9BURK/82-317   AC A0A0Q8BRR2.1
#=GS A0A1M4WJ08_9BACL/82-318   AC A0A1M4WJ08.1
#=GS A0A1A8T2E0_9GAMM/82-317   AC A0A1A8T2E0.1
#=GS A0A1N6UHK6_9GAMM/82-318   AC A0A1N6UHK6.1
#=GS F7YS95_VIBA7/1-198        AC F7YS95.1
#=GS A0A117RH10_9ACTN/90-325   AC A0A117RH10.1
#=GS Q1ZQS1_PHOAS/82-317       AC Q1ZQS1.1
#=GS A0A1H1SUV6_9BACT/82-319   AC A0A1H1SUV6.1
#=GS A0A090SP34_9VIBR/1-215    AC A0A090SP34.1
#=GS FABV_BRAHW/82-320         AC C0QVH0.1
#=GS FABV_TREDE/87-320         AC Q73Q47.1
#=GS FABV_TREDE/87-320         DR PDB; 4GGP C; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG B; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG P; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG L; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGO C; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG M; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG A; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGP A; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGO B; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG J; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG D; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGO A; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG O; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG E; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG I; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG G; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGP B; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG F; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG H; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG K; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGP D; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG N; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4GGO D; 87-320;
#=GS FABV_TREDE/87-320         DR PDB; 4FBG C; 87-320;
#=GS A0A089IMM8_9BACL/81-316   AC A0A089IMM8.1
#=GS S3DJ01_9GAMM/82-318       AC S3DJ01.1
#=GS A0A1M5PFN2_9GAMM/82-317   AC A0A1M5PFN2.1
#=GS E1VQV7_9GAMM/82-313       AC E1VQV7.1
#=GS Q5H6Y9_XANOR/138-374      AC Q5H6Y9.1
#=GS F6AHV2_PSEF1/82-319       AC F6AHV2.1
#=GS U5S9R8_9LACT/83-319       AC U5S9R8.1
#=GS A1ZZQ0_9BACT/81-316       AC A1ZZQ0.1
#=GS A0A0Q7TEX5_9CAUL/81-313   AC A0A0Q7TEX5.1
#=GS A8UAA6_9LACT/83-319       AC A8UAA6.1
#=GS A0A0Q4MTJ6_9GAMM/82-318   AC A0A0Q4MTJ6.1
#=GS A0A0R1GK96_9LACO/91-281   AC A0A0R1GK96.1
#=GS E1SQ23_FERBD/82-317       AC E1SQ23.1
#=GS A0A125XZB7_AERCA/82-317   AC A0A125XZB7.1
#=GS A0A1R0WWH7_9BACL/81-316   AC A0A1R0WWH7.1
#=GS F9R803_VIBSN/82-317       AC F9R803.1
#=GS A0A235E099_9SPHI/82-318   AC A0A235E099.1
#=GS A0A1M6PP81_9BACT/82-318   AC A0A1M6PP81.1
#=GS A0A261SGW7_9BORD/82-317   AC A0A261SGW7.1
#=GS R7IT06_9FIRM/81-315       AC R7IT06.1
#=GS A0A285IYK0_9GAMM/82-317   AC A0A285IYK0.1
#=GS A0A1Q5MSR7_9ACTN/84-320   AC A0A1Q5MSR7.1
#=GS A0A1I2QU01_9GAMM/82-317   AC A0A1I2QU01.1
#=GS A0A0F7HGF2_SERFO/82-317   AC A0A0F7HGF2.1
#=GS W6TS21_9SPHI/96-332       AC W6TS21.1
#=GS FABV_OPITP/82-317         AC B1ZZ93.1
#=GS A0A0Q9E469_9FLAO/81-316   AC A0A0Q9E469.1
#=GS D4YHU2_9LACT/84-320       AC D4YHU2.1
#=GS R5JXN3_9FIRM/81-313       AC R5JXN3.1
#=GS A0A1Y0FUK5_9GAMM/82-317   AC A0A1Y0FUK5.1
#=GS F7T721_9BURK/82-317       AC F7T721.1
#=GS A0A1H8MW82_9FLAO/81-316   AC A0A1H8MW82.1
#=GS A0A1C3EM69_9GAMM/82-317   AC A0A1C3EM69.1
#=GS A0A127QZZ8_9BURK/82-317   AC A0A127QZZ8.1
#=GS A0A066Z6B2_9ACTN/84-319   AC A0A066Z6B2.1
#=GS A0A0F6AHS4_9GAMM/82-317   AC A0A0F6AHS4.1
#=GS A0A163X6V9_9FLAO/82-318   AC A0A163X6V9.1
#=GS A0A1M5RSG6_9ALTE/82-317   AC A0A1M5RSG6.1
#=GS A0A0C5WSS4_9GAMM/82-317   AC A0A0C5WSS4.1
#=GS F2LQY7_BURGS/82-317       AC F2LQY7.1
#=GS A0A1N6GLG0_9BRAD/82-314   AC A0A1N6GLG0.1
#=GS A0A1I6Q4N0_9SPHI/82-318   AC A0A1I6Q4N0.1
#=GS A0A2A6AVJ7_9ALTE/82-317   AC A0A2A6AVJ7.1
#=GS A0A0A2M272_9FLAO/81-316   AC A0A0A2M272.1
#=GS A0A0A0X4T1_9SPIO/86-321   AC A0A0A0X4T1.1
#=GS A0A0Q7GMU0_9FLAO/81-316   AC A0A0Q7GMU0.1
#=GS D4E644_SEROD/82-317       AC D4E644.1
#=GS A0A089K0J7_9BACL/81-316   AC A0A089K0J7.1
#=GS A0A0C4YNE6_9BURK/82-317   AC A0A0C4YNE6.1
#=GS A0A1Q2M7C0_9GAMM/82-314   AC A0A1Q2M7C0.1
#=GS A0A0S2JCL8_9GAMM/82-317   AC A0A0S2JCL8.1
#=GS A0A1C5CHF1_9ACTN/81-316   AC A0A1C5CHF1.1
#=GS A0A059W1M0_STRA9/87-323   AC A0A059W1M0.1
#=GS A0A166WIE8_9GAMM/82-317   AC A0A166WIE8.1
#=GS A7TAP6_NEMVE/81-261       AC A7TAP6.1
#=GS U1JY09_9GAMM/82-317       AC U1JY09.1
#=GS A0A1I6JY26_9FIRM/81-315   AC A0A1I6JY26.1
#=GS U2FLX9_9BURK/82-317       AC U2FLX9.1
#=GS A0A081NH23_9GAMM/82-317   AC A0A081NH23.1
#=GS A0A2I9E332_9FLAO/81-316   AC A0A2I9E332.1
#=GS R9PGA1_AGAAL/81-316       AC R9PGA1.1
#=GS A0A1A9EW60_9GAMM/82-317   AC A0A1A9EW60.1
#=GS A0A0J1GH90_9GAMM/88-324   AC A0A0J1GH90.1
#=GS A0A1J0THF6_9ALTE/82-317   AC A0A1J0THF6.1
#=GS G2NJF4_STREK/90-325       AC G2NJF4.1
#=GS A0A1B9DW62_9FLAO/81-316   AC A0A1B9DW62.1
#=GS A0A1B1VE91_9VIBR/83-319   AC A0A1B1VE91.1
#=GS A0A087M0R7_9RHIZ/82-315   AC A0A087M0R7.1
#=GS A0A1Y5KGB3_9BACL/81-316   AC A0A1Y5KGB3.1
#=GS A0A1G8WCN7_9FLAO/81-316   AC A0A1G8WCN7.1
#=GS A0A177QIN0_9GAMM/81-317   AC A0A177QIN0.1
#=GS A0A0A5HVJ1_9VIBR/82-317   AC A0A0A5HVJ1.1
#=GS A0A023NRN2_9GAMM/82-318   AC A0A023NRN2.1
#=GS U2PU12_LEPWF/81-318       AC U2PU12.1
#=GS A0A1N6JNT5_9FLAO/82-318   AC A0A1N6JNT5.1
#=GS A0A089MCG4_9BACL/81-316   AC A0A089MCG4.1
#=GS E8LM44_SUCHY/82-317       AC E8LM44.1
#=GS A0A2A3XDX2_9GAMM/83-318   AC A0A2A3XDX2.1
#=GS Q1YTD6_9GAMM/81-316       AC Q1YTD6.1
#=GS A0A1V0KNS0_9GAMM/82-317   AC A0A1V0KNS0.1
#=GS A0A1Z8XG79_9PROT/217-438  AC A0A1Z8XG79.1
#=GS FABV_METFK/81-316         AC Q1H0P3.1
#=GS A0A1H7ZU01_9BACL/81-316   AC A0A1H7ZU01.1
#=GS A0A0X8HBE3_9GAMM/83-318   AC A0A0X8HBE3.1
#=GS A0A0F6TRH7_9GAMM/84-320   AC A0A0F6TRH7.1
#=GS A0A0C2EWY0_9PSED/82-317   AC A0A0C2EWY0.1
#=GS A0A1B1B0L5_9ACTN/86-321   AC A0A1B1B0L5.1
#=GS A0A090P8C0_9VIBR/83-319   AC A0A090P8C0.1
#=GS A0A1M5A2W9_9FLAO/81-316   AC A0A1M5A2W9.1
#=GS A0A1S1NSB3_9GAMM/82-318   AC A0A1S1NSB3.1
#=GS A0A259R0R0_9GAMM/82-318   AC A0A259R0R0.1
#=GS B4CTR8_9BACT/82-317       AC B4CTR8.1
#=GS A0A1M5HRX4_9FLAO/81-316   AC A0A1M5HRX4.1
#=GS R5DYY3_9CLOT/81-315       AC R5DYY3.1
#=GS A0A086D0M9_9GAMM/83-318   AC A0A086D0M9.1
#=GS A0A1G1P9U2_9BACT/82-317   AC A0A1G1P9U2.1
#=GS A0A0A6QF85_9BURK/82-317   AC A0A0A6QF85.1
#=GS J2JU01_9ACTN/67-302       AC J2JU01.1
#=GS W1NC11_9GAMM/83-319       AC W1NC11.1
#=GS H9UIZ3_SPIAZ/83-318       AC H9UIZ3.1
#=GS A0A0D7PB72_9BRAD/82-314   AC A0A0D7PB72.1
#=GS A0A0B8Q445_9VIBR/1-73     AC A0A0B8Q445.1
#=GS A0A077EMF1_9FLAO/82-318   AC A0A077EMF1.1
#=GS FABV_SHEWM/82-317         AC B1KLT1.1
#=GS A0A1R4B6T9_9VIBR/83-319   AC A0A1R4B6T9.1
#=GS A0A1S2DIY5_9GAMM/83-318   AC A0A1S2DIY5.1
#=GS C9RMX0_FIBSS/93-329       AC C9RMX0.1
#=GS A0A1T5KPM4_9GAMM/82-318   AC A0A1T5KPM4.1
#=GS Z9JJA4_9GAMM/82-318       AC Z9JJA4.1
#=GS A0A1B9DZ39_9FLAO/81-316   AC A0A1B9DZ39.1
#=GS A0A081KFA0_9GAMM/81-317   AC A0A081KFA0.1
#=GS A0A1A6KY66_9VIBR/82-317   AC A0A1A6KY66.1
#=GS A0A0D8D565_9GAMM/82-317   AC A0A0D8D565.1
#=GS W9UW00_9GAMM/81-316       AC W9UW00.1
#=GS A0A1Z8P9S9_9BACT/82-318   AC A0A1Z8P9S9.1
#=GS A0A1N7BLS6_9SPHI/81-316   AC A0A1N7BLS6.1
#=GS A0A1Y6IP86_9VIBR/82-317   AC A0A1Y6IP86.1
#=GS A0A0F6A040_9GAMM/84-319   AC A0A0F6A040.1
#=GS A0A085EM81_9FLAO/81-316   AC A0A085EM81.1
#=GS A0A1F1Q0F5_9PSED/83-320   AC A0A1F1Q0F5.1
#=GS A0A1D8RXX4_9GAMM/82-317   AC A0A1D8RXX4.1
#=GS A0A167BRU1_9GAMM/82-317   AC A0A167BRU1.1
#=GS A0A1Q8IX96_9BURK/82-317   AC A0A1Q8IX96.1
#=GS A0A0X3Y8C0_9GAMM/82-317   AC A0A0X3Y8C0.1
#=GS A0A1R0XCW3_9BACL/81-227   AC A0A1R0XCW3.1
#=GS U3AJH4_9VIBR/83-319       AC U3AJH4.1
#=GS FABV_ERWT9/82-318         AC B2VET7.1
#=GS A0A193KHB2_9VIBR/83-319   AC A0A193KHB2.1
#=GS F7RMF7_9GAMM/82-317       AC F7RMF7.1
#=GS A0A0A2TSJ2_9BACL/81-316   AC A0A0A2TSJ2.1
#=GS A0A0U3BIX0_9FLAO/81-316   AC A0A0U3BIX0.1
#=GS A0A1E3KWR6_9BACL/81-316   AC A0A1E3KWR6.1
#=GS FABV_SHEFN/82-317         AC Q07ZY9.1
#=GS A0A1T4L6I0_9SPIO/91-334   AC A0A1T4L6I0.1
#=GS A0A1A5X4S0_9BURK/82-318   AC A0A1A5X4S0.1
#=GS A0A1I3KKB7_9BURK/82-317   AC A0A1I3KKB7.1
#=GS A0A257HXZ3_9BACT/81-316   AC A0A257HXZ3.1
#=GS A0A235BCC8_9BACL/81-316   AC A0A235BCC8.1
#=GS A0A0F4REN4_9GAMM/83-318   AC A0A0F4REN4.1
#=GS A0A1I1IJ55_9GAMM/82-317   AC A0A1I1IJ55.1
#=GS A0A1H0H7H5_9BRAD/82-314   AC A0A1H0H7H5.1
#=GS A0A1I0C6L2_9FIRM/81-312   AC A0A1I0C6L2.1
#=GS FABV2_VIBPA/83-319        AC Q87HT6.1
#=GS A0A1P8R6P5_9GAMM/83-318   AC A0A1P8R6P5.1
#=GS A0A1B1KPR5_SERPL/82-317   AC A0A1B1KPR5.1
#=GS A0A1H9DBG7_9GAMM/82-317   AC A0A1H9DBG7.1
#=GS A0A090RRM6_9VIBR/82-235   AC A0A090RRM6.1
#=GS A0A172YL76_9GAMM/82-318   AC A0A172YL76.1
#=GS A0A1G5DQH9_9ACTN/85-322   AC A0A1G5DQH9.1
#=GS A0A1B9QW47_9VIBR/82-317   AC A0A1B9QW47.1
#=GS A0A1C5EDD7_9ACTN/185-420  AC A0A1C5EDD7.1
#=GS A0A0E3Z2N2_9GAMM/82-317   AC A0A0E3Z2N2.1
#=GS R7K0B1_9CLOT/81-313       AC R7K0B1.1
#=GS A0A1Q8TG61_9GAMM/85-320   AC A0A1Q8TG61.1
#=GS A8T0V6_9VIBR/83-319       AC A8T0V6.1
#=GS A0A1R1F291_9BACL/81-316   AC A0A1R1F291.1
#=GS A0A0X8BYF1_9PSED/83-320   AC A0A0X8BYF1.1
#=GS A0A0R0AD03_STEMA/82-316   AC A0A0R0AD03.1
#=GS W6J256_9ENTR/79-314       AC W6J256.2
#=GS A0A1I1J150_9GAMM/82-318   AC A0A1I1J150.1
#=GS A9NFB1_ACHLI/81-317       AC A9NFB1.1
#=GS M4WZ09_9PSED/82-317       AC M4WZ09.1
#=GS A0A1G1N5E3_9BACT/82-317   AC A0A1G1N5E3.1
#=GS A0A0J0YC25_9FLAO/81-316   AC A0A0J0YC25.1
#=GS A0A0A4A149_9GAMM/82-317   AC A0A0A4A149.1
#=GS A0A0D8Q6T5_9GAMM/82-317   AC A0A0D8Q6T5.1
#=GS V6RYP7_9FLAO/75-310       AC V6RYP7.1
#=GS FABV_SHEPC/82-317         AC A4Y5I7.1
#=GS A0A240BXR5_SERFI/82-317   AC A0A240BXR5.1
#=GS A0A1G1PAW5_9BACT/82-319   AC A0A1G1PAW5.1
#=GS A0A081PLH7_9SPHI/81-316   AC A0A081PLH7.1
#=GS C9P737_VIBME/83-319       AC C9P737.1
#=GS A0A1G3MWA8_9SPIR/91-325   AC A0A1G3MWA8.1
#=GS A0A1H9MHB5_9FLAO/81-316   AC A0A1H9MHB5.1
#=GS A0A063Y5Q6_9GAMM/81-316   AC A0A063Y5Q6.1
#=GS A0A1N7C6M6_9GAMM/81-315   AC A0A1N7C6M6.1
#=GS A0A1Z8WML8_9BACT/81-313   AC A0A1Z8WML8.1
#=GS A0A0Q8MJC5_9CAUL/82-314   AC A0A0Q8MJC5.1
#=GS A0A1W2F939_9SPHI/81-317   AC A0A1W2F939.1
#=GS A0A177NBC1_9GAMM/82-317   AC A0A177NBC1.1
#=GS A0A1Q9HQH8_9VIBR/83-319   AC A0A1Q9HQH8.1
#=GS A0A1G5BFI1_9FLAO/81-316   AC A0A1G5BFI1.1
#=GS Z5XWM3_9GAMM/82-317       AC Z5XWM3.1
#=GS A0A089K8D1_9BACL/81-316   AC A0A089K8D1.1
#=GS D2U842_XANAP/82-318       AC D2U842.1
#=GS A0A168PW11_9BACL/81-316   AC A0A168PW11.1
#=GS A0A1X1QN62_9GAMM/82-317   AC A0A1X1QN62.1
#=GS W6RUC4_9CLOT/81-315       AC W6RUC4.1
#=GS D5U9I6_BRAM5/82-320       AC D5U9I6.1
#=GS A0A127VDC0_9SPHI/81-316   AC A0A127VDC0.1
#=GS A0A160PAY7_STRLU/95-331   AC A0A160PAY7.1
#=GS U3C073_9VIBR/83-319       AC U3C073.1
#=GS U3AT01_9VIBR/82-317       AC U3AT01.1
#=GS A0A1H1NNR3_9BACL/81-315   AC A0A1H1NNR3.1
#=GS A0A1R0XQD7_9BACL/1-115    AC A0A1R0XQD7.1
#=GS A0A094L0Z4_9GAMM/82-317   AC A0A094L0Z4.1
#=GS J0S3S8_9FLAO/81-316       AC J0S3S8.1
#=GS A0A090U4K8_9ENTR/82-317   AC A0A090U4K8.1
#=GS A0A1U7JM87_9RHOB/83-319   AC A0A1U7JM87.1
#=GS A0A0J0Y468_9SPHI/81-316   AC A0A0J0Y468.1
#=GS H1Z960_MYROD/82-318       AC H1Z960.1
#=GS A0A1V3N393_9SPHI/82-318   AC A0A1V3N393.1
#=GS A0A1M5HRF1_9FLAO/81-316   AC A0A1M5HRF1.1
#=GS A0A1G7S856_9GAMM/83-318   AC A0A1G7S856.1
#=GS A0A1H9YFZ7_THASX/82-316   AC A0A1H9YFZ7.1
#=GS A0A0M2VCB7_9GAMM/82-317   AC A0A0M2VCB7.1
#=GS F3L1I1_9GAMM/1-122        AC F3L1I1.1
#=GS E1T8J4_BURSG/82-317       AC E1T8J4.1
#=GS A0A1U9R7K2_9GAMM/83-318   AC A0A1U9R7K2.1
#=GS FABV_CLOAB/82-318         AC Q97LU2.1
#=GS FABV_CLOAB/82-318         DR PDB; 4EUH A; 82-318;
#=GS FABV_CLOAB/82-318         DR PDB; 4EUE A; 82-318;
#=GS FABV_CLOAB/82-318         DR PDB; 4EUF A; 82-318;
#=GS W4D4J5_9BACL/81-316       AC W4D4J5.1
#=GS A6D6Z1_9VIBR/82-317       AC A6D6Z1.1
#=GS J4QZ43_9BURK/82-317       AC J4QZ43.1
#=GS A0A1T4KB09_VIBCI/82-317   AC A0A1T4KB09.1
#=GS D1AML5_SEBTE/81-318       AC D1AML5.1
#=GS A0A1Q2GV67_9GAMM/82-317   AC A0A1Q2GV67.1
#=GS A0A2A9FZ36_9VIBR/82-317   AC A0A2A9FZ36.1
#=GS A0A0J1GMW7_9GAMM/82-317   AC A0A0J1GMW7.1
#=GS U4KD44_9VIBR/83-318       AC U4KD44.1
#=GS A0A1Z9AL21_9GAMM/82-316   AC A0A1Z9AL21.1
#=GS A0A1D8AX12_9BACT/82-318   AC A0A1D8AX12.1
#=GS A0A0X7BFI6_9FLAO/81-316   AC A0A0X7BFI6.1
#=GS A0A1H7KJL0_9LACT/82-318   AC A0A1H7KJL0.1
#=GS A0A0R1H0B5_9LACO/1-64     AC A0A0R1H0B5.1
#=GS A0A1G6DQE9_9GAMM/82-317   AC A0A1G6DQE9.1
#=GS A0A1G9RXJ2_9GAMM/88-323   AC A0A1G9RXJ2.1
#=GS D4MZN4_ANAHA/82-313       AC D4MZN4.1
#=GS K6ZFR7_9ALTE/86-321       AC K6ZFR7.1
#=GS A0A243SCZ9_9FLAO/81-316   AC A0A243SCZ9.1
#=GS A0A1M6S0F3_9FLAO/82-318   AC A0A1M6S0F3.1
#=GS A0A0A7S2D8_9GAMM/82-317   AC A0A0A7S2D8.1
#=GS A0A1M5R6S0_9FLAO/81-316   AC A0A1M5R6S0.1
#=GS F4GJL3_SPHCD/99-336       AC F4GJL3.1
#=GS A0A291JYX5_9GAMM/83-318   AC A0A291JYX5.1
#=GS A0A172ZMU7_9BACL/81-316   AC A0A172ZMU7.1
#=GS A0A0F5LP39_9RHIZ/82-315   AC A0A0F5LP39.1
#=GS A0A1B9QVB4_9VIBR/83-319   AC A0A1B9QVB4.1
#=GS A0A098LHL3_9BACT/81-316   AC A0A098LHL3.1
#=GS A0A1H1PXJ2_9FLAO/81-316   AC A0A1H1PXJ2.1
#=GS A0A1Q9K0J3_9FIRM/82-316   AC A0A1Q9K0J3.1
#=GS E0NIK1_PEDAC/82-318       AC E0NIK1.1
#=GS A0A243T774_9GAMM/83-318   AC A0A243T774.1
#=GS A0A1X7GW72_9BACL/81-316   AC A0A1X7GW72.1
#=GS FABV_FLAPJ/81-316         AC A6H0N4.1
#=GS D0GP02_9FUSO/1-211        AC D0GP02.1
#=GS A0A1I4WH37_9PSED/82-317   AC A0A1I4WH37.1
#=GS A0A0L8LV83_9ACTN/85-320   AC A0A0L8LV83.1
#=GS A0A077FHY6_9PSED/83-316   AC A0A077FHY6.1
#=GS L8CZI5_9GAMM/82-317       AC L8CZI5.1
#=GS A8T1W2_9VIBR/82-317       AC A8T1W2.1
#=GS A0A1G0WFA5_9BACT/81-317   AC A0A1G0WFA5.1
#=GS A0A255ZPK0_9FLAO/81-316   AC A0A255ZPK0.1
#=GS A0A0W0P943_9PSED/82-317   AC A0A0W0P943.1
#=GS F0SCA2_PSESL/81-316       AC F0SCA2.1
#=GS A0A1S6HNF7_9GAMM/82-317   AC A0A1S6HNF7.1
#=GS A0A1T5BSS8_9GAMM/100-336  AC A0A1T5BSS8.1
#=GS R6RZ01_9CLOT/81-313       AC R6RZ01.1
#=GS FABV1_VIBPA/82-317        AC Q87QB9.1
#=GS A0A1T4KK79_VIBCI/83-319   AC A0A1T4KK79.1
#=GS A0A1B8WCT8_9BACI/81-316   AC A0A1B8WCT8.1
#=GS V5WIM4_9SPIO/81-316       AC V5WIM4.1
#=GS B5WPK0_9BURK/82-317       AC B5WPK0.1
#=GS D5EJI6_CORAD/81-313       AC D5EJI6.1
#=GS A0A1G8XYG7_9GAMM/82-317   AC A0A1G8XYG7.1
#=GS FABV_COLP3/82-317         AC Q488Q1.1
#=GS A0A0M0HUR9_VIBNE/82-317   AC A0A0M0HUR9.1
#=GS A0A0H4VLS9_9BACT/81-316   AC A0A0H4VLS9.1
#=GS F2R9J2_STRVP/86-322       AC F2R9J2.1
#=GS S2KIW8_HALAF/107-342      AC S2KIW8.1
#=GS A0A0X3UZV8_9ACTN/87-324   AC A0A0X3UZV8.1
#=GS FABV_PSYIN/82-317         AC A1SSJ9.1
#=GS A0A089KVF1_9BACL/81-316   AC A0A089KVF1.1
#=GS A0A1M4VWG6_9FIRM/82-318   AC A0A1M4VWG6.1
#=GS A3J0V9_9FLAO/81-316       AC A3J0V9.1
#=GS B8KWY0_9GAMM/82-317       AC B8KWY0.1
#=GS A9ELP2_9GAMM/82-317       AC A9ELP2.1
#=GS I4W6S2_9GAMM/83-317       AC I4W6S2.1
#=GS A0A226HAF3_9FLAO/81-316   AC A0A226HAF3.1
#=GS A0A1A0EVR8_9GAMM/83-318   AC A0A1A0EVR8.1
#=GS D8MSI2_ERWBE/82-317       AC D8MSI2.1
#=GS A0Z1K9_9GAMM/47-282       AC A0Z1K9.1
#=GS A0A109RHW1_9LACT/84-320   AC A0A109RHW1.1
#=GS FABV_CLOCE/81-316         AC B8I4V6.1
#=GS A0A1I0WL75_9FLAO/81-316   AC A0A1I0WL75.1
#=GS H7FRY3_9FLAO/81-316       AC H7FRY3.1
#=GS A0A098G1G8_9GAMM/82-317   AC A0A098G1G8.1
#=GS A0A239XTL8_9SPHI/82-318   AC A0A239XTL8.1
#=GS S2K8P0_9PSED/83-316       AC S2K8P0.1
#=GS A0A088EWM0_9SPHI/82-318   AC A0A088EWM0.1
#=GS A0A0F5ZSJ6_9GAMM/82-317   AC A0A0F5ZSJ6.1
#=GS A0A1Q6CKH0_9GAMM/82-317   AC A0A1Q6CKH0.1
#=GS E3HI12_ACHXA/94-329       AC E3HI12.1
#=GS A0A221A1P8_9BURK/82-317   AC A0A221A1P8.1
#=GS A0A1H4BFN1_9SPHI/81-316   AC A0A1H4BFN1.1
#=GS A0A0X3UCR9_9GAMM/82-314   AC A0A0X3UCR9.1
#=GS A0A1T4XW12_9BACT/82-317   AC A0A1T4XW12.1
#=GS A0A167EYI5_9FLAO/81-316   AC A0A167EYI5.1
#=GS A0A1I7AY40_9BURK/82-317   AC A0A1I7AY40.1
#=GS B7S1X7_9GAMM/95-330       AC B7S1X7.1
#=GS FABV_YERPE/82-318         AC Q8Z9U1.1
#=GS FABV_YERPE/82-318         DR PDB; 3ZU4 A; 82-318;
#=GS FABV_YERPE/82-318         DR PDB; 4BKQ A; 105-341;
#=GS FABV_YERPE/82-318         DR PDB; 5JAI A; 82-318;
#=GS FABV_YERPE/82-318         DR PDB; 5JAQ A; 82-318;
#=GS FABV_YERPE/82-318         DR PDB; 5JAM A; 82-318;
#=GS FABV_YERPE/82-318         DR PDB; 3ZU5 A; 82-318;
#=GS FABV_YERPE/82-318         DR PDB; 3ZU2 A; 105-341;
#=GS FABV_YERPE/82-318         DR PDB; 3ZU3 A; 82-318;
#=GS A0A1N7RW40_9BURK/82-317   AC A0A1N7RW40.1
#=GS F5Y6P6_TREAZ/94-339       AC F5Y6P6.1
#=GS F3L2M2_9GAMM/82-194       AC F3L2M2.1
#=GS U4K3W8_9VIBR/82-317       AC U4K3W8.1
#=GS FABV_SHEDO/82-317         AC Q12LA9.1
#=GS A0A098RJM6_9GAMM/83-318   AC A0A098RJM6.1
#=GS FABV_PSEPK/83-320         AC Q88E33.1
#=GS FABV_VIBF1/82-317         AC Q5E6G3.1
#=GS FABV_SHEPA/82-317         AC A8H609.1
#=GS A0A1G7MV09_9SPHI/81-316   AC A0A1G7MV09.1
#=GS A0A176L0D9_9ACTN/16-168   AC A0A176L0D9.1
#=GS A0A0S2DBH9_LYSEN/82-319   AC A0A0S2DBH9.1
#=GS A0A290XDM9_9GAMM/82-318   AC A0A290XDM9.1
#=GS A0A1T4Q2C8_9SPIO/92-327   AC A0A1T4Q2C8.1
#=GS FABV_BURM1/82-317         AC A9ALQ1.1
#=GS R6RL27_9FIRM/82-316       AC R6RL27.1
#=GS FABV2_PHOPR/83-319        AC Q6LP67.2
#=GS A0A1E4HK55_9GAMM/83-317   AC A0A1E4HK55.1
#=GS A0A1H9DAS9_9FLAO/81-316   AC A0A1H9DAS9.1
#=GS W4CSG0_9BACL/81-316       AC W4CSG0.1
#=GS B7VS11_VIBTL/83-319       AC B7VS11.1
#=GS A3WQ04_9GAMM/82-317       AC A3WQ04.1
#=GS W3YCT9_9GAMM/82-317       AC W3YCT9.1
#=GS A0A089I9F4_9BACL/81-316   AC A0A089I9F4.1
#=GS A0A143Z7E9_9LACT/83-319   AC A0A143Z7E9.1
#=GS A0A1D9H854_9BURK/82-317   AC A0A1D9H854.1
#=GS A0A1E5BPI9_9GAMM/89-324   AC A0A1E5BPI9.1
#=GS A0A0Q0IZM2_9GAMM/82-317   AC A0A0Q0IZM2.1
#=GS R6LNF5_9CLOT/81-313       AC R6LNF5.1
#=GS A0A0Q4LM71_9SPHI/81-316   AC A0A0Q4LM71.1
#=GS A0A1W2CYR2_9SPHI/81-317   AC A0A1W2CYR2.1
#=GS A0A239X7U1_9FLAO/82-318   AC A0A239X7U1.1
#=GS A4BDP5_9GAMM/82-318       AC A4BDP5.1
#=GS A0A1M7B902_9FLAO/82-318   AC A0A1M7B902.1
#=GS A0A1Z8ZGX2_9GAMM/83-318   AC A0A1Z8ZGX2.1
#=GS E6UXE5_VARPE/82-317       AC E6UXE5.1
#=GS A0A269PLE0_9GAMM/82-317   AC A0A269PLE0.1
#=GS A0A0K2DYQ1_PISSA/83-319   AC A0A0K2DYQ1.1
#=GS I0XB63_9SPIO/91-336       AC I0XB63.1
#=GS A0A1K1MW08_9BACT/81-316   AC A0A1K1MW08.1
#=GS A0A1Y1S0D2_9SPIO/81-316   AC A0A1Y1S0D2.1
#=GS A0A1E5CMZ0_9VIBR/83-318   AC A0A1E5CMZ0.1
#=GS A0A0R2DEJ4_9LACO/84-321   AC A0A0R2DEJ4.1
#=GS A0A0K1ECU2_CHOCO/90-318   AC A0A0K1ECU2.1
#=GS FABV_SACD2/82-317         AC Q21HE4.1
#=GS A0A2C6MQY6_9VIBR/82-317   AC A0A2C6MQY6.1
#=GS A0A0Q9LC99_9BACL/81-316   AC A0A0Q9LC99.1
#=GS A0A1H6VYR4_9FIRM/81-316   AC A0A1H6VYR4.1
#=GS A0A1M6B9K7_9CLOT/81-316   AC A0A1M6B9K7.1
#=GS A0A176TAA9_9FLAO/90-325   AC A0A176TAA9.1
#=GS A0A063BFX7_9BURK/82-317   AC A0A063BFX7.1
#=GS A6ECW5_9SPHI/81-316       AC A6ECW5.1
#=GS D0YX53_PHODD/82-317       AC D0YX53.1
#=GS B7VPS2_VIBTL/84-319       AC B7VPS2.1
E0I4S6_9BACL/81-316                  ................................RTASAGWYNSAAFEQAAQAA..GRKSYSIVGDAFSDEIKAKTIDLIRTEI..G......SIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFASVIK....PLG..E.T......Y.S...N...KTV......NF.........H...S...G...EVT.TATI........EPA......T.......E.D.ELRQTIGVMGGEDWAMWIDELQQAGVLADGATTVAYSYIGPEIT..HAVYKEGTIGRAKDDLEATSQRINEK..L.SA.TGGR...SFISVNKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQMYRLFNERLY..................................
#=GR E0I4S6_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P0CD22_9BACT/81-316              ................................KPGSPGWYNTAAFEKQAHEA..GLYAKSINGDAFSDEIKQKTLDLIKADL..G......QIDLVIYSLA.......S..P..RRV..HP.....K.......T......G..V....VHNSVLK....PIG..Q.T......F.S...N...KTV......DF.........H...T...G...NVS.EVSI........TPA......S.......E.E.DIENTVAVMGGEDWAMWMEALKAADLLAPGATTVAYSYIGPALT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KD.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAKGIHEGTIEQIQRLFQERLY..................................
#=GR A0A0P0CD22_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F2RDG5_STRVP/12-248                  ................................RTATAGWYRTATTADIARAA..GRDLVFLNGDAFSDTMKDQVAGLIEQRF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYTSVLK....PIG..Q.A......N.R...T...KTLv...fdDQ.........G...V...P...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRGLLGKGFATAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLNER..L.DKtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGRD-------------------llppvhqlaalwdql...................
#=GR F2RDG5_STRVP/12-248       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C1ZDM1_9DELT/103-343             ................................KIGSPAWHRNVAIERELRNQ..GREAVSLSADAFDPLARAMVIDTIRARF.pG.....rKLAGLVWALA.......A..P..RGL..DP.....R.......T......G..K....TVSSTLK....PLG..K.P......A.T...I...KTFgg..peGD.........Q...P...P...QIF.ELEV........PQG......T.......P.E.EAVATVWVMGGRVVEEWTRDLLAADLLDEGHTLLTISYRGSPLN..APLYRDGLIGLAKADLEFTTRALSSS..L.HRhVNGQ...AFAVEGPAVVTEASGGIPGVPLYMALLLDVMGDQ--HEDPLASMRRMFHTH--fm................................
#=GR A0A0C1ZDM1_9DELT/103-343  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z9GF15_9BACT/81-313              ................................KPASAGWYNTVAFENAALES..GLYAKSINGDAFSDDVKATVVETIKKDW..G......QVDCVIYSLA.......S..P..RRT..DP.....K.......T......G..E....TFKSCLK....PIG..S.E......F.K...N...RSL......DT.........N...K...G...EIL.DVSI........EPA......S.......D.E.DIQNTVKVMGGEDWELWMDALSEAGVLASEAKTVAYSYIGPEVT..WPVYKNGTIGTAKLDVERAAKAIQER..H.--.-QLE...AFVSVNKAVVTQASSAIPVVPLYISILFKEMVAKGTHEGCIEQIVRLFKDRLY..................................
#=GR A0A1Z9GF15_9BACT/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q7S459_9BACL/81-316              ................................RTASAGWYNSAAFEKAAEKA..GLQSYSITGDAFANETREKAVELIRSEF..G......QVDLVVYSVA.......S..A..RRV..DP.....N.......T......G..E....VFNSVLK....PIG..Q.S......Y.T...N...KTV......NF.........H...T...G...EVS.SVTL........EPA......S.......E.E.EIRQTVTVMGGEDWELWMDALQQGGVLADDATTIAFSYIGPELT..QAIYREGSIGQAKDHLEATAHKLNDR..L.SA.TGGR...AYVTVAKALVTQSSSAIPVVPLYISALYKIMKEKGLHEGCIEQLQRLFADRLY..................................
#=GR A0A0Q7S459_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G7F675_9GAMM/82-317                  ................................KTGSAGWYNTAAFQEAADEA..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDCIIYSLA.......S..P..RRT..DP.....N.......T......G..E....VFSSTLK....PIG..N.A......V.T...T...KNL......NT.........S...K...R...EID.EITV........EAA......N.......Q.D.DIDNTIKVMGGEDWEMWIDALKEAGVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKES..T.KD.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHALFSENLY..................................
#=GR G7F675_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M1NJL5_9BACL/81-316              ................................RTASAGWYNSVAFEKAAEAA..GLKSFSVTGDAFTQETKAKTVELIRKEL..G......QVDLVVYSVA.......S..A..RRT..LP.....E.......T......G..E....TVNSVLK....PIG..P.A......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVKNTVEVMGGDDWELWMNELAEGGVLAPNVTTIAFSYIGSEIT..KAIYRDGSIGQAKDHLEATALKLKEK..L.AA.GGGR...AYVTVSKALVTQSSSAIPVVPLYVSALYKVMKEKGLHEGCIEQIYRLFSDRLY..................................
#=GR A0A0M1NJL5_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q9GFM6_9GAMM/83-319              ...............................g-VGTAGWYNNIFFREEAEKQ..GLVGKNFVGDAFSTSMRQQVIDYIKVEF.gG......KLDLVVYSLA.......T..G..VRP..DP.....E.......T......G..E....MWRSSIK....TIG..E.S......V.T...G...PTI......NI.........E...T...D...TME.PMII........DTA......T.......E.E.EIEATKKVMGGEDWESWIDILSEAGVLADGCKTVAYSYIGPEAT..YPIYHKGTLGRAKTHLHATGDLLNDK..L.AR.IGGE...AYVSVCKALVTKASVFIPAFSPYILALFKVMQDKGVHEGCIEQMQRLYSQRLY..................................
#=GR A0A1Q9GFM6_9GAMM/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2RCX4_9FUSO/81-318                  ................................RIGTAGWWNTIAFTEAAKEE..GLTAKNFIGDAFSNEMKADVIKYIKEEF.gG......KIDLLIYSLA.......S..G..MRT..DP.....K.......D......G..V....TYRSALK....STK..G.E......I.V...G...PSI......NI.........E...K...D...AME.ETTM........GVA......T.......P.E.EIQSTVKVMGGEDWKLWVDALDEAGVLTDGFKTVAYSYLGPKVT..YGIYKDGTIGAAKRDLEHTSDVLNDF..L.KKkYNGE...AYVSLSKALMTKASAVIPIFPLYAALLYRVMKEKGIHEGTIEQKHRLLKDMIY..................................
#=GR U2RCX4_9FUSO/81-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0G3UQ08_9ACTN/85-321              ................................RTGTAGWYRTAATARLARQH..GRDFVFLNGDAFSDTMKEQVADLLAERF.gG......RLDYLVYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..S.P......Y.T...T...KTL......VF.........D...E...QgapEVK.QVTT........APA......G.......G.D.DIEQTVEVMGGADWERWITFLAERSLLAEGFATAALSYIGSPLT..AAIYRQGTIGAAKSHLETTARALDEH..L.GKtLGGR...AVTSVNAAAVTQSSTAIPGIALYVGLLRGVLGDA--MVAPIGQLVELWD----ql................................
#=GR A0A0G3UQ08_9ACTN/85-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J2YGE5_9PSED/82-317                  ................................KLGTAGWYNTAAFHKFAEEK..GLYAKSINGDAFSDEVKRQTIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VLSSTLK....PLG..K.S......V.T...L...RGV......DT.........D...K...E...IVK.ETTL........QPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALHEAGVLAEGAKTTAFTYLGEKLT..HDIYWNGSIGEAKKDLDQKVIGIRKE..L.SD.LGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGSHEGCIEQVYGLYKDSLY..................................
#=GR J2YGE5_9PSED/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
L8XXC4_9GAMM/82-318                  ................................KTGTAGWYNSAAFDKYAKAA..GLYAKSINGDAFSNEVRAKVIELIKEDL..G......TVDCVVYSLA.......S..P..VRK..LP.....E.......T......G..E....VVRSALK....TIG..E.T......Y.T...A...PSL......DT.........N...K...N...EVI.EASV........EPA......T.......A.E.EISDTITVMGGQDWELWMKALDEAGVLAENVQTVAYSYIGTAIT..WPMYWHGTLGKAKEDVERAAREINAM..L.EEkYQGH...AAVAVLKSVVTQASSAIPVMPLYISAAFRVMKELDLHEDCIEQIQRLFATCMY..................................
#=GR L8XXC4_9GAMM/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F2NWU0_TRES6/91-326                  ................................KGGTPGWYNNMAFDKAAEKA..GLKTKTFNADAYSDECRAEVIKQLKDWG..A......KADLVIYSLA.......S..P..VRT..DP.....D.......T......K..V....MYRSVIK....PIN..Q.V......Y.S...G...ASL......DM.........M...T...G...KIT.QAST........QPA......E.......G.D.EIPNTVKVMGGEDWERWIKQLSEADVLADGCRTLAYSYIGPSLS..HPIYRDGTIGEAKKDLEKRAHNIDAA..L.KA.KGGA...AYVSVNKGLITRSSSVIPIITQYLGVLFKIMKKQGTHEGCIEQMERLFAERLY..................................
#=GR F2NWU0_TRES6/91-326       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8NYM4_9VIBR/82-213              ................................KPGTAGFYNAAAFDKLAQEE..GLYAKSLNGDAFSNEAKQKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...EII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWMDALSEAGV------------------..--------------------------..-.--.----...-----------------------------------------------------..................................
A0A135I9Q9_9GAMM/83-319              ...............................g-AGTAGWYNNVFFRQEAEKH..GLIAKNFVGDAFSSEMRKQVIDYIKKEF.gG......HVDLVVYSLA.......T..G..IRP..NP.....E.......T......G..E....LWRSSIK....TLD..K.P......L.S...G...PTI......DL.........E...R...D...VML.PLDV........GVA......T.......E.D.ELDATVKVMGGEDWESWIAVLSDAGVLAKGCKTLAYSYIGPEFT..YPIYHRGTLGKAKDHLHKTADVLNQT..L.QD.LEGE...AYVAVCKALVTKASVFIPAFSPYILSLFKVMKENGTHEGCIEQMQRLFTERLY..................................
#=GR A0A135I9Q9_9GAMM/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A075P9W4_9ALTE/82-317              ................................KTGTAGWYNTAAFHDQAKAE..GVYAQTINGDAFSDEIKHQAIEKIKADM..G......KVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..V....TYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...KVH.EVSL........EPA......N.......D.D.EILNTIKVMGGEDWERWMDFLRDAGVLAEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAIIGK..N.SD.LLVQ...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIYGLFSQCLF..................................
#=GR A0A075P9W4_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K8WJU7_PRORD/82-317                  ................................KTGSAGWYNSAGFDKAAKEE..GLYAKSINGDAFSDECRQTVIDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....IVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLI.EAVV........EPA......N.......E.Q.EIADTVKVMGGQDWELWMNALDEAGVLADNAQSVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAHAINQK..L.QA.KGGA...AYVAVLKSVVTQASSAIPVMPLYISIVFKIMKEKGIHEGCIEQIQRLFATKLF..................................
#=GR K8WJU7_PRORD/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J8V717_9GAMM/82-317              ................................KPGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSHEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSTLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EVADTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAAKALDEK..L.SA.NGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLY..................................
#=GR A0A0J8V717_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R7C8S2_9CLOT/81-315                  ................................RTATAGWYNTKAFEEFAKED..GYYAKSFNGDGFSEEMKNQVIETIRKDF..G......KVDMVVYSMA.......A..P..RRT..MP.....D.......-......G..T....TVSSVLK....TVG..K.E......L.T...N...KTI......DL.........R...N...N...EIK.DVTV........PVA......N.......E.E.EIENTVKVMGGEDWEAWIQALVDADVLSDNAVTLAYSYIGPELT..HAIYKEGSIGQAKKHLFDTSKKLTKE..F.EA.KGLK...AYISVNKALVTQSSAAIPIVPLYISLLYKIMKKEGLHEGCIEQMNRLFIDKL-p.................................
#=GR R7C8S2_9CLOT/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K8P2G3_9BRAD/82-314                  ................................RTGSAGWYNNRAFEIEARKI..GRAPVTLEGDAFSNELKDAFIERVREKF..G......QLDLLVYSMA.......A..P..VRT..DP.....D.......T......G..V....TYRSAIK....PLG..A.P......V.E...I...KTL......NT.........E...S...G...EVY.ETVI........APA......T.......E.D.EATATVAVMGGDDWKRWIDRLADAGVLAPGFRTLNYTYIGSELT..WPIYWKGTLGRAKVDLDRKADEIRSR..L.GR.--DS...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR K8P2G3_9BRAD/82-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I4VJT7_9GAMM/83-317                  ................................KTGTAGWYNAAAFDKAAKAA..GLVAKSINGDAFSHETRAKAIEIIKNDL.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..E.P......F.H...N...TSV......DT.........N...K...D...TVI.DATV........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSAAGVLADHAKTIAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKELRSR..H.--.PGLE...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKAKGIHENPIEQANRLFHDRLY..................................
#=GR I4VJT7_9GAMM/83-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R6NPD0_9FIRM/81-313                  ................................RTATPGWYNTAAFEEEAHKA..GIYAKSINGDAFSWEIKEKTIDLIKKDW..G......KADMVIYSLA.......A..P..RRT..DK.....N.......-......G..N....LWVSSLK....TTK..E.A......F.T...E...KSL......DL.........R...N...N...TIV.EKTV........EPA......K.......P.E.EIQGTKKVMGGEDWMEWIEALKEADVLTENAITVAYSYIGPKLT..YPIYFDGTIGQAKRHLENTAKAMREK..F.P-.-DLQ...AYVSVNKALVTQASAAIPIVPLYFAILYKVMKEVGNHEGCIEQISRLFKEKLF..................................
#=GR R6NPD0_9FIRM/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W7QU64_9ALTE/81-316                  ................................KCASAGWYNTAAFTKYAKEA..GLWAKNINGDAFSHEIKAKAIDIIKQEL..G......KVDLVIYSLA.......S..P..RRT..DP.....D.......T......G..E....VYSSTLK....PIG..E.T......V.T...T...KNL......NT.........S...K...R...VID.EVTV........EAA......N.......E.A.EIQGTIDVMGGADWELWIKALQEADVLAEGFKTTAYTYIGKKLT..WPIYGHATIGKAKEDLDRAAKAIKQS..T.DS.ISGE...AYVTSLNAVVTQASSAIPIMPLYISALFKVMKEQGTYEGVIEQIQALFSENLY..................................
#=GR W7QU64_9ALTE/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A168HPY0_9BACL/81-316              ................................RTASAGWYNSAAFEKAAQSA..GLKSFSVTGDAFSTETKDKTIELIRTEL..G......QVDLVIYSVA.......S..A..RRE..NP.....Q.......T......G..E....MVNSVLK....PIG..K.P......Y.T...N...QTV......NF.........H...T...G...EVT.QVTI........EEA......T.......D.E.EVRDTVTVMGGDDWELWINGLRQAGVLADHATTIAYSYIGSEIT..QAVYRDGSIGQAKDHLEATALKMNDQ..L.AI.SGGR...AYVCVSKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQTYRLFKERLY..................................
#=GR A0A168HPY0_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV1_VIBCH/82-317                   ................................KPGTAGFYNAAAFDKLAHEA..GLYAKSLNGDAFSNEAKQKAIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....LVRSALK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIADTVTVMGGQDWELWIQALEEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAATALNEK..L.AA.KGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCMEQIYRMFSQRLY..................................
#=GR FABV1_VIBCH/82-317        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_CYTH3/81-316                    ................................KPGSPGWYNTVAFQNEAKKA..GIYAKSINGDAFSTEVKQKTIDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....V.......T......G..V....THRSVLK....PIG..G.A......F.S...N...KTV......DF.........H...T...G...NVS.TVTI........EPA......N.......E.E.DVTNTVAVMGGEDWGMWMDAMLEAGVLAEGATTVAYSYIGPALT..EAVYRKGTIGRAKDHLEASAATITDK..L.KS.VKGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGCIEQIQRLYADRLY..................................
#=GR FABV_CYTH3/81-316         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H6KCW1_9FLAO/82-318              ................................KPGTAGWYNSAAFEKEAQAA..GLYAKSINGDAFSDEIKQQTIDLIKKDL..G......TIDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..Q.P......F.S...N...KTV......DF.........H...T...G...VVS.DITI........NPI.....dS.......Q.E.DIDNTIAVMGGEDWKFWMEDLQKAGVLANGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATASTIHSI..L.KD.VNGE...AYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMYRLFKERLY..................................
#=GR A0A1H6KCW1_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A099Y0N4_9FLAO/81-316              ................................RPGSPGFYNTAAFEKHANAA..GLYAKSINGDAFSNEIKEQVINLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....T.......T......G..K....RFKSVLK....PIG..G.E......F.S...N...KTV......DF.........H...T...G...NVS.EISI........KPA......E.......G.E.DVENTITVMGGEDWKMWMDALKAENLLAEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTIADD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A099Y0N4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A094JNB4_9BACL/81-317              ................................RTATAGWYNTAAFEKEARKA..GLVAESINGDAFSKEIKEQTIQKIKNRL.gG......KVDMVVYSLA.......A..P..RRV..HP.....E.......T......G..E....TFHSVLK....PIG..K.P......F.S...N...KAV......DF.........H...S...G...NVS.EMTI........EPA......T.......D.E.EVHDTIQVMGGEDWQMWMDALKEADVLAEGVTTIAYSYIGPELT..FPIYREGTVGKAKDHLEKTAHELDAK..L.KD.LGGR...AFVSVNKALVTQSSAAIPIVPLYISILYKVMKEKGLHEDCIMQMYRLFSERLY..................................
#=GR A0A094JNB4_9BACL/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4QC26_9GAMM/82-316              ................................KPGTAGWYNSAAFEKYAHQA..GLYARSVNGDAFSDEVKAKVIEIIKADL..G......QVDQVVYSLA.......S..P..RRR..HP.....R.......T......G..E....VISSTLK....PIG..E.P......I.T...L...RGL......DT.........D...K...E...VLT.ETTL........QPA......T.......A.E.EISGTVQVMGGEDWQMWIDALLEAGVLAPGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDTKVKDIRGK..L.QG.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKSEGTHEGCIEQLDTLYD----ily...............................
#=GR A0A0Q4QC26_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090S7W9_9VIBR/83-135              ...............................g-TGTAGWFNNHYFKQQAEKA..GRTAINITGDAFLQSYARKLLKRLKPTL..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...-...---.----........---......-.......-.-.--------------------------------------------..--------------------------..-.--.----...-----------------------------------------------------kaklt.............................
H8KSP8_SOLCM/81-316                  ................................KTASPGWYNTAAFEDQAHKA..GLYAKSINGDAFSDEIKQKTIELIKADL..G......QIDLIIYSLA.......S..P..VRT..NP.....K.......T......G..V....THRSVLK....PIG..Q.P......F.S...N...KTV......DF.........H...T...G...VVS.DITI........QPC......A.......D.D.DIENTVAVMGGEDWEMWIDELKSAGVLAPGATTVAYSYIGPELT..EAVYRKGTIGKAKDHLEATAFTIADK..L.KD.INGN...AFVSVNKALVTQASSAIPVIPLYISLLYKVMKEDNIHEGCIEQIQRLFQQRLF..................................
#=GR H8KSP8_SOLCM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4NJW3_9VIBR/82-317              ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAAALNEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A0F4NJW3_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M2VRN7_9BACL/81-316              ................................RTASAGWYNSAAFEKLAKEA..GLKSVSVTGDAYTDETKQKTVEAIREEL..G......KVDLVVYSVA.......S..A..RRT..DP.....K.......T......G..E....VANSVLK....PIG..R.P......F.T...N...KTV......NF.........H...S...G...EVT.EVTL........EPA......S.......E.Q.EVQDTVTVMGGEDWEMWIHALRQGGVLADDATTIAYSYIGSDIT..KAVYRDGSIGQAKDHLEATALKLNDE..L.SP.GGGR...AYVSVSKALVTQSSSAIPIVPLYVSALYKVMKEKGLHENTIEQTYRLFADRLY..................................
#=GR A0A0M2VRN7_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0L6JPA1_9FIRM/81-316              ................................KTASAGWYNTAAFDKKAKEA..GLYSRNINGDAFSDEIKNKTIDIIKKDL..G......KVDMVVYSLA.......S..P..RRT..HP.....K.......T......G..V....THNSVIK....PTG..N.P......Y.T...N...KTI......DF.........H...S...G...VVS.EVTI........QPA......S.......E.D.EIKDTVAVMGGEDWEMWIQALKSAGVLENGFKTVAFSYIGPKLT..HAIYTNGTIGKAKEHLENSSKAITAQ..L.KE.VHGK...AYVSVNKALVTQASSAIPVVPLYISILYKIMKEKGLHEGCIEQASRLFAERLY..................................
#=GR A0A0L6JPA1_9FIRM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R1GRV0_9GAMM/8-169                   ..........................ysrara--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..N.P......F.T...G...LGL......NL.........E...R...Y...ALE.EQTL........PVA......S.......A.E.EIRDTVTVMGGEDWQLWLQALQAADCLAPGVQTVAYSYIGPQST..YPLYRDGTIGYAKEHLHSTAEAINLQ..L.AD.IGGH...AWVSVCKALVTKASAYIPVLPVYLGLLMGVMKEQGLHEGCIEQMHRLFASKMY..................................
#=GR R1GRV0_9GAMM/8-169        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I7GGG4_9BACL/81-316              ................................RTATAGWYNTAAFEQAARQA..GRFAKTVNGDAFSDEVKQEVIDLIRTHF..G......QVDLVVYSLA.......S..P..RRR..HP.....R.......T......G..E....TFSSVLK....TIG..Q.P......F.T...S...KTV......DV.........H...T...G...KVT.EVTV........QPA......T.......E.E.EIRDTIAVMGGEDWQMWMDALEEAGVLADGATTVAYSYIGPELT..RAIYRDGTIGKAKDDLEATALRLNER..L.RA.RGGR...AFVSVNKAVVTQSSSAIPVVPLYISLLFKVMKEKGLHEDCIQQMYRLLAHRLY..................................
#=GR A0A1I7GGG4_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_EDWI9/82-317                    ................................KTGTAGWYNAAAFDKAAKEA..GLYAKSVNGDAFSNECRQQVIELIKQDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.SASV........EPA......T.......E.E.EIQNTITVMGGQDWELWMSALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAAAGIRGD..L.AA.HGGT...AHVAVLKSVVTQASSAIPVMPLYISMSFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR FABV_EDWI9/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A7N4Z7_VIBCB/83-319                  ...............................g-VGSAGWYNNIYFKDEATHH..GRTAVNIVGDAFSDTVRNQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KP.....E.......S......D..E....FWRSVIK....PIG..E.S......V.T...G...ASI......ML.........E...N...D...QWV.ESTL........APA......T.......Q.E.EAEATIKVMGGEDWESWIDTLINSESVAKGCKTIAFSYMGPDVT..HPIYLDGTLGRAKVDLHQTSHALNIK..M.AN.FGGG...AYATVCKALVTKASVFIPALSPYLLALYRVMKEKGTHERCIEQMQRLFTTKLY..................................
#=GR A7N4Z7_VIBCB/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A256BH25_9LACT/84-320              ..............................nl--GKPGWYNNIFFREAAEAE..GLIAKNVMADAFSNEAKAQVIDFIKNEF.gG......KVDFVVYSLA.......S..G..IRT..DP.....A.......T......G..E....TYHSAIK....AIG..E.P......V.V...G...PNV......NL.........Q...K...E...TFF.EQVL........EPA......T.......D.E.EIANTVKVMGGEDWRLWMTALREADVLSEGVQTVVYSYLGAELN..ESYYNKGTLGRAKADCDRFAALINED..L.AP.LKGQ...ATVVVATAVTTKASSVIPFFPVYCLGLYKVMSDAGLHETPIMHIDRIFRDMI-c.................................
#=GR A0A256BH25_9LACT/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T4U5D4_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSDEAKKKTIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....K.......T......G..E....VVRSSLK....PIG..E.T......Y.R...S...TAV......DT.........N...K...D...EII.ETSV........EPA......T.......A.E.EIKDTVTVMGGEDWELWIQALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAASALDEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGLHEGCMEQIYRMLSQRLY..................................
#=GR A0A1T4U5D4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
B5GA81_STRSH/125-361                 ................................RTATAGWYRTAATAEIARAA..GRDLVFLNGDAFSDTMKDQVADLIEQRF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..Q.A......N.R...T...KTLv...fdDQ.........G...V...P...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWVDHLASRGLLGEGFATAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLNER..L.DKtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGQN--LVPPVHQLAALW-----dql...............................
#=GR B5GA81_STRSH/125-361      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A242L6C4_9ENTE/82-318              ..............................ml--GTAGWYNNIFFREFAEKE..GLIAKNFIGDAYSLEMKEAVINYIKEEF.gG......KIDLLVYSLA.......A..P..KRT..DY.....K.......T......G..I....TYTSALK....PIG..K.T......V.T...G...ENI......NL.........E...K...E...ELF.TQVV........EPA......T.......E.E.EIEGTVKVMGGEDWEWWVELLKEEGLLAEGFKTTLYSYIGPKAT..HAFYHEGSLGVAKKQAEESSNRINES..L.KE.LNGE...SLICVSKAVTTKASVVIPILPKYLICLYKVMLEKGTHETPIMHKDRIFRTMFY..................................
#=GR A0A242L6C4_9ENTE/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9T7Z3_9VIBR/82-317                  ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKEKTIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LIRSSLK....PIG..D.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNDK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRAEGVHEGCMEQIFRMFSERLY..................................
#=GR F9T7Z3_9VIBR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A060B863_9GAMM/83-318              ................................KTGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSNEAREKAIELIKQDM..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMSALDDAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAAIDAK..L.KE.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGERLY..................................
#=GR A0A060B863_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H7WAX8_9GAMM/94-330              ................................KAGTAGWYNAAAFDKFAKAE..GLYSRSINGDAFSDEARAKVIELIKTEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....S.......T......G..E....LKRSALK....PIG..Q.P......Y.S...S...TAI......DT.........N...K...D...AIT.HASI........EPA......T.......E.Q.EIEDTVTVMGGQDWELWINALSEAGVLAPATRTVAFSYIGTEIT..WPIYWHGALGKAKVDLDATAQRLNAK..L.GA.DGGS...ANVAVLKSVVTQASSAIPVMPLYISIAFKVMKEQGLHEGTIEQLDRLFRERMY..................................
#=GR A0A1H7WAX8_9GAMM/94-330   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R0D8S1_9GAMM/82-316              ................................KPGSAGWYNSAAFHKYAGQA..GLYAKSVNGDAFSDEVKEQVIALIKADL..G......QVDQVVYSLA.......S..P..RRK..HP.....K.......T......G..E....VINSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...V...KLT.ETHL........EPA......T.......A.E.EIAGTVAVMGGEDWQMWIDALAAAGVLADGCSTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDQKVLGLREK..L.AA.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEKGTHEGCIEQLDVLYD----ily...............................
#=GR A0A0R0D8S1_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I5EN51_9BURK/82-318              ................................KTGTPGWYNTAAFERLATAE..GRYAKSINGDGFSDAVKQQVIETIRQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSTLK....PIG..Q.A......V.S...L...RGI......DT.........D...S...G...TVK.ETVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQLWIDALHEAGVLAEGAKTTAFTYLGEKIT..QDIYWNGSIGAAKKDLDRTVPAIRAK..L.AAhGGGD...ARVAVLKAVVTQASSAIPMMPLYLSLLFKVMKEEGTHEGCIEQVDGLFREGLY..................................
#=GR A0A1I5EN51_9BURK/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F0LQA9_VIBFN/82-317                  ................................KPGTAGFYNAAAFDKLAHEE..GLYAKSLNGDAFSNEAKQKAIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LIRSALK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIEDTITVMGGQDWELWMQALEDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRASAALNAK..L.AA.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGIHEGCMEQIFRLFNERLY..................................
#=GR F0LQA9_VIBFN/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q0I9X1_9GAMM/82-317              ................................KTGSAGWYNTAAFQDAADEA..GLWSKNINGDAFSNEIKQKAIETIKADL..G......KVDCIIYSLA.......S..P..RRT..DP.....N.......T......G..E....VYSSTLK....PIG..N.G......V.T...T...KNL......NT.........S...K...R...VID.EVTV........EAA......S.......Q.D.DIDNTIKVMGGEDWEMWIDALKEADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKES..T.KD.LNGQ...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHALFSENLY..................................
#=GR A0A0Q0I9X1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I1A909_9BACL/81-316              ................................RTASAGWYNSAAFERSASEA..GLKSFSIVGDAFSDEIKDKTIATIREEL..G......QIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PLG..G.T......Y.T...N...KTV......NF.........H...T...G...EVS.LASI........EPA......T.......E.D.EVRQTVAVMGGEDWEMWIDALREAGVLAEDATTVAYTYIGPEIT..HAVYREGTIGRAKEHLEETGLRLNDR..L.SA.TGGR...AFVSVNKALVTQSSSAIPVVPLYISVLYKVMKEKDLHEGCIEQMYRLFSERLY..................................
#=GR A0A1I1A909_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E7RSY0_9GAMM/82-316              ................................KPGTAGWYNSAAFQKYAKDA..GLYARSVNGDAFSDEVKAKVIELIRQDL..G......QVDQVVYSLA.......A..P..RRK..HP.....K.......T......G..E....VISSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VIT.ETTI........EPA......T.......P.E.EVAGTVAVMGGEDWQMWIDALLEAGVLAEGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDQKVQGIRAK..L.AP.LGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKERGTHEGCIEQLDTLYD----ivy...............................
#=GR A0A1E7RSY0_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V4SK47_CLOHU/81-316              ................................KTASAGWYNSAAFEKFAREE..GLYAKSINGDAFSNEIKEQTIELIKKDL..G......KVDMVIYSIA.......S..P..RRI..HP.....V.......T......G..E....VFNSALK....PIG..S.P......S.T...V...KTV......DF.........H...T...Q...QVS.ESTI........EPA......D.......E.E.EIRQTVAVMGGEDWDMWMKALKEADVLEQGAVTIAYSYVGPEMT..HAIYRKGTIGRAKDDLEATAIKLTEN..N.KD.MGLK...AYVSINKAVVTQASAAIPVISIYISVLFKVMQDMNIHEGTIEQMYRMLNDRVY..................................
#=GR A0A1V4SK47_CLOHU/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C7N8Z3_LEPBD/81-318                  ................................RVGSAGWWNTIAFNEAAEKE..GLVSKNFIGDAFSMEMKDDVIKFIKEEF.gG......KIDLLIYSLA.......S..G..VRT..DP.....I.......D......G..I....TYRSALK....STT..K.E......I.T...G...PTI......NF.........E...K...E...TME.ETTM........GVA......T.......P.E.EIKSTVKVMGGEDWKLWIEALDKGGVLSEGFKTVAYSYLGPKVT..YGIYKEGTIGAAKRDLEHTSDILNDF..L.KEkYNGE...AYVSLSKALMTRASAVIPIFPLYAALLYKVMKEKGIHEGTIEQKHRLLTQMVY..................................
#=GR C7N8Z3_LEPBD/81-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6RXY9_9BACT/89-325              ................................KTGTPGWYNNMAFDKFAKEA..GLESVTFNGDAFSHEMRQNVIDTLNKMG..R......KVDLLVYSVA.......S..S..VRV..DP.....D.......N......G..T....LYRSVLK....PIG..E.T......F.S...G...ATI......DC.........M...T...G...KIS.TISA........EPA......T.......E.E.EAANTVKVMGGEDWALWVNQLKAAGVLAEGVKTVAYSYIGPKLS..HAIYRDGTIGGAKKHLEATARELNSS..L.QKdLKGE...AYVSVNKGLVTRSSAVIPIIPLYLSVLFKVMKEQGSHEGCIEQMERLMSERLY..................................
#=GR A0A1M6RXY9_9BACT/89-325   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J3AJN8_9CAUL/82-314                  ................................KTASAGWYNNRAFEAQAQAR..GRKAVTLDGDAFSNDMKAKVIAAVREEL..G......QIDMLIYSMA.......A..P..VRT..DP.....R.......T......G..E....THRSVIK....PLG..E.P......V.R...V...KTL......NT.........D...K...G...EVF.ETEL........APA......T.......L.D.ETAATVAVMGGEDWEMWVAALADAGLLAEGFQTLDYTYIGSKLT..WPIYWHATLGKAKEDVDRAAAAIRDR..L.GP.--DA...ARVVSLKAVVTQASSAIPVVPLYGVVLFRVMKDMGLHEGCIEQIDRLFRDAL-..................................
#=GR J3AJN8_9CAUL/82-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5SBB0_9CLOT/81-313                  ................................RTGTAGWYNTVAFEEFATKD..GHYAKTINGDAFSDDIKKETIDLIKKDF..G......KVDMVIYSVA.......A..P..RRK..AP.....D.......-......G..V....TYRSVLK....TTD..G.A......Y.T...N...KTI......DL.........S...T...N...EIS.EVTI........EPA......T.......E.D.EINATVKVMGGEDWRLWIDAMKEADVLSDNAVTVAYSYIGPVLT..HPIYFDGSIGRAKADLYKTADEIDEQ..V.--.DGVS...AYVSVNKAVVTQSSAAIPIVPLYLSILLKVMKEKNVHEECIQQMYRLVHDRL-c.................................
#=GR R5SBB0_9CLOT/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G4H853_9BACL/81-316                  ................................RTASAGWYNSAAFEQAAEAA..GLKSFSVTGDAFTEETKAKTVELIKKEL..G......EVDLVVYSVA.......S..A..RRT..LP.....R.......T......G..E....TVSSVLK....PIG..Q.S......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVRNTVEVMGGEDWELWIQALSEGGVLADNATTIAFSYIGSEIT..KAIYRDGSIGQAKDHLEDTALKLNEA..L.AG.RGGR...AYVTVSKALVTQSSSAIPIVPLYVSALYKVMKEKGLHEGCIEQIYRLFTDRLY..................................
#=GR G4H853_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A239SDH9_9BURK/82-317              ................................KPATPGWYNTAAFDKFATEQ..GLYAKSINGDAFSKEIKAKTIETIKNDL..G......QVDLVVYSLA.......A..P..RRT..HP.....E.......T......G..Q....VFNSVLK....PVG..K.S......V.T...L...RGI......DT.........D...K...E...VVK.ESVF........EPA......S.......Q.E.EIENTVAVMGGEDWQMWMDALADAGVLAPGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDEKVLGIRAK..L.AP.SGGD...ARVAVLKALVTQASSAIPMMPLYLSLLFKVMKAKGTHEGCIEQIYGLYKDSLY..................................
#=GR A0A239SDH9_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1L6M0S3_9DELT/89-316              ............................kmqi-----GPYHVQAMREAADAE..GIPTRFWNEDATKTEVIDRVRAALEADG..I......RVVHLVNGIA.......N..GatKRY..AE.....H.......G......P..T....QVKDVDV....AFD..P.V......L.Q...I...PDFs....qPE.........N...V...R...RVG.LVDV........EVA......T.......E.A.DIDRTNRFMGTSS-LLWAEPLARAGFLVKGESIVAFCDYDYPAD..DPVYAMGPLAGAKVLQRKTMAEIEER..F.GA.--RT...ARIC-YPPVATTALGAIPGGLLMYALSAQILKERGQYRDVM------------elgvd.............................
#=GR A0A1L6M0S3_9DELT/89-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X7I1Y5_9SPHI/82-318              ................................KPGTAGWYNSAAFEKEAHAA..GLYAKSINGDAFSDEIKKQTIDLIKSDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PIS..Q.P......F.T...D...KTV......DF.........H...T...G...VVS.DITI........QPV.....eN.......P.E.DIENTVAVMGGEDWKFWIEELKAAGVLAEGVKTVAYSYIGPELT..YPIYRNGTIGRAKDDLEGTVPVLNAL..L.SD.LGGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A1X7I1Y5_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2DTM3_9BACT/90-327                  ................................RLATAGWWNNIFFKQKAEQE..GLVAKNFIGDAFSNEMKDQVIDYIKTEF.gG......QIDLLIYSLA.......A..P..KRK..DP.....K.......T......D..I....VYTSALK....PID..E.V......V.I...G...HSI......NL.........E...N...G...KLF.KQII........EPA......T.......D.E.EIKSTIKVMGGEDWELWIDALEEANVLSEGFKTTLYSYVGPDIT..KAFYGNGTLGRAKRDAEQTSDRLNER..L.KNrVFGE...SIICCSKAVTTKASAVIPIFPLYASALYRVMAEKDLHETPIMHKYRFFKDMLY..................................
#=GR U2DTM3_9BACT/90-327       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A4A5N1_9GAMM/82-317                  ................................KPGTAGWYNSAAFHAEAEDA..GLYARSINGDAFSDEIKQRTIEEIRNHM..G......QVDLVVYSLA.......S..P..RRT..HP.....R.......T......G..E....VHSSTLK....PIG..S.A......T.T...Q...KGI......NT.........D...K...G...EIQ.EFHL........EPA......T.......Q.D.EIDNTVAVMGGEDWQFWIEALDEAGVLADGAKTTAYTYVGEKLT..WDIYWHGTIGAAKKDLDRRVIDIRKR..L.AA.KGGD...ARVSVLKAVVTQASAAIPAMPIYLAILFKVMKEQGTHEGCIEQVDGLFRDSLY..................................
#=GR A4A5N1_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1U7PWW2_9FLAO/82-318              ................................KMGTAGWYNSAAFEKEAHAA..GLYAKSINGDAFSDDIKRQTIDLIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..E.P......F.T...N...KTV......DF.........H...T...G...VVS.DITI........SPV.....eN.......E.E.DIANTIAVMGGEDWKFWIEDLKNAGVLADGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEKTVTVLNDL..L.KD.LHGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGTHEGTIEQMQRLFAGRLY..................................
#=GR A0A1U7PWW2_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5CK40_9GAMM/82-317              ................................KPGTAGWYNTAAFDKFAKEE..GLYSKSLNGDAFSDEAKRKAIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....K.......T......G..E....VVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...EII.QASV........EPA......T.......Q.E.EIKDTITVMGGEDWELWMQALSDADALADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAASALNDK..L.ST.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A1E5CK40_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R4L749_9SPHI/82-318              ................................KPGTAGWYNTAAFEKEAQEA..GLYAKSINGDAFSDEIKKQTIELIKQDL..G......QVDLVIYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PID..V.P......F.T...N...KTV......DF.........H...T...G...VVS.DITI........NPI.....dN.......Q.E.EIANTVAVMGGEDWKFWIEDLKEAGVLAEGAKTVAYSYIGPELT..FPIYRNGTIGRAKDDLEGTVPAINAL..L.KD.INGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A1R4L749_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G1NHG0_9BACT/82-317              ................................RTASAGWYNSVAFEQKARQA..GLYAKSFNGDAFSDEIKEKVVDAIKKDL..G......QVDLVIYSLA.......S..P..RRE..HP.....K.......T......G..Q....LAKSALK....PIN..S.S......Y.T...G...KTL......DV.........T...T...N...TLE.PVTL........PQA......T.......Q.E.EIEQTVSVMGGEDWEYWIDALEKNGLLAQGATAVAYSYMGPELT..RGIYREGTIGRAKDHLEATARKLDGR..L.KK.IKGR...AIVSVNKALVTQSSSAIPVIPLYFVLLNKVMKAKGIYEDCIAQIYRLFSTRLY..................................
#=GR A0A1G1NHG0_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P7XE60_9GAMM/81-316              ................................KTGTAGWYNTAAFHEKARAA..GLYAESINGDAFSDDLKAQTIEKIKADL..G......QVDLVIYSLA.......S..P..KRK..DP.....E.......S......D..Q....VFSSTLK....PVG..Q.T......Y.T...T...KTY......DT.........D...K...D...LVH.DVTL........EPA......N.......E.D.EIRQTVKVMGGEDWERWIKALAAAGVLAQDCQTTAYTYIGKKLT..WPIYGHATIGKAKEDLDRAATAIRAD..Y.QS.LGMK...AYVSSLKAVVTQASSAIPVMPLYISLMYKVMKEDGTHEGCIEQAYRLFTEGLY..................................
#=GR A0A0P7XE60_9GAMM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A240UU21_9GAMM/82-318              ................................RPGSAGWYNSAAFDRLASAE..GLYSRSINGDAFAHETRDQAIEMIKGEM.gG......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VVKSALK....PIG..E.T......Y.R...A...TAL......DT.........N...K...D...QII.EASV........EPA......S.......Q.E.EIDNTIRVMGGEDWELWIDALDQAGVLAEGASTVAFSYIGTEIT..WPIYWHGSLGKAKEDLDRAAQALDTR..L.SE.KGGH...ANVAVLKSVVTQASAAIPVMPLYISMVYRIMKEKNLHEGTIDQLNRLFHEHL-t.................................
#=GR A0A240UU21_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H0DHJ9_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDM..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMEALDEAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAAIDSK..L.KT.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGVHEGTIDQLNRLFGERLY..................................
#=GR A0A1H0DHJ9_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A226INX1_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWSMWMDALKSENLLAEGATTIAYSYIGPELT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A226INX1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q0VAS6_9SPHI/81-316              ................................KTASPGWYNTAAFETEAIKA..GLYAKSINGDAFSNEVKAQTIDLIKADL..G......QIDLVIYSLA.......S..P..VRT..NP.....N.......T......G..I....THRSVLK....PIG..G.T......F.S...N...KTV......DF.........H...T...G...IVS.EVSI........EPA......N.......E.E.EIENTIAVMGGEDWAMWIDALKEANLLAEGFSTVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFTISDT..L.KD.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFKDRLY..................................
#=GR A0A0Q0VAS6_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J7TL49_MORMO/82-317                  ................................KTGSAGWYNAAAFDKAAKEE..GLYAKSINGDAFSDECRQNVIDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....IVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLI.EAVV........EPA......N.......E.Q.EIADTVKVMGGQDWELWMNALEEAGVLADNAQSVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAAAINQK..L.QA.KGGA...AYVAVLKSVVTQASSAIPVMPLYISIVFKIMKEKGIHEGCIEQTQRLFATKLF..................................
#=GR J7TL49_MORMO/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B1MWB0_9BACL/81-316              ................................RTASAGWYNSAAFEKAAEEA..GLKSFSVTGDAFDADTKKRTAELIKREL..G......QVDMVIYSVA.......T..A..RKT..DP.....A.......T......G..E....VFNSVLK....PIG..Q.T......Y.T...N...KTV......DF.........H...N...G...TVT.DISI........EPA......T.......E.E.EIKATVEVMGGNDWQDWMQMLEEAGVLADGVITLAYSYLGPALT..QPIYRDGSIGQAKDHLEATARRMNDQ..L.AA.KQGH...AYVVVGKALVTQSSSAIPIVPLYISALYKVMKEKGIHEGTIEQMYRLFAERLY..................................
#=GR A0A1B1MWB0_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A081KBW9_9GAMM/82-317              ................................KPGTAGWHNSAAFEKLAHEA..GLYAKSLNGDAFSHEAKQKAIELIKQDL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSVLK....PMG..E.T......Y.R...A...TAV......DT.........N...K...D...TLF.EATV........EPA......T.......A.E.EVAATVTVMGGQDWELWMKALSEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGEAKKDLDRAAHTIDDQ..M.KA.LHGS...ANIAVLKSVVTQASSAIPVMPLYISMVFKKMREEGVHEGCIEQINRMFRERLY..................................
#=GR A0A081KBW9_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A238YIP7_9PROT/81-316              ................................KPGTAGWYNSAAFHKLAEAE..GLYAASINGDAFSDAVKQQTIDTIKRDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..H....VYNSTLK....PIG..K.T......L.H...Q...RGL......DT.........D...K...E...VIK.ENVI........EPA......T.......D.E.EIANTVAVMGGEDWQMWIEALDQAGVLADGAKTTAFTYLGEKIT..HDIYWNGTIGAAKKDLDQRVLQIREQ..L.AA.RGGY...ARVAVLKALVTQASSAIPMMPLYLSLLFKVMKQAGTHEGCIEQVDGLYRDSLY..................................
#=GR A0A238YIP7_9PROT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S6IR34_9LACT/83-319              ...............................n-LGTAGWYNNIAFRQAAEKE..GLIAKNFVADAFSHETKQEVIDYIKQEF.gG......KVDLVVYSLA.......S..G..VRK..DP.....D.......T......G..E....TYHSAIK....AIG..E.P......V.I...G...PHI......NM.........Q...T...E...SFY.TEKL........EAA......S.......D.E.EIANTVKVMGGEDWQLWMEALKEADVLADGVLTTNYSYLGTELN..HVYYGGGTLGRAKADCDEKAANIDAL..L.AD.INGK...AQMIVATAVTTKASSVIPFFPVYCIALYKVMSEQGTHETPIMHQERIYREMVY..................................
#=GR A0A1S6IR34_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H7ITK6_9GAMM/91-326              ................................KTASAGWYNTAAFQAAADEA..GLWSKNINGDAFSHEIKAKAIETIKAEL..G......EIDLIVYSVA.......S..P..RRT..DP.....D.......T......G..E....VYSSTLK....PIG..E.S......V.T...T...KNL......NT.........T...K...R...IID.SVSV........EAA......T.......E.A.EIQGTIDVMGGADWELWINALKDAGVLAKGFKTVAYTYIGKELT..WPIYGHATIGRAKEDLDRASSAIKAT..T.AE.INGE...AYVTSLNAVVTQASSAIPIMPLYISAMFKVMKADGTYEGCIEQIQGLFRENIY..................................
#=GR A0A1H7ITK6_9GAMM/91-326   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6HE07_9XANT/82-318              ................................KAGTAGWYNSAAFDTQAKAA..GLYSKSINGDAFSDAARAQVIELIKTEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PIG..Q.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......T.......E.Q.EIEDTITVMGGQDWELWIDALEGVGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLNAR..L.SK.YGGS...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR A0A1Y6HE07_9XANT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C4SE96_YERMO/108-344                 ................................KPATSGWYNSAAFHKFAEQK..GLYAKSINGDAFSDQIKQLTIDAIKQDL..G......QVDQVIYSLA.......S..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..H.E......V.K...F...RGL......DT.........D...K...E...VIK.EAVL........QPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALLEAGVLAEGAQTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLAIRDS..L.AAhGGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYSLYKESL-c.................................
#=GR C4SE96_YERMO/108-344      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A244CU57_9GAMM/82-317              ................................KTGSAGWYNSAAFHQAAEAE..GLWAKSINGDAFSNEIKEKTIAAIQAEM..G......KIDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....VYSSTLK....PIG..N.S......V.T...T...KNL......NT.........S...K...R...LID.EISV........EAA......N.......E.D.EIANTVKVMGGEDWELWLNALNDADVLAENFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAASAIKET..T.RA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHGLFNENLY..................................
#=GR A0A244CU57_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S5ZPF0_9SPIO/86-321                  ................................KWGTPGWYNNLAFDGAAKAE..GLVSITIEGDAFSDAVKAEVIKKAKEHG..M......NFDLVIYSLA.......S..P..LRI..DP.....D.......T......G..V....TYKSVLK....PFG..K.A......F.T...G...KTL......DP.........F...T...G...KLS.EITA........EPA......T.......E.E.EAAATVKVMGGEDWQRWIEQLSEAGVLAEGCITAAYSYIGPEAT..QALYRKGTIGKAKEHLEKTAHILNDK..M.KT.FNGK...AFVSVNKGLVTRASAVIPVIPLYLASLFKVMKEKGNHEGCIEQINRLFSERLY..................................
#=GR S5ZPF0_9SPIO/86-321       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q9HEC9_9VIBR/82-317              ................................KPGTAGFYNAAAFDKLASEA..GLYAKSLNGDAFSNEAKQKTIDLIKQDL..G......QVDMVVYSLA.......S..P..VRK..LP.....E.......S......G..E....LIRSALK....PIG..Q.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIKDTVTVMGGEDWELWVNALAEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNTK..L.AE.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A1Q9HEC9_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A136Q4J4_9FIRM/81-313              ................................RTASAGWYNTAAFEEFAHAD..GLYAKTINGDAFSRGVKEQAAELIEKDL..G......QVDMVVYSLA.......S..P..RRT..LA.....D.......-......G..T....TVSSTLK....TTD..S.D......Y.T...N...KTI......DL.........A...T...R...RIT.EVTV........PPA......T.......E.Q.EIADTVKVMGGEDWKEWISLLSEKGLLAPDAVTLAYSYLGPELT..HPIYMDGSIGRAKEHLFRTSQEITQE..V.--.PGVT...AYISVNKALVTQSSAAIPIVPLYISILYHVMKEKGTHEGCIEQMHRLYAEKL-p.................................
#=GR A0A136Q4J4_9FIRM/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8W8Y3_9BACI/81-316              ................................RTASAGWYNSAAFEEAASAA..GRKSYSIVGDAFSDEIKAKTIDLILTEL..G......QIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFASVIK....PLG..G.T......Y.T...N...KTV......NF.........H...S...G...EVS.QATI........EPA......T.......E.D.ELRQTIAVMGGEDWQMWIDELQQAGALAEGATTVAYSYIGPEIT..HAVYREGTIGAAKNDLEATAQRLNAQ..L.SS.NGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQMYRLFSERLY..................................
#=GR A0A1B8W8Y3_9BACI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A285R9F2_9ACTN/86-322              ................................RTATAGWYRTAATAELARSA..GRELVFLNGDAFSDAMKEQVADLVEQRF.gG......RLDYLLYSVA.......A..P..RRT..DP.....D.......T......G..A....GYASVLK....PIG..R.A......A.R...T...RTLv...fdDQ.........G...V...P...EVR.EVET........EPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRGLLADGFTTAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLDAR..L.RTtVGGR...AVTSVNGAAVTQSSTAVPGIALYTGLLRGVLGEE--MVPPVRQLAALWD----ql................................
#=GR A0A285R9F2_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A5W325_9BACT/81-313              ................................KPASAGWYNSAAFESAAHTS..GLYAKSINGDAFSTEVKEQTIDMIKADL..G......QVDLVIYSLA.......S..P..RRT..DP.....A.......S......G..E....TYRSCLK....PIG..G.T......Y.T...N...RTL......DT.........D...K...A...QVS.DITI........DAA......T.......K.Q.EAEDTVKVMGGEDWELWMQALAQAGVVAQGAKTVAYSYIGPEIT..WPVYTNGTIGAAKKDVERAAAAITAQ..Y.--.-DCD...AYVSVNKAVVTQASSAIPVVPLYISILFKIMKSKGTHEDCIEQTVRLFNQRLY..................................
#=GR A0A2A5W325_9BACT/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H2TG32_9BACL/81-316              ................................RTATAGWYNSAAFEQEAHRE..GLYAKSINGDAFSNELKQQTIDLIKKDL..G......QVDLVIYSLA.......S..P..KRK..HP.....V.......T......G..E....LFSSVLK....PIG..R.P......Y.A...S...KTV......DF.........H...T...G...VVS.EVSI........EPA......N.......D.E.EIRQTVAVMGGEDWEMWVQALSEAGVLADGATTLAYSYLGPTLT..WPIYRDGSIGRAKIDLDETAHRLDRR..L.KE.RGGR...AYVSVNKAVVTQSSSAIPVVPLYISILFKLMKEQGTHEGCTEQIYRLLSERLY..................................
#=GR A0A1H2TG32_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A9GCU7_SORC5/91-319                  ...........................mqigp-------HHVKAISAAAAAE..GLTARFWNNDATRPQVIDEVVAALKERY..R......AVHLV-NGIA.......A..G.aMKR..YA.....E.......H......G..P....TKVKDLD....VAF..D.P......V.L...QipdFSR......PE.........N...I...R...KLG.LVEV........DVA......N.......D.A.DIERTNKFMGTSS-LLWVEPLAAAGLIAKGESVVSFCDYDYPSD..DPVYAMGPLAGAKILQRKTMAEIRER..F.GA.--KT...ARIC-YPALATTALGAIPGGLLMYGLSTQILKERGQFKDVID-----------lagetme...........................
#=GR A9GCU7_SORC5/91-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6JZI9_9BURK/82-317              ................................KAGTAGWYNTAAFEKFAREK..GLYATSINGDAFSDEVKQRTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......T......G..E....VFTSTLK....PVG..K.A......V.N...L...RGI......DT.........D...K...E...VIK.ETVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALLNAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSMY..................................
#=GR A0A1N6JZI9_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A017SW55_9DELT/91-317              ...........................mqigp-------HHVQALTAAAAAE..GVDARFWNADATRPQTVEEVVAALKERY..R......AVHLV-NGIA.......A..G.aTKR..YA.....E.......H......G..T....TTVRDLD....VAF..D.P.....vL.Q...V...PDFs....rPE.........N...I...R...KLG.LVEV........EVA......T.......D.A.DIERTNRFMGTST-LLWAEPLAAAGLLAPGESVVAFCDYDYPAD..DPVYAMGPLAGAKVLQRKSMQEIRGR..F.GV.--KT...ARI-CYPPVATTALGAIPGGLLMYGLSAQILKERGEL----------------rdvldlgret........................
#=GR A0A017SW55_9DELT/91-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6NCT4_9SPIO/81-316              ................................RTASAGWYLDQAFQKEAGAA..GLQHKSIIGDAFSHQVKEETIREIRSMM..E......QVDFVVYSLA.......S..G..VRI..DP.....D.......T......G..E....MYRSTLK....PIG..R.D......Y.R...A...LSL......DS.........R...T...G...EVA.EATV........PAA......T.......E.E.EIAQTVKVMGGEDWELWIKALQAGGVLAPGAVTVAYSYIGPKLT..FPLYRDGTIGRAKDHLEETARSLDTV..L.RE.SGGR...AWVSVNKALVTRASSVIPAVPLYLALLYRIMKEKGLHEGTIEQCLRLFSEKLF..................................
#=GR A0A1N6NCT4_9SPIO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H8DLD3_9BACL/81-316              ................................RTATAGWYNTAAFEKAATEA..GYVAKSINGDAFSNEIKQETIDLIKKEF..G......KVDIVVYSLA.......A..P..RRV..HP.....D.......T......G..E....VFSSVLK....PIG..Q.A......Y.T...N...KTV......DF.........H...T...G...KVS.EVTL........EPA......T.......E.E.EIRHTVAVMGGEDWKMWIDALEEAGVLADGVITLAYSYIGPKIT..HPVYREGTVGRAKDHLEATAHELDAQ..L.KK.LNGR...AFVSVNKAVVTQSSSAIPVVPLYISLLFKVMKEKGLHEGCIEQMYRLFADRLY..................................
#=GR A0A1H8DLD3_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_IDILO/82-317                    ................................KTATAGWYNTAAFHQEANKA..GLAFHSINGDAFSDEIKQESIDYIKQNM..G......KIDLVVYSLA.......S..P..KRK..DP.....D.......S......G..E....VYSSVLK....PIG..K.Q......Y.T...T...KTY......NT.........D...K...D...QVH.EVTL........DPA......T.......D.E.DIANTVKVMGGEDWERWVKALHNAGVLAENCQTTAYTYIGKKLT..LPIYGHATIGRAKEDLDRAASELVAE..C.DD.LNLK...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR FABV_IDILO/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D8ICF9_BRAP9/82-319                  ................................RTATPGWYNNMAFSEFAKRD..GIEELSLNLDAFLNASKEEVIKEAKKFF.dG......KIDLFIYSLA.......A..P..VRT..DE.....K.......T......G..T....LYRSALK....PIG..K.K......Y.E...G...MGI......DF.........M...T...E...ELL.NVSI........EPA......N.......D.D.DIKNTVKVMGGEDWELWTNALLEADMLAENAINIAYSYIGPEIT..KAVYREGTIGRAKDDIESTAHRLDKN..M.QKkINGH...AYISVNKAVVTRASSVIPTVPLYIGILFKIMKAKGLHEGCIEQMYRLLSDKLY..................................
#=GR D8ICF9_BRAP9/82-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S2TUE1_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINCDAFSHEAKAKVIELIKADL..G......QIDMIVYSLA.......S..P..VRK..LP.....D.......S......G..E....VIRSALK....PIG..E.S......Y.R...S...TAV......DT.........N...K...D...TII.EASV........EPA......T.......E.Q.EINDTVTVMGGQDWELWVDALDKAGVLADGCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAASELNQR..L.AA.KGGS...ANVAVLKSVITQASSAIPVMPLYIAMVFKKMREEGLHEGCMEQIYRMFSERLY..................................
#=GR A0A1S2TUE1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V9EA78_9BACT/81-316              ................................KTASPGWYNSAAFQNEAKKA..GLYAKSINGDAFSDEIKKQTIELIKKDL..G......KIDVVVYSLA.......S..P..VRT..NP.....K.......T......G..V....THRSVLK....PIG..Q.T......F.T...N...NTV......DF.........H...T...G...KVT.EISI........APA......T.......P.E.DIDNTIAVMGGEDWQMWMDALLQADALSENALTLAYSYIGPGLT..EAVYRKGTIGKAKDHLEATAFNITDS..L.KK.VNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKEKGIHEGCIEQIDRLFRERLY..................................
#=GR A0A1V9EA78_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C9MUR8_9FUSO/81-318                  ................................RVGSAGWWNTIAFNEAAEKE..GLVSKNFIGDAFSMEMKDDVIKFIKEEF.gG......KIDLLIYSLA.......S..A..VRT..DP.....I.......D......G..V....TYRSALK....STT..K.D......I.T...G...PTI......NF.........E...K...E...VME.ETTM........GVA......T.......P.D.EIKSTVKVMGGEDWKLWIEALDKGGVLSEGFKTVAYSYLGPKVT..YGIYKEGTIGAAKRDLEHTSDVLNDF..L.KEkYNGE...AYVSLSKALMTKASAVIPIFPLYAALLYKVMKEKGIHEGTIEQKHRLLTQMVY..................................
#=GR C9MUR8_9FUSO/81-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A150ANY1_9BACT/81-316              ................................RPASPGWYNSAAFEKQATEA..GLYAKSINGDAFSNEIKQQTIDMIKEDL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..K....RHKSVLK....PIG..D.V......F.S...N...KTV......DF.........H...T...G...NVT.EVTI........QPA......N.......E.D.DIANTVEVMGGEDWEMWIDAMKEAGVLADGCQTFAYSYIGPKLT..EPVYRKGTIGAAKDDLEATSFKIAEK..L.KD.INGN...AVVSVNKALVTQASSAIPVIPLYISLLYKTMKEKGIHEGCIEQIQRLYADRIF..................................
#=GR A0A150ANY1_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A136A578_9ALTE/82-317              ................................KTGTAGWYNTAAFHQAAKAA..GLYADTLNGDAFGKEMKQQVIDTLKANM..G......KVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..E....IYKSTLK....PVG..Q.S......F.K...T...KTY......DT.........D...K...N...LVH.EIAL........EPA......N.......E.D.EIQQTIKVMGGEDWELWLNALADADLLADGCKTTAYTYVGKELT..WPIYGQATIGKAKEDLDRAAAAIVKS..K.AA.LNVQ...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKDEGTHQGCIGQIYDLFADKL-t.................................
#=GR A0A136A578_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M4T5E4_9GAMM/84-319              ................................KPGTAGWYNAAAFDRYAKEE..GLYSKAINGDAFAHETREKAIELIKQDL..E......EVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSVLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.ETEV........EPA......T.......E.Q.EVADTVQVMGGEDWELWIDALDKAGVLAPGAKSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAEIDER..L.AK.QGGS...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFRDRLY..................................
#=GR A0A1M4T5E4_9GAMM/84-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1K1N9S9_9GAMM/82-318              ................................KTGTAGWYNSAAFDRLAREQ..GLFSRSINGDAFADETRAKAIDIIRNEM.gG......KVDLVVYSLA.......S..P..VRK..LP.....K.......T......G..E....VVRSALK....TIG..E.T......F.T...A...SSV......DT.........N...K...D...AVV.MATV........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSEAGVLADNATTIAYSYVGTEIT..WPIYWHGTLGQAKQHLDRTAKELRER..H.AA.NGLR...SYVGVMKSVVTQASSAIPVIPLYVSMVFKIMKAKGIHEGTIEQINRLFHDRLY..................................
#=GR A0A1K1N9S9_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A068Z3W5_9GAMM/82-317              ................................KTGSAGWYNSAGFDKVAKEA..GIYAKSINGDAFSNECRQSVIDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLV.EAVV........EPA......N.......E.K.EIADTVKVMGGQDWQLWMDALDEAGVLADNIQTVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAQAIDQK..L.KA.KSGA...AYVAVLKSVVTQASSAIPVMPLYISIVFKIMKEQGIHEGCIEQVQRLFASKLY..................................
#=GR A0A068Z3W5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A3VIR5_9GAMM/82-318              ................................KPGTAGWYNAAAFDRYAKQA..GLYSRSINGDAFSDEARAQAIELIKNEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VVRSALK....PIG..E.A......Y.T...S...TAI......DT.........N...K...D...QII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALRDAGVLADGAKTVAFSYIGTEIT..WPIYWHGALGKAKADLDATARRLDAQ..L.AT.TGGS...ANVAVLKSVVTQASAAIPVLPLYIAIAFKVMKQAGLHEGTLDQLDRLFRERMY..................................
#=GR A0A2A3VIR5_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W7YJC8_9BACL/81-316                  ................................RTASAGWYNSAAFEKAAEAA..GLKSFSVTGDAFSTETKTKTIELIRKEL..G......KVDLVIYSVA.......S..A..RRT..NP.....V.......T......G..E....FSNSVLK....PIG..H.S......Y.T...N...KTV......NF.........H...T...G...EVS.EVTL........EPA......T.......Q.Q.EISDTVTVMGGDDWQQWMNALSEGEVLTNDVTTIAYSYIGSEIT..QAIYREGSIGQAKDHLESTALQMNEK..L.AA.HGGR...AYVCVSKGLVTQSSSAIPVVPLYMSALYKVMKEKGLHEGTIEQTYRLFSERLY..................................
#=GR W7YJC8_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A117KEP5_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWTMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KS.IGGQ...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFKDRLY..................................
#=GR A0A117KEP5_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C3DHQ7_9VIBR/82-317              ................................KPGTAGFYNAAAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKADL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAAKALNDK..L.QA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A0C3DHQ7_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M0HR65_VIBNE/83-319              ...............................g-VGTAGYYNNIFFKKYAEEA..GRTAINIQGDAFSPQTKEDVIEAIETYF.eG......EVDLVIYSVA.......A..G..IRP..DP.....E.......T......G..E....MLRSAIK....PIG..Q.E......V.T...G...ATI......TL.........E...D...D...TWH.ETTI........TSA......T.......E.Q.EAKDTLKIMGGQDWESWIDTLINVESIAEGCKTIAFSYVGPEVT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FNGG...AYATVCKALVTKASVFIPGLSPYLIALYKVMKEQGTHEGCIEQMQRLFSEKLY..................................
#=GR A0A0M0HR65_VIBNE/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G7TTP6_9BACL/81-316              ................................RTASAGWYNSAAFEKAAQEA..GLQSFSVTGDAFSKETKVRTAELISKEL..G......QVDLVVYSVA.......T..A..RKT..DA.....N.......T......G..Q....YYNSVLK....PIG..E.S......Y.S...N...KTV......NF.........H...T...G...EIS.MVTL........EPA......T.......E.Q.EISETVAVMGGDDWQEWIDTLCEAGVLAQNAITIAYSYIGPELT..ERIYREGTIGQAKDHLEATAKQLDKQ..L.EA.QGGH...AYVVVSKALVTQSSSAIPIVPLYMSALYKVMKEKGIHEGTIEQMHRLFADRLY..................................
#=GR A0A1G7TTP6_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV2_VIBVY/83-320                   ...............................g-TGSAGWYNNVFFKREAEKE..GRIAINIVGDAFASETRTQVIEAIETYF.eG......EVDLVIYSLA.......T..G..MRP..IP.....N.......Q.....pG..E....FWRSVIK....PFG..Q.T......V.T...G...ASL......DL.........E...H...D...RWI.DTTL........ESA......T.......E.E.EALHTIKVMGGEDWESWIDTLINAESIAQGCQTIAFSYVGPEIT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FDGA...AYATVCKALVTKASVFIPALSPYLLALYRVMKDEKCHEGCIEQMQRLFATKLY..................................
#=GR FABV2_VIBVY/83-320        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q2BLL7_NEPCE/82-317                  ................................KPGTAGWYNSAAFDKEAKAA..GLYSKSLNGDAFSHEAKAKTIDLIKEDM..G......QVDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....VIRSCLK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...VII.EAEV........EPA......T.......E.E.EIAATVTVMGGEDWELWMNALSEAGVLAEGCKSVAYSYIGSDIT..WPIYWDGALGKAKQDLDRAAASINTQ..L.EA.TGGQ...ANIGVLKSVVTQASSAIPVMPLYLAMCFKVMREKGLHEGCMEQVQRLFATGLY..................................
#=GR Q2BLL7_NEPCE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A8EJM8_9ACTN/87-323              ................................RTATAGWYRTAATAELAREA..GRDMVFLNGDAFSDTMKEQVADLLVERF.gG......KLDYLIYSVA.......A..P..RRT..DP.....E.......T......G..T....VHASVLQ....PIG..A.S......S.R...T...KTLv...fdDE.........G...A...P...EVK.EVET........APA......A.......E.E.DIAHTVAVMGGADWERWIDHLAGRGLLADGFATAALSYIGSTLT..EAIYRKGTIGAAKAHLEGTARALDKR..L.SElVGGR...AVTSVNGAAVTQSSTAIPGIALYVGLLRGVLDERMV-----------------pptaqlsalwdql.....................
#=GR A0A0A8EJM8_9ACTN/87-323   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J6XIK1_9ACTN/88-324              ................................RTATAGWYRTAATADLARAA..GRDLVLLNGDAFSDSMKDQVADLVERRF.gG......RLDHLVYSVA.......A..P..RRT..DP.....A.......T......G..T....TYASVLK....PIG..R.P......D.R...T...KTL......VF.........D...E...EgvpEVR.EVET........APA......E.......G.D.DVEQTVAVMGGADWERWIDHLAARGLLAEGFTTAALSYIGSSLT..AAIYRQGTIGAAKAHLEATARTLNER..L.GTtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGEG--LVPPVRQLAALW-----dql...............................
#=GR A0A0J6XIK1_9ACTN/88-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1C4NW38_9ACTN/84-320              ................................RTGTAGWYRTAATAELARRH..GHDMVFLNGDAFSDEMKNQVAQVLEERF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..E.A......Y.S...T...KTLv...fdDG.........G...T...G...EVR.EVGT........QPA......E.......G.D.DIEQTVAVMGGTDWERWIDHLADRGLLADGFTTAALSYIGSALT..AAIYRQGTIGAAKSHLEQTARTLDER..L.GKlVGGR...AVTSVNAAAVTQSSTAIPGIALYVGLLRGVLGHT--MVPPIGQLTDLWD----ql................................
#=GR A0A1C4NW38_9ACTN/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C9QJT5_VIBOR/82-317                  ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...LII.EASV........EPA......T.......E.D.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNDK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRAEGVHEGCMEQIYRMFSQRLY..................................
#=GR C9QJT5_VIBOR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X9NEV0_9GAMM/82-317              ................................KPGTAGWYNSAGFHKYAEAE..GLYAKSINGDAFSDEIKQKTIETIKADL..G......QVDLVVYSLA.......S..P..VRQ..HP.....K.......T......G..E....LHRSTLK....PIG..Q.D......I.V...Q...RAA......DT.........D...K...G...ILK.DVSV........TAA......S.......Q.E.EIDNTVAVMGGEDWQMWIDALDEAGVLAEGAKTTAYTYIGEKIT..WDIYWHGTIGQAKQDLDKRVIDIREK..L.AA.SGGD...ARVSVLKAVVTQASSAIPVMPLYLGLLFKVMKEDGSHQGCIEQIDLLFRESLY..................................
#=GR A0A1X9NEV0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D0I6P4_GRIHO/82-317                  ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSDEAKKKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....K.......T......G..E....VVRSSLK....PIG..E.A......Y.R...S...TAV......DT.........N...K...D...EII.EATV........EPA......T.......D.Q.EIKDTVTVMGGEDWELWIQALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAAALNEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR D0I6P4_GRIHO/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D3EDL3_GEOS4/81-316                  ................................RTASAGWYNSAAFEKAADAA..GLKSYSVTGDAFTQETKAKTVELIRKEL..G......QVDLVVYSVA.......S..A..RRT..LP.....E.......T......G..E....TVSSVLK....PIG..P.A......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVKNTVEVMGGDDWELWMNELAEGGVLAPDVTTIAFSYIGSEIT..KAIYRDGSIGQAKDHLEATALKLNEK..L.AT.GGGR...AYVTVSKALVTQSSSAIPVVPLYVSALYKVMKEKGLHEGCIEQIYRLFSDRLY..................................
#=GR D3EDL3_GEOS4/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PSEAE/82-317                    ................................KPGTAGWYNSAAFEKFAHEK..GLYARSINGDAFSDEVKRLTIETIKRDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......S......G..E....VFSSTLK....PIG..K.S......V.S...F...RGL......DT.........D...K...E...VIK.DVVL........EAA......S.......D.Q.EVADTVAVMGGEDWQMWIDALLEADVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIRDK..L.AP.LGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVDGLYRESLY..................................
#=GR FABV_PSEAE/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q1I4Y5_PSEE4/97-330                  ................................KAGTAGWYNAAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLVIYSLA.......S..P..VRK..LP.....Q.......T......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...VII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWIDALNAAGVLAPQARTVAFSYIGSDIT..WPIYWDGALGKAKQDLDETAQRLGKK..V.--.-GGS...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGIHEGTQHQLDRMFRDRMY..................................
#=GR Q1I4Y5_PSEE4/97-330       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6FAZ9_9BURK/82-317              ................................KLGTAGWYNTAAFEKIATDK..GLYAKGINGDAFSDALKQQTIDVIKRDL..G......KIDLVVYSLA.......S..P..RRT..HP.....R.......T......G..E....VFNSTLK....PIG..K.A......V.T...L...RGI......DT.........D...K...E...VVR.ETAL........EAA......T.......Q.T.EIDNTVAVMGGEDWQMWIDALLEADVLADGAKTTAFTYVGEKIT..HDLYWNGSIGAAKKDLDQKVVGIRKK..L.AR.TGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A1N6FAZ9_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4R872_9GAMM/82-317              ................................KTGTAGWYNAAAFDKFAKEE..GLYAKSINGDAFSNEAREKVIETIKADL..G......QVDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....VIRSVLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...N...TII.DAEV........EPA......T.......E.E.EIAATTTVMGGQDWELWMSALEEAGVLADGARTVAYSYIGSEIT..WPIYWHGALGKAKEDLDRAANEINTR..L.AV.NGGG...ANVAVLKSVVTQASAAIPVMPLYLAMVFNVMRKEGIHEGCIEQIQRMFSERLY..................................
#=GR A0A0F4R872_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C1G605_9SPHI/81-316              ................................KTASPGWYNSAAFEKEAHAA..GLYAKSINGDAFSKEIKAKTIELIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..E.T......Y.T...N...KTV......DF.........H...T...G...NVS.EVSI........EPA......T.......E.E.DIANTVAVMGGEDWAMWIDALKAENLLAEGATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFTIGDK..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGTIEQIQRLYADRLF..................................
#=GR A0A0C1G605_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A098QV08_9SPIO/82-317              ................................RPGTMGWYNTASYEQEAAKA..GLYAKSLNGDAFSNEMKQQVIQTIKDDL..G......DVDLVVYSLA.......S..P..VRT..DP.....Q.......S......G..D....VYRSVLK....PIG..S.A......F.S...A...KSI......NP.........Q...T...G...EIK.EFSI........EPA......S.......D.E.EVEQTVKVMGGEDWILWMSALKQAGVLAKGVRTVAYSYIGPEVT..RAVYRDGTIGKAKEHLERSAGEITQT..L.SD.IQGE...AYVSVNKALVTRASAVIPVVPLYLALLFKVMKEKGIHEGCIEQMDRLFRDRL-g.................................
#=GR A0A098QV08_9SPIO/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H7EIT3_9SPIO/86-322                  ................................KGGTPGWYNNKQFDKSAAAA..GLKSVTLNMDAFSDECRAEVVKIAKENG..M......KFDLVVYSLA.......S..P..VRT..DP.....D.......T......K..V....TYRSVIK....AIG..K.E......Y.K...G...AAL......DM.........M...T...G...ALS.EMVA........PIA......E.......G.S.DILNTIKVMGGEDWERWIDQLSEADVLADGCMTVAYSYIGPALS..HAIYRDGTIGTAKKDLEAHARTISRK..L.AEkYKGA...GYVSENKGLITRSSSVIPIIALYLGCLFKVQKAEGRHEGCIEQMERLFAERLY..................................
#=GR H7EIT3_9SPIO/86-322       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7BXT3_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKRETLDLIKADL..G......QVDLIIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...T...G...KVS.EVSI........EPC......S.......G.D.DIENTIAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSVT..EAVYRKGTIGRAKDHLEATAFEISDS..L.AD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGVHEGCIEQIQRLYQQRLF..................................
#=GR A0A1M7BXT3_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X1MSC7_9VIBR/82-317              ................................KPGTAGFYNAAAFDKLATEA..GLYSKSLNGDAFSHDAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...AII.EASV........EPA......T.......E.Q.EIADTVTVMGGEDWELWIDALAKADVLAPACKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAAALNEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A1X1MSC7_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5IW19_SHECO/82-317              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSLNGDAFSHEAKQKAIELIKQDL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...LII.ETSV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALADAGVLAPNCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAHALNDQ..L.ST.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREAGLHEGCQEQINRMFNERLF..................................
#=GR A0A1E5IW19_SHECO/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9T2M4_9VIBR/83-319                  ................................RTGSAGFYNNYYFKKAGEQE..NRIAINIHGDAFSKQLKEEVIEAIETYF.eG......EVDLVIYSLA.......S..G..VRP..NP.....N.......T......G..E....LWRSAIK....PIG..E.P......V.T...G...ATL......ML.........E...T...D...EWH.QTTL........PPA......T.......T.Q.EEESTLKVMGGEDWEDWINALINSESIAHGCKTIAFSYVGPECT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.YGGG...AYATVCKALVTKASVFIPALSPYIIALYKVMKEQGTHEGCIEQMQRLFATKLY..................................
#=GR F9T2M4_9VIBR/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R0E151_9GAMM/82-316              ................................KPGTAGWYNSAAFEKHAHAA..GLYARSVNGDAFSDEVKARVIEIIKADL..G......QVDQVVYSLA.......A..P..RRK..HP.....R.......T......G..E....IISSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VLT.ETTL........QPA......T.......D.E.EIAGTVQVMGGEDWQMWIDALLEAGVLAPGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDDKVKAIRGK..L.QG.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEEGTHEGCIEQLDTLYD----ily...............................
#=GR A0A0R0E151_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E7ZB55_9ALTE/82-317              ................................KTATAGWYNTAAFHQQAAQN..GLYAKTLNGDAFSDEMKAQVIEQIKTDL..G......SVDLVIYSLA.......S..P..RRT..DP.....V.......S......G..D....TFKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...KVH.DVTL........EPA......N.......D.E.EIHNTIKVMGGEDWERWMDFLGDAGVLAEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAIIGK..H.TD.KLVE...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIFGLYTECLY..................................
#=GR A0A1E7ZB55_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_SHELP/82-317                    ................................KPGTAGWYNSAAFDKFAKQG..GLYSKSLNCDAFSHEAKQKAIELIKQDL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.K...S...TAV......DT.........N...K...D...LII.ETSV........EPA......T.......E.Q.EIEDTVTVMGGQDWELWINALAEAGVLTPDCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAHALNDK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGLHEGCQEQINRMFHERLY..................................
#=GR FABV_SHELP/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_XYLFA/82-318                    ................................KPGTAGWYNAAAFDKSAKNA..GLYSRSINGDAFSDEMRAKVIEIIKSEM.gG......HVDLVVYSLA.......S..P..LRK..MP.....S.......T......G..E....IKRSVLK....PIG..V.A......H.I...S...NAI......DT.........N...K...D...QII.QATV........EPA......T.......E.Q.EIADTVAVMGGQDWELWINALTQADVLAPQTRTVAFSYIGTEIT..WPIYWHGALGKAKADLDATSRRLDAR..L.QA.LGGG...ANVAVLKSVVTQASAAIPALPLYIAIVFKVMKEKGLHEGTIEQADRLLRERLY..................................
#=GR FABV_XYLFA/82-318         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A257K3F2_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHAA..GLYAKSINGDAFSDDVKQQVIEMIKSDL..G......QVDLIIYSLA.......S..P..VRT..HP.....K.......T......G..V....THRSTLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...IVS.NVSI........EPA......N.......E.E.EIQNTVVVMGGEDWAMWIDDLKNAGLLADGAMTIAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KE.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A257K3F2_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A8FTI5_SHESH/82-317                  ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEAKQKAIDIIKADL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...LII.ATSV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWLAALSDAGVLADGCKTVAYSYIGTELT..WPIYWNGALGKAKMDLDRAAKALDEK..L.ST.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGLHEGCMEQINRMFAERLY..................................
#=GR A8FTI5_SHESH/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A173MKI5_9BACT/81-316              ................................KPGSPGWYNTAAFEAEAQSA..GLYAKSINGDAFSKEIKQKTIELIKADL..G......QIDLVIYSLA.......S..P..RRT..HP.....V.......T......G..V....VHNSVLK....PIG..E.T......F.R...N...KTV......DF.........H...T...G...VVS.EVSI........EPC......T.......E.E.DIANTIAVMGGEDWEMWMDELKAAGVLANGATTVAYSYIGPKLT..EPVYRKGTIGMAKDHLEKTAFVIDEK..L.KD.LNGH...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAKGLHEGCIEQMQRLFATRLF..................................
#=GR A0A173MKI5_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M9ZFM0_9ACTN/12-248              ................................RTATAGWYRTVATAAVARTA..GRDVVFLNGDAFSDGMKRQVGDLIEQRF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..A....TYASVLK....PIG..R.A......N.R...T...KTLv...fdDQ.........G...I...P...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRGLLGEGFATAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLNER..L.EKtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGED--LVPPVHQLAALW-----dql...............................
#=GR A0A0M9ZFM0_9ACTN/12-248   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D5LCI2_9BURK/82-317              ................................KPGTAGWYNSAAFHDEAAAR..GLYAASINGDAFSDAIKQKTIDAIKRDL..G......QVDLVVYSVA.......A..P..RRT..HP.....K.......T......G..V....TFQSTLK....PIG..H.A......V.R...L...RGV......DT.........D...N...E...AIK.ETLL........QPA......T.......P.D.EIAGTVAVMGGEDWQMWIDALDAAGVLADGAKTTAFTYLGEKVT..HDIYWNGSIGEAKKDLDRTVLALREK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGTHEGCIEQVDGLLRDSLY..................................
#=GR A0A0D5LCI2_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W1SQ07_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMSALDEAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAAIDAK..L.QE.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEKGLHEGTIEQLNRLFGERLY..................................
#=GR A0A0W1SQ07_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U1KWG5_9GAMM/82-317                  ................................KTASAGWYNTAAFQQAADEA..GLWSKNINGDAFSDEIKQKTIAAIKAEM..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....VFSSVLK....PIG..N.D......V.T...T...KNL......NT.........S...A...R...AIG.DITV........EAA......N.......E.D.EIANTVKVMGGEDWELWVDALKEADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKAS..T.AS.LKGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQINGLFRESLY..................................
#=GR U1KWG5_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A5YNZ9_9BACL/81-316              ................................RTASAGWYNSAAFEASAQEA..GLKSYSIVGDAFSDEIKTKTIDLIKSEL..G......QVDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PLG..G.V......Y.T...N...KTV......NF.........H...T...G...EVS.QATI........EPA......T.......E.D.ELRQTIAVMGGEDWEMWIDAMEQAGVLAEGATTVAYSYIGPEIT..HAVYREGTIGAAKNHLEATAKTLNDR..L.DS.KGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKIMKEKGLHEGCIEQMYRLFSERLY..................................
#=GR A0A1A5YNZ9_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W7TXF6_9GAMM/81-315              ..............................gl--GSAGWYNNIWFREAAEGE..GRVALNLIGDAFSDTLRQQAVTAIRERL..G......QVDLVVYSLA.......S..G..LRM..LP.....D.......-......G..S....QVRSVLK....STG..S.P......F.S...G...LGY......DL.........E...H...D...ALI.PQSL........DPA......S.......E.Q.EIRDTVSVMGGEDWQIWMQALAEAGCLAHGVQTVAYSYIGPEST..YPLYRDGTIGYAKEHLHASAEAINLQ..L.AG.MGGH...AWVAVCKALVTKASAFIPVLPVYLAVLMQVMKERGTHEGCIEQMMRLFAGKMY..................................
#=GR A0A0W7TXF6_9GAMM/81-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A285NN78_9PSED/94-330              ................................KAGTAGWYNSAAFDKFAKAD..GLYSKSINGDAFSDEARAKVIELIKSEM.gG......QVDLVIYSLA.......S..P..VRK..LP.....G.......S......G..E....VKRSVLK....PIG..Q.T......Y.T...S...TAI......DT.........N...K...D...TIV.QASI........EPA......T.......E.Q.EIEDTVTVMGGQDWQLWIDALNTAGVLAQGARTVAFSYIGTEIT..WPIYWHGALGKAKADLDATAQRLNSQ..L.QA.VGGG...AAVAVLKSVVTQASAAIPVMPLYISMVYKVMKEQKLHEGTIDQLNRLFRDRLY..................................
#=GR A0A285NN78_9PSED/94-330   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0E3UHQ3_9BACT/82-318              ................................KTATPGWYNTAAFTTAARAA..GLYAKNFNGDAFSDALKTDVLATIKRDL..G......QVDLIVYSLA.......S..P..RRT..HP.....K.......T......G..V....THKSTLK....PVG..Q.S......Y.S...N...QTV......DT.........D...K...G...IVS.TITI........EPA......N.......E.A.EIADTAAVMGGEDWELWINALDEAGLIAPGATSVAYSYIGPSLT..WPIYKNGTIGLAKNDLERAAKAINAT..L.KVnGYGR...AFISVNKALVTQASSAIPVVPLYISMLYKVMKAKGSHEGCIEQIDRLFRTQMY..................................
#=GR A0A0E3UHQ3_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M8MLL1_9FLAO/82-317              ................................KTASPGWYNSAAFETEAHAA..GLYAKSINGDAFSNEIKQQTIDLIKADL..G......QVDLVVYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSTLK....PIG..G.V......F.S...N...KTV......DF.........H...T...G...KVS.EVTI........QPA......V.......E.E.DIENTVVVMGGEDWAMWIDALKDAGVLAEGATTVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFEIADK..L.KD.INGH...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAKGLHEGTIEQIDRLYRQRLY..................................
#=GR A0A0M8MLL1_9FLAO/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M2XVI3_9SPHI/82-318              ................................KPGTAGWYNSAAFEKEAHEA..GLYAKSINGDAFSDEVKKQTIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PIQ..E.P......F.T...N...KTV......DF.........H...T...G...VIS.DITI........QPV.....eN.......E.E.DIANTVAVMGGEDWKFWIEDLKAAGVLAYGAKTVAYSYIGPELT..YPIYRNGTIGRAKDDLEGTVPAINAI..L.SD.INGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A0M2XVI3_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K2JTD2_9GAMM/82-317                  ................................KTGTAGFYNAVAFDKLATEA..GFYAKSINGDAFSNEVKQQTIDTIKADL..G......QVDLVVYSIA.......S..P..VRK..LP.....E.......T......G..E....LVRSTLK....PIG..K.P......Y.S...A...TAV......DT.........N...K...D...EII.SVDV........EPA......V.......D.Q.EIQDTITVMGGQDWELWIKALNDAGVLADGCKSIAYSYIGTEIT..WPIYWHGTIGKAKEDLDRAAAAIDAL..L.KG.TGGE...AHVAVLKSVVTQASSAIPVMPLYIAIVYKVMKEKGLHEGTMEHVFRLFSQQLY..................................
#=GR K2JTD2_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y2PCH6_9FLAO/81-316              ................................RPASPGFYNTAAFEEEAQKA..GLYAKSINGDAFSNEIKEEVVNLIKEDL..G......QVDLVIYSLA.......S..P..VRT..HP.....E.......S......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...KVS.EISI........KPA......E.......G.D.DVENTVTVMGGEDWRMWMDALKNANVLAEGVTTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTISED..L.EA.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKEKGIHEGCIEQIERLYSERLF..................................
#=GR A0A1Y2PCH6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6TAU3_9BACT/86-321              ................................KSGTPGWYNNMAFDQAAKAK..GLGCVTFNGDAFSDEMRRQVIEASK-QF..G......KIDLVIYSVA.......S..A..VRV..DP.....V.......T......G..E....KYRSVLK....PLS..K.T......F.S...G...ATM......DV.........V...T...G...KFS.IITA........EVA......N.......E.E.EKRQTVKVMGGEDWARWIQQLSEAGVLAEGVKTVAYSYIGPTYT..HAIYRDGTIGAAKKDIERTAREINEK..L.KQtLSGE...AYISVNKGLVTRSSAVIPLIPLYISILFKIMKRNGTHEGCIEQMERLFAERLY..................................
#=GR A0A1M6TAU3_9BACT/86-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8CJR9_9PSED/82-317              ................................KAGTAGWYNSAAFEKFAQAK..GLYARSINGDAFSDEVKQKTIETIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSVLK....PVG..K.T......V.N...F...RGL......DT.........D...K...E...VIK.ESVM........EPA......T.......P.E.EVANTVAVMGGEDWQMWIDALQEAGVLADGAKTTAFTYLGEEIT..HDLYWNGSIGAAKKDLDQKVLGIRQK..L.AA.SGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVDGLFRDSLY..................................
#=GR A0A1G8CJR9_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N0HDA7_THEVU/81-316              ................................RTATAGWYNTAAFEEAAREA..GLFAKSINGDAFSNEIKQQTIEMIKREW..G......KVDLVVYSLA.......A..P..KRV..HP.....E.......T......G..E....VFSSVLK....PIG..Q.T......F.S...N...KTV......DF.........H...T...E...EVS.HISI........EPA......T.......E.E.EIRHTIAVMGGEDWKMWIDALQEADVLNEGAKTVAYSYIGPVVT..HPVYREGTVGRAKNHLEATAHELDKQ..L.KK.IGGE...AYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGLHEGCIEQMYRLFNECLY..................................
#=GR A0A0N0HDA7_THEVU/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A7EI15_9GAMM/82-317              ................................KTGSAGWYNTAAFQAEAEAA..GLWSKNINGDAFSNELKEKTVATIKEEL..G......KVDLVIYSLA.......S..P..RRT..DP.....N.......T......G..E....TYSSVLK....PIG..N.S......V.T...T...KNL......NT.........S...K...R...IID.EVKV........EAA......N.......D.E.EIANTVKVMGGEDWEMWLDALQQADVLADGFKTSAYTYIGKELT..WPIYGHATIGKAKEDLDRAAAAIKEK..T.AS.LKGE...AYVSSLNAVVTQASSAIPIMPLYISGLFKVMKEDGTYEGTIEQIDGLFRENLY..................................
#=GR A0A0A7EI15_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A084A6L0_9GAMM/82-317              ................................KPATAGWYNSAAFDKAAKEA..GLYAKSVNGDAFSNECRAKVIELIKADL..G......QVDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......N.......E.E.EIQNTITVMGGQDWELWMSALEQAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAASAIRGN..L.AA.KKGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR A0A084A6L0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_CHRSD/85-320                    ................................KPGTAGWYNAAAFDKFAKAE..GLYSKAINGDAFSHEAREKAIELIKQDM..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSALK....PIG..E.T......Y.T...A...TAI......DT.........N...K...D...AIV.EASV........EPA......T.......E.E.EIADTVTVMGGEDWELWVDALDKAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGELDAR..L.GQ.HGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKVMKEQGLHEGTIDQLNRLYRERLY..................................
#=GR FABV_CHRSD/85-320         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A259R435_9GAMM/82-316              ................................KPGTAGWYNSAAFEKYAHQA..GLYARSVNGDAFSDEVKAKVIEIIKADL..G......QVDQVVYSLA.......S..P..RRK..HP.....K.......T......G..E....VISSTLK....PIG..E.P......I.T...L...RGL......DT.........D...K...E...VLT.ETTL........QPA......S.......A.E.EIAGTVQVMGGEDWQMWIDALLEAGVLAPGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDAKVKDIRAS..L.QG.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEEGTHEGCIEQLDTLYD----ily...............................
#=GR A0A259R435_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G8X5K2_FLACA/81-316                  ................................KTATPGWYNSAAFEQEAKKA..SLYAKSINGDAFSKEIKQKTIEMIKTDL..G......QVDLVVYSLA.......S..P..VRM..HP.....D.......T......G..V....LHRSVLK....PIG..Q.V......F.S...D...KTV......DF.........H...T...G...VVS.EVSI........QPA......V.......Q.E.DIDNTVVVMGGEDWTMWMDAMMDAGVLAEGATTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEIDEK..L.KN.INGR...AFVSVNKALVTQASSAIPVIPLYISLLYKTMKTKGIHEGCIEQMQRLFSECLY..................................
#=GR G8X5K2_FLACA/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0U4XA15_9GAMM/82-317              ................................KTGSAGWYNTAAFEAAANAE..GLWNKHLNGDAFTDEMKSQAISLIRAEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......T......G..E....IYSSVLK....PIN..H.A......Y.T...A...KTL......NT.........S...K...R...EIE.EVSV........EPA......N.......D.E.EIFNTVKVMGGEDWERWLDQLHAAGVLAENVQTVAYTYIGKELT..WPIYGKATIGRAKEDLDRAASAISSK..L.AG.QGGH...AYVASLKALVTQASSAIPIMPLYISLLYRVMKAEGTHEGCIEQIYGLFRQCLY..................................
#=GR A0A0U4XA15_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K6YLI8_9ALTE/82-317                  ................................KTGTAGWYNTAGFHAKASAV..GLYAKTLNGDAFSKELKQQVIDTLKADM..G......KVDLIIYSLA.......S..P..RRT..DP.....E.......T......G..E....VYKSTLK....PVG..Q.A......Y.K...T...KTY......DT.........D...K...N...LIH.EIAL........EPA......N.......D.D.EIQQTIKVMGGEDWELWLEALDQADLLADNCKTTAYTYVGKELT..WPIYGQATIGKAKEDLDRAAAAIVKT..K.AS.KNVQ...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHQGCIEQIYDLFTDKL-t.................................
#=GR K6YLI8_9ALTE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6L5Y3_9FLAO/81-316              ................................KTATPGWYNSAAFEVEAHNA..GLYAKSVNGDAFSKEVKEQVINMIKEDL..G......QIDLVIYSLA.......S..P..VRM..HP.....E.......T......G..V....LYRSTLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVS.QVSI........DPA......T.......E.E.DIANTVVVMGGEDWKMWMDALKNANVLAEGATTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEITDA..L.KD.INGK...GYVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGIHEGCIEQIQRLYADRLY..................................
#=GR A0A1M6L5Y3_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H6S6N4_9LACT/82-318              ...............................n-LGTAGWYNNIAFKEAAEKE..GLTAKNFVQDAFSHEIKQEVIEYIKNEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....N.......T......G..Q....TYTSSIK....AIG..D.S......V.V...G...PNI......NM.........Q...K...E...DYY.TETL........EPA......T.......E.Q.EIADTVKVMGGEDWELWMEALKEADVLSDGVLTTNYSYLGSELN..HPYYGNGTLGRAKADCDIKADAINGL..L.AD.INGK...AQIVVATAVTTKASSVIPFFPVYCVGLYKVMTEKGTHETPIMHMDRIYRDMIY..................................
#=GR A0A1H6S6N4_9LACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R2FQB0_9LACO/89-326              ..............................ml--GTAGWYNNIYFREEAEKK..GLKAKNFIGDCFTQSMKEQVIDYIKSDF.gG......KIDLLVYSVA.......A..P..KRT..NP.....N.......N.....pN..E....VWRSVLK....PVG..E.S......V.S...G...KTI......NL.........E...K...N...TLV.DQTI........EPA......S.......K.E.EVEATKHVMGGEDWELWVNQLKKAGVLANGFKTILFSYIGPKST..YAFYHEGTLGAAKDAAEKSSLKIQKS..I.DD.IQGE...ALISVSRAQTTKASVVIPIFPLYCLALYKVEEETGTHETPILHKDRLFRDMVY..................................
#=GR A0A0R2FQB0_9LACO/89-326   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A162P9V1_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHNA..GLYAKSINGDAFSNEIKKQTIDLIKADL..G......QVDLIIYSLA.......S..P..VRM..HP.....T.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...S...G...KVS.EISI........EPC......S.......G.D.DIENTVAVMGGADWSMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFAITDR..L.AS.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYQERLY..................................
#=GR A0A162P9V1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G0AJ16_9BACT/81-316              ................................KTASPGWYNSAAFEKEATKS..GLYAKSINGDAFSNEVKQQAIDLIKADM..G......QIDLVIYSLA.......S..P..VRM..HP.....G.......T......G..V....LHRSTLK....PIG..G.T......F.T...N...KTV......DF.........H...T...G...NVT.QVSI........EPA......N.......Q.E.DIDNTVVVMGGEDWSMWINALKDANVLAEGATTVAYSYIGPEVT..EAVYRKGTIGQAKDHLEATAFEISKD..L.AS.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLYQQRLY..................................
#=GR A0A1G0AJ16_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090R4J3_9VIBR/1-73                ...............................m--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...-...---.----........---......-.......-.-.--------------------------------------------..--------------DLDRAASALGEK..L.GE.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
A0A089IGU8_9BACL/81-316              ................................RTASAGWYNSAAFEELAEKA..GLQSYSVTGDAFSKETKDRTIQLIRSEL..G......QVDLVIYSVA.......S..A..RRT..DP.....V.......T......G..E....VYNSVIK....PIG..D.T......Y.T...N...KTV......NF.........H...T...G...EVS.QISI........EPA......T.......D.K.EIDDTIRVMGGDDWQLWIEALHQAGALADHATTIAFSYIGPEIT..QSVYRKGTIGRAKDHLELTAHTLNDE..L.SS.IDGR...AYVAVTKGLVTQSSSAIPVVPLYTSALYKVMKEKGLHEGCIEQTYRLFAERLY..................................
#=GR A0A089IGU8_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q4VPN3_9ACTN/87-322              ................................KAGTAGWYRTAATAELARDT..GREMHFLNGDAFSDAMKKQVCDLVEERF..G......RLDHLIYSVA.......A..P..RRT..DP.....E.......T......G..V....TYSSALK....PIG..E.T......T.R...M...KTL......VF.........D...E...EgtpEVR.TVVT........EPA......G.......G.D.DVEQTVAVMGGSDWERWVTCLADRGLLADGFTSAALSYIGSPLT..AGIYRRGTIGAAKAHLEQTARALDER..L.GElCGGR...AVTSVNGAAVTQSSTAIPGIALYTALLREVLGQD--MVSPVNQLAGLWD----ql................................
#=GR A0A1Q4VPN3_9ACTN/87-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G0JEN1_9GAMM/82-317              ................................KTASAGYYNTSAFHDAAAAA..GLYAHTINGDAFSGECKTQVIDLLRNGI..G......KVDLVVYSLA.......A..P..RRT..DP.....V.......T......G..E....LHSSVLK....PIG..A.A......Y.T...A...KNL......NT.........D...T...L...KIS.DITV........EPA......T.......D.A.EIAATVKVMGGEDWELWIKALREADLLSEGCQTVAYTYLGDKLT..WPIYGHATIGKAKEDLDRAADAISAS..L.QG.VGGK...ARVAVLKALVTQASSAIPVMPLYLSILIKVMKEDGSNEGCIEQIQRLFTECLY..................................
#=GR A0A1G0JEN1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N0NG46_9ACTN/90-326              ................................RTGTAGWYRTAATADIARAA..GRDLVLLNGDAFSDAMKDQVADIIEQRF.gG......RLDHLVYSVA.......A..P..RRT..DP.....D.......T......G..S....TYASVLK....PIG..G.A......H.R...T...KTL......VF.........D...D...EgvpEVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIGHLAGRGLLADGFSTAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLDER..L.AKtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGDG-------------------lvppvhqladlwdql...................
#=GR A0A0N0NG46_9ACTN/90-326   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y5EKJ3_9GAMM/82-317              ................................KTGSAGWYNTAAFDAEAKQA..GLYAKHVNGDAFSNEAKEKTIELIKEDL..G......QVDLVIYSLA.......S..P..VRK..VP.....G.......T......D..T....LVRSCLK....PIG..E.T......Y.T...S...TAI......DT.........N...K...D...RII.EASV........EPA......T.......E.E.EIVDTVTVMGGQDWELWMSALADAGVLAKGCQSVAYSYIGTAIT..WPIYWDGALGKAKMDLDRAANTIDAD..L.KA.NNGS...ANVAVLKSVVTQASSAIPVMPLYISMAFKVMKEENVHEGCIEQINRLFRTQLF..................................
#=GR A0A1Y5EKJ3_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A250B8A0_9ENTR/82-317              ................................KPATAGWYNSAAFDKAAKEA..GLYAKSVNGDAFSNECREKVIELIKADL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.SASV........EPA......T.......E.E.EIQNTITVMGGQDWELWMSALEQAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.SA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCIEQVDRLMRTRLY..................................
#=GR A0A250B8A0_9ENTR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I7C867_9GAMM/88-323              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIQQDM..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......E.Q.EIEDTRAVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAASEIGQR..L.AA.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRVMKEKGLHEGTIDQLNRLFGERLY..................................
#=GR A0A1I7C867_9GAMM/88-323   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S6GE70_9GAMM/82-317                  ................................KSGTAGWHNSAAFTAEAEKA..GLYAKSLNGDAFSHQAKQKTIDLIKADL..A......QVDLVIYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSTLK....PIG..D.S......Y.K...S...TAI......NT.........N...K...D...TLF.EAAV........EPA......T.......E.Q.EIADTVTVMGGDDWQLWIDALSDAGVLADGCKTVAYSYMGSDIT..WPIYWHGTIGRAKQHVDQIAAVLNTK..M.QA.IGGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMKESNVHEGCMEQIDRLFRTGLY..................................
#=GR S6GE70_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W7Q346_9GAMM/83-318                  ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEARETAIELIKQDM..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...VII.EAEV........EPA......T.......E.Q.EIEDTRAVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDSK..L.KA.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEKGLHEGTIDQLNRLFGEQLY..................................
#=GR W7Q346_9GAMM/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A2YDH6_9BACT/82-317              ................................RCGTAGWYNSAAFEKEAAAA..GLFARSFNGDAFSDAMKAEVCAAIKADF..G......QVDCIIYSLA.......S..P..RRT..DP.....K.......T......G..E....VYKSVLK....SIG..E.S......Y.T...N...KNL......NT.........G...N...G...VVD.EVTI........QPA......E.......G.D.DIKNTVAVMGGEDWEMWIDALLAENLIAPGTQTVAYSYIGPEIT..WPIYKNGTIGAAKEDCERVQRALDAK..L.SD.LGGK...AWVSVNKALVTQASSAIPVVPLYISLLYKVMKAEGTHEDTIEQMDRLLRDRLY..................................
#=GR A0A2A2YDH6_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q4V8Z5_9ACTN/84-321              ................................RTGTAGWYRTAATAQLARQH..GRDMVFLNGDAFSDAMKEQVAGLLAERF.gG......RLDFLVYSVA.......A..P..RRT..DP.....D.......T......G..D....VYASVLK....PVG..S.P......H.A...T...KTL......VF.........D...E...HgvpEVK.EVTI........APA......E.......G.D.DIEQTVAVMGGTDWERWVTFLADRSLLADGFTTAALSYIGSPLT..AAIYRQGTIGTAKGHLEATARTLDEL..L.GKsLGGR...AVTSVNAAAVTQSSTAIPGIALYVGLLRGVLGSA--MVAPIHQLVELWDQ---lt................................
#=GR A0A1Q4V8Z5_9ACTN/84-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A066UZT9_9VIBR/82-317              ................................KPGTAGYYNSAAFDKLAKEE..GLYSKSLNGDAFSNEAKQKTIDLIKEDL..G......QVDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...TII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAAAALNEK..L.GQ.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A066UZT9_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4RWY2_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QIDLVIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DITNTVAVMGGEDWSMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFSITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A0Q4RWY2_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1JAN1_9GAMM/83-145              ...............................g-TGAAGYYNNLFFKKYAEQE..GRIAVNIQGDAFSRQIQEEVVEAIETYF.eG......EADLIIYSVA.......S..G..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...-...---.----........---......-.......-.-.--------------------------------------------..--------------------------..-.--.----...-----------------------------------------------------v.................................
A0A0S2KGV5_9GAMM/82-318              ................................KPGTAGWYNSWAFEQQAKDA..GLYARSINGDAFSNEVREQAIDIIKQDL..G......EVDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VKRSVLK....PIG..E.V......Y.Q...S...TAI......DT.........N...K...N...QII.HAEV........EPA......T.......E.Q.EIADTIDVMGGQDWELWMQALDKAGVLAPGARTVAFSYIGTEMT..WPIYWHGALGKAKEDLDRAAHALDKL..L.AQkYQGG...ANVAVLKSVVTQASAAIPVMPLYIALVYKVMKEKGLHEGTIEQLNRLFSEQLY..................................
#=GR A0A0S2KGV5_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E6WW19_PSEUU/82-317                  ................................KPGNPGWYNSAEFDRQAKAA..GLWSRSINGDAFSDEVRAKAIELIGEMG..G......PIDLVVYSLA.......S..P..VRR..LP.....D.......T......G..E....LKRSALK....PIG..Q.A......Y.K...A...TAV......DT.........N...R...D...QVI.EATV........EPA......T.......E.Q.EIADTIRVMGGEDWELWIDALSKAGVLAPDAKTVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAHAIDAK..L.KP.TGGS...ANVAVLKSVVTQASAAIPVMPLYIAIVYRIMKEKGLHEGPIEQLERTFREHLY..................................
#=GR E6WW19_PSEUU/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5Y8T9_9GAMM/82-317              ................................KPGTAGWYNAHAFDKAAHEA..GLYAKSINGDAFSHEAKQKAIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSSLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...TLF.EASI........EPA......T.......E.Q.EVQDTVTVMGGQDWELWIQALAEAGVLAQGCRTVAYSYIGTEIT..WPIYWHGALGEAKKDLDRAAKALDSQ..L.QS.LGGG...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCIEQICRMLTERLY..................................
#=GR A0A1M5Y8T9_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2D1U4E3_9SPHI/81-317              ................................KTASPGWYNSAAFEDQAQKA..GLYAKSVNGDAFSTEIKQKVIDLIKADL..G......QIDLVVYSLA.......S..P..KRV..HP.....I.......T......G..V....THNSVLK....PIG..EnT......F.T...N...KTV......DF.........H...T...G...VVS.EVSI........APA......N.......E.E.EIENTVAVMGGEDWGMWIDELKAANLLAPEAITVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFAISDK..L.KD.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGTHEGCIEQMQRLFADRLY..................................
#=GR A0A2D1U4E3_9SPHI/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090RM62_9VIBR/1-162               ...............................m--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-----IK....PIG..Q.S......V.E...G...AIV......SL.........E...T...D...QWQ.PQTL........EAA......S.......E.Q.EAADTIKVMGGEDWESWIDTLINAESIADGCQTIAFSYVGSELT..HPIYLDGTLGQAKIDLHQTSHSLNLK..L.AN.FNGH...AYATVCKALVTKASVFIPAFTPYILALYKVMKEKGTHEGCIEQMHRLFTEQLF..................................
#=GR A0A090RM62_9VIBR/1-162    pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2D8RDP0_9GAMM/82-319              ................................RCGSAGWYNNMAAEALLKSErpDQQIHTVNADAFSQETKDQVIELATEKY..G......KFDLVIYSLA.......A..P..RRK..DP.....V.......T......G..E....IWQSVLK....PIG..E.P......F.E...G...ITL......DT.........D...N...E...VLK.SVSI........EPA......T.......D.D.EIEHTVKVMGGEDWADWMSQLHAADLLAVGCETVAYHYVGRELT..WPIYGQATIGRAKAHLEETAHEISRQ..L.KD.IDAK...AFIGVLKAVVTQSSSAIPIMPLYIAILYDVMKEEGTHETAMDQILRFFSTQL-l.................................
#=GR A0A2D8RDP0_9GAMM/82-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H2J1K0_RAHAC/82-317                  ................................KTATAGWYNSAAFEEFADAK..GLYAKSINGDAFSDEVKQKTIELIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..K.Q......V.T...I...RGI......NT.........D...K...E...TIN.ETTL........EPA......T.......P.E.EIAGTVAVMGGEDWQMWIDDLKAAGVLAEGAKTTAFTYLGEEVT..QDIYWNGSIGEAKKDLDKRVLDIRST..L.AE.QGGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR H2J1K0_RAHAC/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S8CQ55_9GAMM/82-317              ................................KPATAGWYNSAAFDKIAKEE..GLYAKSINGDAFSNECRAKVIELIKADL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......T.......E.E.EIQNTITVMGGQDWELWMSALEEAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVYRLMRTRLY..................................
#=GR A0A1S8CQ55_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A246FYX5_9PSED/82-316              ................................KLSSAGWYNSAAFEKFALEK..GLYAKSINGDAFSDEIKRLTIETIKKDL..G......KIDLVVYSLA.......A..P..RRT..DP.....Q.......-......G..V....VHTSTLK....PIG..K.A......V.T...L...RGI......NT.........D...K...G...VVV.DTTL........EPA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALRDADVLAEGAKTTAFTYLGEKLT..QDIYWNGSIGEAKKDLDKKVLTLRDN..L.AA.LKGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A246FYX5_9PSED/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
V9G7M8_9BACL/81-316                  ................................RTASAGWYNSVAFEKAADAA..GLKSFSVTGDAFTQETKAKTVELIRQEL..G......QVDLVVYSVA.......S..A..RRT..LP.....D.......T......G..E....TVNSVLK....PIG..P.A......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.A.EVKNTVEVMGGDDWELWMNELAVGGVLTENVTTIAFSYIGSEIT..KAIYRDGSIGQAKDHLEATALKLNGK..F.AA.GGGR...AFVTVSKALVTQSSSAIPVVPLYVSALYKVMKEKGLHEGCIEQIYRLFADRLY..................................
#=GR V9G7M8_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C1EW28_9FLAO/81-316              ................................KTASPGWYNSAAFENEAHKA..GLYAKSINGDAFSNEIKKQTLDLIKADL..G......QIDLIIYSLA.......S..P..VRV..HP.....V.......T......G..V....MHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...S...G...KVS.EISI........EPC......S.......G.D.DIENTIAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFAITDS..L.AD.IDGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYQERLY..................................
#=GR A0A0C1EW28_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N7JWN6_9GAMM/82-317              ................................KTGTAGWYNSAAFEQMAHEA..GLYAKSINGDAFSHEAKQKAIELIKADL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSVLK....PIG..Q.P......Y.R...S...TAI......DT.........N...K...D...VII.NAEI........EPA......T.......E.E.EVANTVTVMGGEDWELWIHALKDAGVLADECKTVAYSYIGTEIT..WPIYWDGALGKAKQDLDRAAGELNTL..L.SA.TGGQ...ANVGVLKSVVTQASSAIPVMPLYLSMVFKIMKEKGIHEGCLDQVDRLFRTGLY..................................
#=GR A0A1N7JWN6_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q4YCC6_9ACTN/96-332              ................................RTGTAGWYRTAATAQLARSH..GRDMVFLNGDAFSDAMKDQVADLLKQRF.dG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..V....TYASVLK....SIG..E.A......H.R...T...KTL......VF.........DgdgA...P...EVR.EVES........PPA......E.......G.D.DIARTTAVMGGADWERWIDHLAARGLLAEGFTTVALSYIGSALT..AGIYRQGTIGVAKAHLEQTARTLDER..L.AElVGGR...AVTSVNGAAVTQSSTAIPGIALYLGLLRGTLGDA-------------------lvppiaqltdlwdrl...................
#=GR A0A1Q4YCC6_9ACTN/96-332   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0X1T6R8_PSEAA/82-317              ................................KLGTAGWYNSAAFHKFADAD..GLYAKSINGDAFSDEVKRLTIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..DP.....K.......T......G..E....VYSSTLK....PIG..Q.S......I.T...Q...RGL......NT.........D...K...E...EVN.VTTL........AQA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALDEAGVLADGAKTTAFTYLGEKLT..HDIYWNGSIGAAKKDLDQKVLKIRER..L.AP.KGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGVHEGCIEQVYGLYKDSLY..................................
#=GR A0A0X1T6R8_PSEAA/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A268SF77_9BACL/81-316              ................................RTASAGWYNSAAFEKAAEEA..GLKSYSITGDAFANETREKAVELIRSEF..G......QVDLVVYSVA.......S..A..RRT..DP.....N.......T......G..E....VSNSVLK....PIG..Q.S......Y.T...N...KTV......NF.........H...T...G...EIT.SVTL........EPA......T.......E.E.EIRQTVTVMGGEDWELWMDALQQGGVLADDATTIAFSYIGPQLT..QAIYREGSIGQAKDHLEATAHKLNDR..M.SA.TGGR...AYVTVAKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQLQRLFADRLY..................................
#=GR A0A268SF77_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A241R4N7_9GAMM/82-317              ................................KTATAGWYNTAAFHQEAEKE..GLKFHSINGDAFSDEIKQESIEYIKDNM..G......KIDLVVYSLA.......S..P..KRK..DP.....D.......S......G..E....LYSSVLK....PIG..K.Q......Y.T...T...KTY......NT.........D...K...D...QVH.EVTL........DPA......T.......D.D.DIANTVKVMGGEDWERWIKALHDAGLLANDCQTTAYTYIGKKLT..WPIYGHATIGRAKEDLDRASSALDDT..Y.KD.VNLK...AYVSSLKALVTQASSAIPVMPLYISLIYGVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR A0A241R4N7_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H1G6K7_9GAMM/82-317                  ................................KPGTAGWYNSAAFHKFAEAE..GLYAKSINGDAFSDEIKAKTLETIRQDL..G......QVDLVVYSVA.......A..P..RRT..HP.....R.......T......G..E....TFNSTLK....PID..K.T......V.T...Q...RGL......DT.........D...K...E...VVK.NFTI........EPA......S.......Q.E.EIDSTVAVMGGEDWQMWIDALDAAGLLAEGAQTTAFTYLGEKVT..HDIYWNGTIGAAKKDLDRRVLDLRRQ..L.AA.RGGD...ARVTVLKAVVTQASAAIPVMPLYLALLFRVMKEKGTHEGVIEQIDTLFRESLY..................................
#=GR H1G6K7_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E8LQN9_9VIBR/82-317                  ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..D.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAAAALNDK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR E8LQN9_9VIBR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5CWK1_9VIBR/82-317              ................................KPGTAGYYNSAAFEKCAHEE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...QII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWMNALSDAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.SS.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A1E5CWK1_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V4J0V2_9CLOT/82-318              ................................RTGTAGWYNNIFFKEFAEKE..GLIAKNFIGDAFSYEVKANVIDYIKKEF..G......KIDLLIYSLA.......A..P..RRK..DP.....K.......T......G..K....IYDSTLK....TTS..E.A......F.S...G...PTI......DI.........E...K...D...ELI.TTKI........NLA......T.......E.E.EIEATKKVMGGEDWKDWCELLLQNDCLSDKAITIAYSYIGSPRT..YKIYKEGTIGGAKRHLENSALEIDKE..W.KNkINGK...AFVSVNKALVTKASAFIPSFSLYAAILYKVMKEKGLHENCIMQTQRMFNEKVY..................................
#=GR A0A1V4J0V2_9CLOT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8TWU8_9FLAO/81-316              ................................RPGSPGYYNTAAFEKHAHKA..GLYAKSINGDAFSNEIKQEVVNLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....N.......T......G..K....RYKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...VVS.EISI........NPA......E.......G.D.DIENTVTVMGGEDWKMWIDALKAENLLAEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFEITDD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKDKEIHEGCIEQIQRLYSERLF..................................
#=GR A0A1B8TWU8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A084CMY4_9GAMM/82-316              ................................KTGTAGFYNAVAFEKLAHER..GLYSKSLNGDAFSNQAKEKTINLIKRDL..G......QIDMVIYSLA.......A..P..VRR..LP.....Q.......T......G..E....LLRSVLK....PIG..K.T......Y.T...S...IAL......DT.........S...R...D...LIT.KASV........DPA......T.......E.K.EIRDTVRVMGGEDWQLWINALFQSGVLSEGCRTLAYSYVGTELT..WPIYWHGTLGKAKIDLENTGLALNEK..L.SA.IGGS...ANVAVLKSVITQASSAIPMMPLYISILFKKMREEGVHEGCVEHIYRMFSQ-L-y.................................
#=GR A0A084CMY4_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z9TA75_9PROT/83-319              ................................KTASAGWYNNKAFEAYAAKD..GLYAKTINGDAFSDEIRLQTIETIKKEL..X......PIDLVVYSLA.......S..P..XRL..HP.....R.......T......E..I....LHRSSIK....PLG.gR.A......L.X...M...XSV......XV.........D...K...G...EVT.QVSL........EPA......S.......E.Q.EVADTVAVMGGEDWEYWIEALKXEGLLASGCQTTAFTYIGSELT..WPIYWDGTLGKAKMDLDRAQRAISES..L.GX.XGGS...ARVAVLKAIVXQASAAIPVVPLYVALLFKVMKEQNNHEDCISHICRLFSTQL-k.................................
#=GR A0A1Z9TA75_9PROT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8Q8W9_9VIBR/82-238              ................................KPGTAGFYNAAAFDKLAQEE..GLYAKSLNGDAFSNEAKQKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...EII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWMDALSEAGVLAEGCKTVAYSYIGTELT..WPIYW---------------------..-.--.----...-----------------------------------------------------tv................................
#=GR A0A0B8Q8W9_9VIBR/82-238   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A4C6S2_9GAMM/82-317                  ................................KTGSAGWYNSAAFHHEAEQQ..GLWAKSINGDAFSNEIKEKTIATIKAEM..G......KVDLIIYSLA.......S..P..RRT..DP.....T.......S......G..E....VFSSTLK....PIG..Q.S......V.T...T...KNL......NT.........S...K...R...VID.SITV........EAA......N.......E.D.EIANTVKVMGGEDWELWLNALKDADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAVVAIKQA..T.AH.LKGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIYGLFAENLF..................................
#=GR A4C6S2_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A081N8G6_9GAMM/82-317              ................................KPGTAGWYNSAAFEKAAHEA..GLYAKSINGDAFSHAAKQTVVDLIKEDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSSLK....PMG..Q.T......Y.T...A...TAV......DT.........N...K...D...VLF.EASV........EPA......T.......E.Q.EVKDTVTVMGGEDWELWMSALSEAGVLAEGCRTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAANALNDK..L.AA.INGG...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCIEQVWRMMSDRLY..................................
#=GR A0A081N8G6_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6YV40_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLVIYSLA.......S..P..VRQ..HP.....A.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVS.EVSI........APA......N.......D.E.DIANTVAVMGGEDWTMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFSITDN..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEQGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A1M6YV40_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I2JPG1_9GAMM/82-317                  ................................KPGTAGWYNSAAFHKFAEAE..GLYAKSINGDAFSDEIKEKTIAQIKADL..G......QIDLVVYSLA.......S..P..RRQ..HP.....K.......T......G..V....VHNSTLK....PIG..K.D......V.T...Q...RGV......NT.........D...K...E...TIE.NFTL........TAA......S.......D.E.EINNTVAVMGGEDWQMWIDALDDAGVLADGAKTTAYTYLGDRLT..WDIYWHGTIGAAKKDLDKRVINIRER..L.AA.KGGD...ARVSVLKAVVTQASSAIPVMPLYLALLFKVMKSDGSHEGCIEQVYGLFKNSLY..................................
#=GR I2JPG1_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H8XUN1_FLAIG/81-316                  ................................KTATPGWYNTAAFEIEAEKA..GLYAKSINGDAFSDEIKQQTIDLIKKDL..G......QVDLVIYSLA.......S..P..VRM..HP.....K.......T......G..V....LHRSTLK....PIG..A.K......F.T...N...KTV......DF.........H...T...G...VVS.DVSI........EPA......T.......Q.E.DIDNTVVVMGGEDWSMWMEAMKNAGVLAEGAMTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEITND..L.KE.INGK...AYVSVNKALVTQASSAIPVVPLYMSLLFKIMKKDNSHEGCIEQMERLFSDRLF..................................
#=GR H8XUN1_FLAIG/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M2NI98_9FIRM/81-313              ................................RTATPGWYNTAAFEEYAHAD..GLYAKTINGDAFSQEVKQQVIDLIKKDL..G......QVDMVVYSLA.......S..P..RRT..MA.....D.......-......G..T....TCSSVLK....TTD..G.E......Y.T...N...KTI......DL.........A...A...R...TVS.EVTV........PPA......T.......Q.E.EIRDTVKVMGGEDWKDWITALSGAGVLAEHTVTMAYSYLGPELT..HPMYRNGSIGRAKEHLFATSKEITQE..F.--.PGVT...AYISVNKGLVTQASAAIPIVPLYMSILYKVMKEKGIHEGCIEQMYRLFHDKL-l.................................
#=GR A0A0M2NI98_9FIRM/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G4YQC5_9BURK/82-317              ................................KPASPGWYNTAAFHKAATAE..GRYAKSINGDGFSDAVKQQTIDTIRADL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSTLK....PIG..K.A......V.N...L...RGL......DT.........D...N...E...VVK.DSVL........QPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDQKVLGLRQT..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKAEGTHEGCIEQVHGLYAESLY..................................
#=GR A0A1G4YQC5_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0KLI7_AERHH/82-317                  ................................KTATAGWYNSAAFDKAAKEA..GLYAKSINGDAFSNECRAKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......N.......E.E.EIQNTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAAAAIRGD..L.AG.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR A0KLI7_AERHH/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A095XFJ6_9BURK/82-317              ................................KPGTAGWYNTAAFHEQAQAE..GLYAKSINGDAFSDEIKRKTIEAIKRDL..G......QVDQVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..A.A......V.S...L...RGL......DT.........D...R...E...VVK.ESVL........EPA......T.......Q.A.EIDATVAVMGGEDWQMWIDALLEAGVLAEGATTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLDIRAK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKIMKEQGTHEGCIEQVYGLYRDSI-c.................................
#=GR A0A095XFJ6_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q4W6M6_9ACTN/84-318              ................................RTATAGWYRTAATSALAEGS..GGDVTFVNADAYADATRAEVLKLLAERY..G......PVDHLVYSLA.......S..P..RRT..DP.....A.......T......G..E....VHHSVIK....PIG..S.P......Y.T...S...PSLl....fDD.........G...A...P...QVG.TVDL........APA......D.......E.A.ERAATVKVMGGEDWGLWVRALAEADLLAPGFTTVALSYVGSEIT..APVYRQGTIGAAKEHLEATARELQTG..V.LA.DRGR...AFTVVAGAAVTQASTAIPSIALYTSLLRNVLGEDGWRT---------------tddqavdlweql......................
#=GR A0A1Q4W6M6_9ACTN/84-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_FLAJ1/81-316                    ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEIKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVS.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWIDALKNENLLAEGATTIAYSYIGPELT..EAVYRKGTIGRAKDHLEATAFTITDT..L.KS.LGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR FABV_FLAJ1/81-316         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A139SI75_9BACT/82-317              ................................RPATPGWYNTIAFTKAARAD..GLYARNIMGDAFSDEIKAQTIDAIKADL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..A....VHKSCLK....PLG..A.P......Y.T...N...KTV......DT.........D...K...G...IVS.SITI........EPA......D.......E.A.EVADTVAVMGGEDWELWIDALRAAGVLAPGAQSLAYSYIGPEVT..WPIYQNGTIGMAKNDLSRAAKAIDAK..L.SP.SGGR...AFISVNKALVTQASSAIPVVPLYISILYKVMKAAGLHEGCIEQMHRLFATQVY..................................
#=GR A0A139SI75_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F2JXC0_MARM1/82-317                  ................................KSGTAGWYNAAAFDKFAKEE..GLYSKSINGDAFSNEAREKVIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSVLK....PIG..E.T......Y.R...S...TAI......DT.........N...R...D...VII.DAEI........EPA......T.......E.E.EVAATTTVMGGQDWELWMSALQEAGVLADGVRTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRAAHEIDSK..L.VS.LSGG...ANVAVLKSVVTQASSAIPVMPLYLAMVFKVMREKGLHEGCMEQVYRLFAERLY..................................
#=GR F2JXC0_MARM1/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5C7K4_9FIRM/81-312                  ................................RTATAGWYNTAAFEKFATQD..GLYAKSINGDAFSAEVKKQAIDTIRRDL..G......QVDLVVYSLA.......A..P..RRS..AD.....-.......-......G..V....TYSSTLK....TVG..S.P......F.T...E...KSI......DL.........R...T...N...EIV.TKSV........EPA......T.......D.K.EIEGTIKVMGGEDWEDWIKVLQKAGVLAENAKTVAYSYIGPELT..YPIYTHGTIGQAKNHLQKTAEKMNQE..L.--.NGVT...AVVSVNKALVTQASSAIPIVPLYLSILYKIMKEQGSHEDCIRQMDRLFRTKL-l.................................
#=GR R5C7K4_9FIRM/81-312       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H1LWM9_9FLAO/81-316              ................................RPASPGWYNSAAFENQAHKD..GLYAKSINGDAFSNEIKDQTLKLIKEDL..G......EIDMLVYSLA.......S..P..VRT..HP.....N.......T......G..K....RYKSVLK....PIG..D.T......F.T...N...NTV......DF.........H...T...G...EVK.EISI........EPC......S.......G.D.DIDNTIAVMGGEDWQMWIDLLKSENVLSKDFKTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFKITES..L.KD.INGK...GYVSVNKALVTQASSAIPVIPLYISLLYKVMKEKGIHEGCIEQIERLFNERLY..................................
#=GR A0A1H1LWM9_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I3P1R6_9BACL/81-316              ................................RTASAGWYNSAAFERAAQAA..GLKSFSVTGDAFSAETKAKAVEVIRREL..G......QVDLVVYSVA.......S..A..RRT..DP.....E.......T......G..E....TYNSVLK....PLG..G.A......Y.T...N...KTV......NF.........H...T...G...EVS.MVTL........EPG......T.......E.Q.DVKETVAVMGGDDWQLWIDALRAGGVLADNATTISYSYIGSRIT..QPIYREGTIGQAKDHLEATAKHLNGQ..L.GE.TGGR...AFVTVSKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQTYRLFAERLY..................................
#=GR A0A1I3P1R6_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y5K6M3_9GAMM/82-317              ................................KTGSAGWYNTAAFQNAADEA..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDLVIYSLA.......S..P..RRT..DP.....N.......T......G..E....TYSSTLK....PIG..D.A......V.T...T...KNL......NT.........S...K...R...EID.EITV........EAA......S.......Q.D.DIDNTIKVMGGEDWEMWIDALKEADVLADNFKTSAYTYIGKELT..WPIYGHATIGKAKEDLDRATVAIKES..T.KA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHSLFTENLY..................................
#=GR A0A1Y5K6M3_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_XANAC/82-318                    ................................KAGTAGWYNSAAFDKHAKAA..GLYSKSINGDAFSDAAREKVIELIKTEM.gG......QVDLMVYSLA.......S..P..VRK..LP.....G.......S......G..E....VKRSALK....PIG..Q.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......S.......A.Q.EIEDTVTVMGGQDWELWIDALEGAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLNAR..L.AR.RGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR FABV_XANAC/82-318         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E6U895_ETHHY/81-314                  ................................RTATAGWYNTAAFESFAGRD..GLYAKTVMGDAFSDAVKEQIIDLIRSDL..G......KVDLVVYSLA.......A..P..RRA..VG.....D.......-......-..V....TYNSVLK....PVG..Q.P......F.T...S...KSL......DV.........A...K...M...EVD.TVTI........EPA......T.......Q.E.EIDGTVKVMGGEDWRWWIDALREADVLAKDATTIAYSYIGPELT..YPVYHDGTVGLAKRDLAEAAKAIDAE..L.RA.GGGH...AYVSVNKALVTQASAAIPVVPLYISILFKIMKEQGTHEGCMEQMYRLLARKLY..................................
#=GR E6U895_ETHHY/81-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A9G5U8_9VIBR/83-319              ...............................g-VGSAGWYNNIFFKQEANHA..GRTAINIVGDAFSDTVRNQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KP.....D.......S......D..A....FWRSVIK....PID..E.P......I.T...G...ASI......ML.........E...N...D...QWV.ETTL........NPA......T.......E.E.EAEATIKVMGGEDWESWIDTLINTESLAQGCKTIAFSYMGPDVT..HPIYLDGTLGRAKIDLHQTSHALNLK..L.AN.FDGG...AYATVCKALVTKASVFIPALTPYLLALYQVMKEKGTHERCIEQMQRLFTTKLY..................................
#=GR A0A2A9G5U8_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M4VNG1_9CLOT/81-313              ................................RTATPGWYNTAAFEKAAKNE..GLYARSVNGDAFSKEIKEKTIDIIRKDL..G......KVDMVIYSLA.......A..P..RRT..TL.....D.......-......G..T....VYSSVLR....TTG..R.P......F.T...N...KSL......DL.........R...N...N...TIG.EKTV........EPA......T.......P.E.EMEGTIKVMGGEDWKDWIEALTRADVMEKGAVTVAYSYIGPALT..YPMYSDGTIGQAKKHLMHTAVELNRE..Y.--.PGVS...AYISVNKALVTQASSAIPIVPLYFAILYKVMKEQGNHEGCIQQITRLFHDKL-l.................................
#=GR A0A1M4VNG1_9CLOT/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0T1Q407_9ACTN/86-322              ................................RTGTAGWYRTAATARLAREH..GRDMVFLNGDAFGDAVKEEVAELLTERF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..E....VYASVLK....PVG..S.P......Y.T...T...KTLv...fdES.........G...A...P...EVT.EVTT........EPA......E.......G.D.DIEQTVAVMGGTDWERWITFLADRSLLADGFTTAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLDER..L.GKtVGGR...AVTSVNAAAVTQSSTAIPGIALYVGLLRGVLGEG--MVAPIGQLVELWD----ql................................
#=GR A0A0T1Q407_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A024FLR0_9FLAO/81-316              ................................RTASPGWYNSAAFEKQAHKD..GLYAKSINGDAFSNEVKAQTLQLIKDDL..G......QIDVLIYSLA.......S..P..VRT..HP.....D.......S......G..E....RFKSVLK....PIG..G.T......F.T...D...NTV......DF.........H...T...G...EVK.EISI........EPS......S.......G.D.DIKNTVAVMGGEDWKMWIDQLNAAGVLSKDFKTVAYSYIGPSLT..EAVYRKGTIGAAKDDLEATAFKITDT..L.KN.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIERLFSERL-n.................................
#=GR A0A024FLR0_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R1GYB5_9LACO/89-325              ...............................l--GAAGWWNQVYFKQAAERA..GLVAQNFNANVFLNSTKQLVIDYVRQRL.dG......PIDLLVYSIA.......A..P..KRI..NP.....E.......N.....pD..E....VWRSVIK....PIG..A.P......V.T...D...FSV......DL.........E...R...E...ELV.KQTI........TPA......T.......P.E.EIAATTHVMGGEDWELWVTALRSAGVLAPNCKTILFSYEGPTAT..AAIYHDGTLGQAKRAAEASARRLQAK..L.GP.TGGE...ALISVNRSATTKAAAVIPGFSRYCLALLQAEQVTGTHETTVEHQDRLFRDMVY..................................
#=GR A0A0R1GYB5_9LACO/89-325   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X1QH81_9GAMM/82-317              ................................KTGTAGWYNMASFDALTKKA..GLYAKHVNGDAFSHEAKGKTIELIKEEM..K......QVDLVIYSLA.......S..P..VRK..LP.....D.......T......G..E....LIRSCLK....PIG..E.T......Y.R...S...TAI......DT.........N...K...D...VIF.EAEV........EPA......T.......E.Q.EIKDTTTVMGGEDWELWMNALAKANVLAEGCQSIAFSYIGTSIT..WPIYWDGALGKAKMDLDRAAKAIDGQ..L.KS.LGGR...ANVAVLKSVVTQASSAIPVMPLYISMVFKVMKQEGIHEGCIEQINRLFRTQLY..................................
#=GR A0A1X1QH81_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A095SSY9_9FLAO/81-316              ................................KTASPGWYNSAAFENEAHKA..GLYAKSINGDAFSKEVKQQTIDMIKADL..G......QIDLIIYSLA.......S..P..VRM..HP.....E.......T......G..V....LHRSTLK....PIG..G.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........EPA......N.......Q.E.DIDNTVVVMGGEDWTMWIDALKAENLLAAGATTIAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKADGIHEGCIEQIQRLYSQRLY..................................
#=GR A0A095SSY9_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F4LKL1_TREBD/91-327                  ................................KGGTPGWYNNLAFDRASKKA..GIPSVTLNMDAFSDDCRKAVVAEARKMG..V......AFDLVVYSLA.......S..P..VRT..DP.....E.......T......G..V....LYKSVLK....PFG..K.P......F.S...G...QTV......DM.........M...S...G...ELS.VMSA........EPA......N.......D.D.EAAQTVKVMGGEDWERWIDQLAEAGVLAKGCKTVAYSYIGPALS..HAIYRDGTIGGAKKHLEKTARALDSK..L.SQkLGGE...AFVSVNKGLVTRSSAVIPIIPLYLSVLFKVMKEKGTHEGCIEQMERLFAERLY..................................
#=GR F4LKL1_TREBD/91-327       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A7JRB5_9PSED/83-320              ................................KAGTAGWYNAAAFDKFAKAD..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLVIYSLA.......S..P..VRK..LP.....Q.......T......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...SII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALSGADVLAEGARTVAFSYIGTEIT..WPIYWHGALGQAKQDLDETALRLDKK..L.AAdVKGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMFRDRLY..................................
#=GR A0A0A7JRB5_9PSED/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A178ID75_9BACT/82-318              ................................RLATPGWYNSAAFTRAALDA..GLYAKNINGDAFSDAVKRQAIDLIKADL..G......QVDLVVYSLA.......S..P..RRT..HP.....R.......T......G..A....THKSCLK....PIG..A.P......Y.T...N...KTV......DT.........D...R...G...IVS.DVTI........EPA......T.......E.T.EIADTVAVMGGEDWEMWIDALLEAGVLAPGATSVAYSYIGPEVT..WPIYKNGTIGTAKIDLERAAKKIDAA..L.KAhGYGR...AFISVNKALVTQASSAIPVVPLYISILYKIMKAKGLHEGCIEQMQRLFATQLY..................................
#=GR A0A178ID75_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1L4BWQ0_9LACT/83-319              ...............................n-LGTAGWYNNIAFKEAAEKE..GLIAKNFVQDAFSHESKQEVIDYIKNEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....D.......T......K..E....TYTSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...N...E...AFY.TETL........DPA......T.......D.Q.EIHDTVKVMGGEDWELWMKALKEADVLADGVLTTNYSYLGTELN..HPYYGGGTLGRAKADCDDKAENINEL..L.AD.INGK...ALIVVATAVTTKASSVIPFFPVYCIGLYKVMEEKGTHETPIMHQDRIYRDMIY..................................
#=GR A0A1L4BWQ0_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9R7T7_VIBSN/83-319                  ...............................g-VGSAGFYNNLYFREHAQNE..GRIAINIDGDAFSTQTKESVIEAIETYF.eG......EVDLIIYSVA.......S..G..LRP..NY.....Q.......T......G..E....MWRSAIK....PIG..Q.A......V.A...G...ASV......SL.........E...H...D...QWL.ESTL........EPA......T.......E.Q.EIDGTLKVMGGEDWEAWVDTLINSESIAEGCKTVAFSYIGSDLT..HPIYLDGTLGRAKVDLHQTSHSLNLK..L.AN.FSGG...AYASVCKALVTKASVFIPGLTPYLIALYKVMKQNGTHEGCIEQMQRLFTTKLY..................................
#=GR F9R7T7_VIBSN/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6EZ66_9FLAO/81-316              ................................RPASPGWYNTAAFETQAHKE..GLYAKSINGDAFSNEIKRQTLDLIKEDL..G......QVDLVIYSLA.......S..P..VRT..HP.....D.......T......G..V....KYKSVLK....PIG..D.T......F.Q...N...KTV......DF.........H...T...G...KVT.EVSI........APA......E.......G.D.DIENTVAVMGGEDWKMWIDALKAEGLLAPDFNTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFDITDT..L.KD.VNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEMGIHEGCIEQIQRLFSDRLY..................................
#=GR A0A1M6EZ66_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q6A557_9SPHI/59-294              ................................KPASAGWYNTAAFEKQAHEA..GLYAKSINGDAFSDEIKEKTIALIKKDL..G......QVDLVIYSLA.......S..P..RRN..HP.....K.......T......G..V....AHNSVIK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...VVS.EISI........NPA......T.......D.E.EIANTVEVMGGEDWGMWIDEMKAANILANGVVTVAYSYIGPALT..EKVYRKGTIGRAKDHLEATAFEISDK..L.KD.IDGK...ALISVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIQRLFEQRLY..................................
#=GR A0A1Q6A557_9SPHI/59-294   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A2YU59_9ACTN/90-325              ................................RSATAGWYRTIATDAIAREL..GSDFSFRNADAFADTTKTETLDLLAERF..G......GVDYLIYSVA.......A..P..RRT..DP.....R.......S......G..T....TYQSVLK....PLG..A.P......H.T...T...RNL......EF.........A...DdgaA...YLR.EVTV........GPA......N.......E.T.ETAATVRVMGGEDWSRWVTALAERGLLRDRFRTVALSYIGSPLT..SAIYRAGTIGAAKADLEFTARALTRR..L.AA.VGGR...AFTSVNGALISQALTAIPGIPLYVCLLRGVLGER--FPSPVEQSLQLWNQ---lt................................
#=GR A0A2A2YU59_9ACTN/90-325   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090T4M0_9VIBR/82-317              ................................KPGTAGFYNSAAFDKLAKEE..GLYSKSVNGDAFSHEAKQKVIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...S...D...KII.EASV........EPA......T.......E.Q.EIADTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWEGALGKAKMDLDRAAAELNAK..L.SQ.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGIHEGCMEQIFRMFSQRLY..................................
#=GR A0A090T4M0_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8U5N5_9FLAO/81-316              ................................RPGSPGYYNTAAFEKHAHKA..GLYAKSINGDAFSNEIKEQVVNLIKEDL..G......QVDLVIYSLA.......S..P..VRK..HP.....N.......T......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...NVS.EISI........NPA......E.......G.D.DIANTVTVMGGEDWKMWMDALQAENLLSEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDDLEKTAFEITDD..L.KS.INGN...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKEKGIHEGCIEQIERLYSERLF..................................
#=GR A0A1B8U5N5_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R4KWD5_9SPHI/82-318              ................................KPGTAGWYNTAAFEKQAIDA..GIYAKSINGDAFSDEIKKQTIDLIKQDL..G......QVDLVIYSLA.......S..P..RRT..HP.....K.......T......G..V....AHSSVLK....PIS..Q.A......F.T...N...KTV......DF.........H...A...G...IVS.DITI........QPV.....eN.......Q.E.DIDNTIAVMGGEDWKFWIEQLKAADVLAPGVKTVAYSYIGPELT..YPIYRNGTIGKAKDNLENTVPELNEL..L.KD.LRGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGIHEGTIEQMQRLFSEHLY..................................
#=GR A0A1R4KWD5_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090SET2_9VIBR/83-318              ...............................g-VGSAGWYNNIYFKQRANQA..GRRAINIVGDAFSQDVREQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KG.....D.......-......G..E....FWRSAIK....PIG..E.A......V.S...G...ASI......NL.........E...T...Q...QWE.NKLL........EPA......T.......D.E.EIEGTLKVMGGEDWESWIDTLVNSDSVANGFKTVALSYVGPEIT..HPIYLDGTLGRAKVDLHQTSHALNLE..L.SN.FDGN...AYAAVCKALVTKASVFIPGLTPYLLALYQTMKEQGTHEECIQQMQRLFSSKLY..................................
#=GR A0A090SET2_9VIBR/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R4HSQ3_9GAMM/83-318              ................................KTGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSNEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...RII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMDALDQAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAATAIDDK..L.KT.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGVHEGTIDQLNRLFGERLY..................................
#=GR A0A1R4HSQ3_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I8T4D1_9GAMM/82-317                  ................................KTGTAGWYNSAAFHKFAEGK..GLYAKSINGDAFSDEIKQKTIEVIRQDL..G......QVDLVVYSLA.......S..P..RRK..HP.....K.......T......G..E....VFSSTLK....PIG..Q.S......L.T...Q...RGL......DT.........D...K...V...IIK.EITL........EPA......T.......Q.A.EIDNTVAVMGGEDWQMWIDALDAAGVLAPGAKTTAFTYLGEKVT..RAIYWNGTIGAAKKDLDKKVLDIRAK..L.GA.SGGD...ARVAVLKAVVTQASSAIPVMPLYLAMLFKIMKANGTHEGCIEQLVELYKDNLY..................................
#=GR I8T4D1_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8PGY2_9VIBR/1-146               ..............................mr--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...Q...TLV.EHTL........EPA......S.......S.D.EIESTRRVMGGEDWQEWIDTLINADAIGSNARSIAFSYIGPEST..HAIYHQGTLGRAKVDLHQASHAVNLK..L.AP.FGGS...AYAAVCKALVTKASVFIPTFAPYVISLYRAMKELGVHETPIEQMIRLYQDKLY..................................
#=GR A0A0B8PGY2_9VIBR/1-146    pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K0P5N8_9BACT/82-318                  ................................RTASAGWYHTAAFEQAAHQA..GIYAKSINGDAFSDAIKQETIALIKEDW.gG......EVDLVIYSLA.......S..P..RRT..HP.....Q.......T......G..M....SFKSCLK....PIG..E.P......Y.R...N...QTV......DI.........I...S...G...HLS.DVCI........EPA......T.......P.K.EVADTVAVMGGEDWMMWIEALFAEKLLAKGVQTMAYSYIGPKLT..HRIYLKGTIGMAKKDLVATSKILQHR..L.RP.IDGQ...AVIAVSKAVMTQASAAIPVVPLYISLLYKIMKEKALHEGCIEQMYRLYADRLY..................................
#=GR K0P5N8_9BACT/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W4AEL9_9BACL/81-316                  ................................RTASAGWYNSAAFEKAAEEA..GLKSYSVTGDAFANETRDKAVELIRSEL..G......QVDLVVYSVA.......S..A..RRT..DP.....N.......T......G..E....VFNSVLK....PIG..Q.S......Y.T...N...KTV......NF.........H...T...G...EIS.SVTL........EPA......N.......E.E.EIRQTVTVMGGDDWELWMDALQQGGVLADDATTIAFSYIGPELT..HAIYRDGSIGQAKNHLEATAHKLNDR..L.SA.KGGR...AYLTVAKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQLQRLFADRLY..................................
#=GR W4AEL9_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A8FZ69_SHESH/83-319                  ...............................g-IGTAGWYNNIFFREEAEKQ..GLIAKNFVGDAFSPQTREQVIDYIKSEF.gG......KLDLVIYSLA.......T..G..VRP..DP.....V.......T......G..E....LWRSSIK....TIG..E.P......V.T...G...PTI......NI.........E...T...D...TME.QMTV........GTA......T.......D.E.EIDATEKVMGGDDWASWIEILSEADVLDKGCKTLAYSYIGAKST..YPIYHQGTLGRAKTHLHATGDMLNHK..L.AK.IGGT...AHVSVCKALVTKASVYIPAFSPYILALYKVMKEKGLHEGCIEQMQRLFAQRVY..................................
#=GR A8FZ69_SHESH/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1HGQ4_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSHEAKQKAIELIKKDL..G......QVDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....MVRSSLK....PIG..E.T......Y.K...A...TAV......DT.........N...K...D...ALF.EASV........EPA......T.......E.Q.EIQDTVTVMGGQDWELWINALSEAGVLSDECKTVAYSYIGTEIT..WPIYWHGALGKAKMDLDRAAKGLNDK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A0J1HGQ4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5FX35_9RHIZ/82-315              ................................KTASAGWYNNRAFEQRARAA..GRIAVTVEGDAFSDAIKAETIEVVRRNL..G......QVDLVVYSLA.......S..P..VRT..DP.....R.......T......G..E....TYRSAIK....PYG..A.A......V.K...A...KTL......NT.........A...T...G...EVS.QIEI........EPA......T.......E.E.EAQATVKVMGGEDWELWISALADAGVLADGFTTLNYTYLGSELT..WPIYHKGTLGVAKADLDRAAGAIRAR..F.GA.--ES...AYVVALKAVVTQASSAIPVVPLYGTLLLKVMAEMGVSEGCIEQIDRLFRTKL-a.................................
#=GR A0A0F5FX35_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C6CTR2_PAESJ/81-316                  ................................RTAKPGWYNSAAFEKAAAES..GLKSFSLTGDAFSDETKARTIDLIRTEL..G......SVDLVVYSVA.......A..P..RRV..HP.....K.......T......G..E....VLNSVIK....PIG..Q.S......Y.S...N...KTV......NF.........H...N...G...VVS.EATI........EPA......T.......E.E.EISQTITVMGGEDWQMWIDDLQAAGVLAEGATTIAYSYIGPEIT..HAVYRDGTIGRAKNDLEATAHNLTEQ..L.SS.TGGR...AYVAVAKALVTQSSSAIPVVPLYISALFKVMKEKGIHEGCIEQMYRMFATRLY..................................
#=GR C6CTR2_PAESJ/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R7CNK0_9FIRM/81-313                  ................................RTATPGWYNTAEFHRLASGK..GVYAKTINGDAFSKEIKEKAIELIKQDL..G......KVDLVVYSLA.......A..P..RRT..DA.....E.......-......G..K....TWSSCLK....TTD..E.P......F.T...E...KSL......DL.........R...N...N...EIT.EKTV........EPA......T.......E.E.EVLSTVKVMGGEDWADWIDALKAADVLTENAVTVAYSYIGPELT..YPIYYHGTIGTAKQHLQKTMSEINQA..H.--.PDVR...AVISVNKGLVTQASAAIPVVPLYFAILYKVMKRAGNHENCIQQIARLFTQKLY..................................
#=GR R7CNK0_9FIRM/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I1JL78_9LACT/83-319              ...............................n-LGTAGWYNNIFFKEAAEKE..GLIAKNFVQDAFSNETKQEVINYIKNEF.gG......KVDLVVYSLA.......S..G..RRT..DS.....E.......T......G..E....TYTSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...K...E...EYY.TETL........EPA......T.......E.Q.EIEDTVKVMGGEDWERWMKALKEADVLADGVLTTNYSYLGSELN..HPYYGHGTLGRAKADCDEKAENINEL..L.KD.IDGK...AQIVVATAVTTKASSVIPFFPVYCIGLYKVMSEKGTHETPIMHMDRIYREMIY..................................
#=GR A0A1I1JL78_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F3L0B8_9GAMM/82-324              ................................KTGTAGWYNSYAFDKLAREA..GLFAKSINGDAFANETRARAIEIIKNEM.gG......KVDLVVYSLA.......S..P..VRK..LP.....E.......GtklgepG..T....VVRSALK....TMG..E.T......F.T...A...SSV......DT.........N...K...N...EVV.QATV........EPA......T.......E.Q.EVQDTVTVMGGEDWSLWIDALAEAGVLADNATTIAYSYVGTSIT..WPIYWHGTLGQAKQHLDRTAAELRER..H.KR.RHLR...SYVGVMKSVVTQASSAIPVIPLYVSMVFKIMKAKGIHEGCIEQINRLFHDRLY..................................
#=GR A0A0F3L0B8_9GAMM/82-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N0MRP7_9ACTN/86-322              ................................RTATAGWYRTAATADIARTA..GRDLVFLNGDAFSDTMKNQVADLLEQRF.gG......KLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..I....TYASVLK....PIG..Q.A......N.R...T...KTLl...fdDQ.........G...V...P...EVR.EVET........EPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRDLLGDGFATAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLNEL..L.EKtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGEA--MVPPVRQLAALWD----ql................................
#=GR A0A0N0MRP7_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J2SPI4_9BURK/82-317                  ................................KPGSPGWYNTAAFERAAHAE..GRYAKSINGDGFSDAVKQQVIDTIRADL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSVLK....PVG..K.A......V.N...L...RGL......DT.........D...S...G...AVK.ETVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDQKVLGIRAQ..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKAQGTHEGCIEQVHGLFAESLY..................................
#=GR J2SPI4_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PARPJ/82-317                    ................................KAGTAGWYNTAAFEKFATEK..GLYATSINGDAFSDEVKARTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......S......G..E....VFSSTLK....PVG..K.A......V.N...L...RGI......DT.........D...K...E...VIK.ETVL........EPA......T.......Q.K.EIDDTVAVMGGEDWQMWIDALLEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR FABV_PARPJ/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H7PUM6_9FLAO/81-316              ................................RPASPGWYNTAAFEKEAQEA..GLYAKSINGDAFSNEIKEQTIELIKKDL..G......QIDLVIYSLA.......S..P..VRV..HP.....E.......T......G..V....KHKSSLK....PIG..G.S......Y.T...N...KTV......DF.........H...T...G...DIS.QISI........EPA......T.......E.E.DIENTVTVMGGEDWKFWIDALQKENLLSPEAKTVAYSYIGPKLT..EPVYRKGTIGRAKDDLEATAFDITKS..L.SA.INGN...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKENNVHEGCIEQMQRLFADRLY..................................
#=GR A0A1H7PUM6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0E4CYR4_9BACL/81-316              ................................RTASAGWYNSAAFEKAAAQQ..GLKSHSIVGDAFSDAIKTKTIDLIKAEY..G......TVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PVG..A.A......Y.T...N...KTM......NF.........H...T...G...EVS.TVTI........EPA......T.......E.D.EVRQTIAVMGGEDWAMWIDQLQEAGVLADGATTVAYSYVGPKIT..HPIYRDGTIGLAKNDLEQTAIALHEK..L.SA.KGGR...AFVSVNKALVTQSSSAIPVVPLYISTLYKVMKEKELHENCIQQMYRLFTDHLY..................................
#=GR A0A0E4CYR4_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H3K5Z3_9FIRM/81-311                  ................................RTATAGWYNTAAFEEFAKND..GYYAKTINGDAFSQTIKEKTIELIKKDL..G......KIDMVVYSLA.......A..P..RRT..TD.....D.......-......G..T....MYSSVLK....TVD..E.P......F.T...A...KTL......NL.........K...T...N...ELT.EATL........PPA......T.......P.E.EVEATIKVMGGEDWADWMHALKDADVLTENACTVAYSYIGSKIT..YPIYYEGTIGAAKQHLYKTADALRQE..-.--.-GFN...AIISVNKALVTQSSSAIPIVPLYVAVMYRVMKDKNVHEGTIEQMYRLWHEYL-s.................................
#=GR H3K5Z3_9FIRM/81-311       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I5XBW0_9LACT/83-319              ...............................n-LGTAGWYNNIAFREEAEKE..DLIAKNFVQDAFSHETKQEVIEYIKNEF.gG......KVDLVVYSLA.......S..G..VRK..DP.....E.......T......G..E....LYKSSIK....AIG..E.P......V.V...G...PHI......NM.........Q...N...E...SFY.TETL........EPA......D.......E.Q.EIADTVNVMGGEDWQLWMEALKESGVLTEGVLTTNYSYLGTELN..HAYYGGGTLGRAKADCDEKAENINQL..L.AD.INGK...AQIVVATAVTTKASSVIPFFPVYCIGLYKVMEEKGTHETPIMHIDRIYRDMIY..................................
#=GR A0A1I5XBW0_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R6MZF4_9CLOT/81-315                  ................................RTGTPGWYNNAAFETYALED..GLYAKTLIGDAFSQEMKEQAAELIQKDL..G......QIDLLVYSVA.......A..P..RRT..DA.....E.......-......G..R....TYSSVLK....PVG..A.P......F.K...S...RSI......DL.........S...T...N...QIK.EVSI........EPA......S.......G.E.EVAATVKVMGGEDWQLWIDLLKEKGLLAQSFATVAYSYIGPEVT..HAIYKNGSIGQAKKDLQETALRITEQ..L.SA.IGGK...AFISVNKALVTQASAAIPVVPLYISILFHVMKEQGTHEGCIEQMDRLLRKKLF..................................
#=GR R6MZF4_9CLOT/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C6XYJ7_PEDHD/81-317                  ................................KTASPGWYNSAAFENQALKA..GLYAKSINGDAFSDEVKQKTLDLIEKDL..G......QIDLVIYSLA.......S..P..KRM..HP.....K.......T......G..V....LHSSVLK....PIG..E.D.....iF.T...N...KTV......DF.........H...T...G...VVS.EISI........VPA......N.......E.E.EIENTIAVMGGEDWEMWMDALKSRGLLATGAKTVAYSYIGPSVT..EAVYRKGTIGRAKDHLEATAFTINDK..L.KD.IDGR...AFVSVNKALVTQASSAIPVIPLYISLLYKVMKEKGIHEGCIEQMERLFTERLY..................................
#=GR C6XYJ7_PEDHD/81-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A023C6A2_9PSED/82-316              ................................KLSSAGWYNSAAFEKFAVEK..GLYAKSINGDAFSDDIKRLTIETIKKDL..G......KIDLVVYSLA.......A..P..RRT..DP.....Q.......-......G..V....VHNSTLK....PIG..K.A......V.T...L...RGI......NT.........D...K...G...VVV.DTTL........EPA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALRDADVLAEGAKTTAFTYLGEKLT..QDIYWNGSIGEAKKDLDKKVLTLRDN..L.AA.LKGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A023C6A2_9PSED/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A066WRK0_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..N.T......F.T...N...KTV......DF.........H...T...G...KVS.EVSI........EPC......S.......G.D.DIENTIAVMGGEDWAMWIDALKAENLLAPGANTVAYSYIGPSVT..EAVYRKGTIGRAKDHLEATAFEISDS..L.AD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLYQQRLF..................................
#=GR A0A066WRK0_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B7K2C5_9GAMM/82-317              ................................KTGSAGWYNSAGFDKAAKEE..GLYAKSINGDAFSNECRQTVIDLIKQDL..G......QIDLVIYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLV.EAVV........EPA......N.......E.Q.EIADTIKVMGGQDWELWMNALDEAGVLADNAQSVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAANAINDK..L.KA.KGGS...AYVAVLKSVVTQASSAIPVMPLYISIVFKIMKEQGIHEGCIQQIQRLFETKLF..................................
#=GR A0A1B7K2C5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T1HXU6_9PSED/82-317              ................................KLGTAGWYNTAAFHKFAEEK..GLYAKSINGDAFSDAVKAETIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VLSSTLK....PLG..K.S......V.T...L...RGV......DT.........D...K...E...IVK.ETTL........QPA......T.......Q.E.EIDGTIAVMGGEDWQMWIDALHDAGVLAEGAKTTAFTYLGEKLT..HDIYWNGSIGEAKKDLDHKVIGMRKQ..L.AD.LHGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGSHEGCIEQVYGLYKNSLY..................................
#=GR A0A1T1HXU6_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A094K075_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKEA..GLYSKSINCDAFSHEAKAKVIELIKQDL..G......EIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSSLK....PIG..E.S......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIADTVTVMGGQDWELWINALSDAGVLADGCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAHELNSK..L.SA.NGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGLHEGCMEQIYRMFSQRLF..................................
#=GR A0A094K075_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV1_VIBVY/82-317                   ................................KPGTAGFYNAAAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QVDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSALK....PIG..Q.T......Y.T...S...TAV......DT.........N...K...D...III.EASV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALAEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAASALNDK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR FABV1_VIBVY/82-317        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
B3PD46_CELJU/105-337                 ................................KTGTAGYYNTAAFHDAAAAA..GLYARTLNGDAFSDECKAQVIDALKQDL..G......KVDLVVYSLA.......A..P..RRT..DP.....K.......T......G..E....VYSSVLK....PIG..K.S......Y.T...A...KNL......NT.........D...T...L...KIA.DVTV........EPA......S.......A.E.EIANTVKVMGGEDWELWIEALKQADLLADGFKTVAYTYLGDKLT..WPIYGHATIGKAKEDLDRAAKALSAT..Y.--.-QGD...ARVAVLKAVVTQASSAIPVMPLYLSILFKVMKEQGSHEGCIEQIQRLFTECIY..................................
#=GR B3PD46_CELJU/105-337      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B1YT09_9BURK/82-317              ................................KPGTAGWYNSAAFEKFAAEK..GLYARSINGDAFSDKVKQITIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PVG..K.S......V.T...F...RGL......DT.........D...K...E...VIR.EVSL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKKVLSIRDK..L.AA.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKETGTHEGCIEQVYGLLKDSLY..................................
#=GR A0A0B1YT09_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1K1ZY07_9GAMM/82-318              ................................KPGTAGWYNSWAFEQEARKA..GLYARSINGDAFSDEVRAKAIEMIKADL..G......EVDLVIYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSALK....PIG..E.V......Y.R...S...TAI......DT.........N...K...D...QII.EAEV........EPA......T.......E.Q.EIADTIRVMGGEDWELWMQALDQAGVLAKGAKTTAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAALNRQ..L.SEkYGGT...ANVAVLKSVVTQASAAIPVMPLYIALVYKVMKSQGIHEGTIEQLNRLYRTQLY..................................
#=GR A0A1K1ZY07_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
L8JJ42_9GAMM/82-317                  ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSNEAKQKTIDLIKEDL..G......QVDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSTLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......N.......E.Q.EVEDTVKVMGGQDWELWINALSDAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAAKELDAK..L.AA.NGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLY..................................
#=GR L8JJ42_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A167VYQ7_9BURK/82-317              ................................KAGTAGWYNTAAFEKFAAEK..GLYATSINGDAFSDEVKQRTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......T......G..E....VFSSTLK....PVG..K.A......V.N...L...RGI......DT.........D...K...E...VVK.ETVL........EPA......T.......Q.A.EIDNTVAVMGGEDWQMWIDALLEANVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSMY..................................
#=GR A0A167VYQ7_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A3LK74_9GAMM/82-318              ................................KPGTAGWYNAAAFDRYAKQA..GLYSRSINGDAFSDEARAQAIELIRNEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VVRSALK....PIG..E.A......Y.T...S...TAI......DT.........N...K...D...QII.EASI........EPA......S.......E.Q.EIADTVTVMGGQDWQLWIDALREAGVLADGAKTVAFSYIGTEIT..WPIYWHGALGRAKADLDATARRLDAQ..L.AK.TGGS...ANVAVLKSVVTQASAAIPVLPLYIAIAFKVMKEAGLHEGTLDQLDRLLRERMY..................................
#=GR A0A2A3LK74_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I3IC08_9GAMM/82-314                  ................................KTATAGYYNTSAFHDAAKAE..GLYAHTINGDAFSDACKDKVIAELKNSM..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....VFNSVLK....PIG..K.E......Y.T...S...KNL......NT.........D...T...L...KIS.DVTI........EPA......S.......D.E.EIANTVKVMGGEDWEMWIDALKGADLLADNFQTVAYTYLGDKLT..WPIYGKATIGKAKEDLDRAAKTLSAK..H.--.-GGN...ARVAVLKAVVTQASSAIPVMPLYLAILFKVMKAQGTHEGCIEQIQRLFKECLY..................................
#=GR I3IC08_9GAMM/82-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D0Z3V9_PHODD/83-319                  ...............................n-IGTAGWYNNIYFKQEAERH..GYQAINIVGDAFAKSTRQQVAEAIQQKF.nG......KVDLVIYSLA.......T..G..ARP..NP.....I.......D......G..T....LWRSTIK....PIK..E.V......Q.T...G...YNL......NL.........E...H...E...TLD.LVDI........PPA......T.......T.K.EIEDTVKVMGGEDWQEWVDFLQSKDLLASGCQTLAFSYIGSPLT..HNIYHRGTLGAAKEHLHQSVTTLNQQ..L.AP.IQGS...AHVVVCKALVTKASAFIPTFSPYMLALYQVMKQQGLHEGCLKQMQRLFKEKL-s.................................
#=GR D0Z3V9_PHODD/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2ZSH6_9SPHI/81-316              ................................KTASPGWYNTAAFETEAIKA..GLYAKSINGDAFSNEIKAQTMELIKADL..G......QIDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....LHRSTLK....PIG..Q.N......F.S...N...KTV......DF.........H...T...G...IVS.EVSI........EQA......N.......E.E.EIENTVAVMGGEDWEMWIDALKAENLLADGFTTVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFTISDK..L.AD.VNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFKDRLY..................................
#=GR A0A1I2ZSH6_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A172U3R6_9GAMM/82-317              ................................KPGSAGWYNSAAFHQFAEAE..GLYAKSINGDAFSDEIKQRVIAAIKQDM..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..V....TYNSTLK....PIG..K.D......L.V...Q...NGV......DT.........D...K...E...IIK.EFTL........TAA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALSEAGVLADGAKTTAFTYLGEKVT..WDIYWDGTIGAAKKDLDKRVIDIRAK..L.AA.IGGD...ARVSVLKAVVTQASSAIPVMPLYLALLFKVMKEQGTHEGCIEQVDGLFRDSLY..................................
#=GR A0A172U3R6_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8VTE8_9GAMM/82-314              ................................RTASAGYYNSAAFEDEAHKA..GLYAKSINGDAFSDEVKAQAIEMIKEDM..G......KVDLVVYSLA.......S..P..RRK..DP.....K.......T......G..E....LHSSVLK....PVG..K.S......Y.T...A...RNL......NT.........D...K...L...EIS.DITL........EPA......N.......Q.E.EIDATVKVMGGEDWELWMQALGDAGVLADDCKTVAYTYIGEKLT..WPIYGHATIGKAKEDLDRAAKEISNK..G.--.-QAD...AHVAVLKALVTQSSSAIPVMPLYISLVYQVMKEEGTHEGCIEQLYRLYTEGLY..................................
#=GR A0A1G8VTE8_9GAMM/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K4KRF4_SIMAS/82-317                  ................................KTASAGYYNTAAFHAAAKQA..GLFALSINGDAFSDEIKAQTLAAVKEHM..G......KVDLVVYSLA.......S..P..RRT..DP.....K.......T......G..T....LYSSVLK....PIG..K.G......Y.T...A...KNL......NT.........D...T...L...KIA.DITV........EPA......S.......E.E.EIANTVKVMGGEDWELWIDALQQEGLLADNCRTVAYTYLGEKLT..WPIYGHATIGKAKEDLDRAAKALNER..M.AS.VQGK...ANVAVLKALVTQSSSAIPIMPLYISLVYKVMKEEGTHEGCIEQLYRLFTEGLY..................................
#=GR K4KRF4_SIMAS/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A160DVI2_9GAMM/82-318              ................................KPGTAGWYNAAAFDRYAKEA..GLYSRSINGDAYSDEVRAKAIELIREEM.gG......PIDLVIYSLA.......S..P..VRR..LP.....D.......T......G..E....LKRSALK....PIG..A.R......Y.R...T...TAV......DT.........N...R...D...QII.EAEI........EPA......T.......P.E.EVADTIRVMGGEDWELWIDALARAGVLAADAKTVAFSYIGTDIT..WPIYWHGALGKAKEDLDRAAHAIDAR..L.KP.GGGE...ARVGVLKSVVTQASAAIPVMPLYIALVFRIMKDRNLHEDPIDQTERLFREHLY..................................
#=GR A0A160DVI2_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090T1G2_9VIBR/83-318              ...............................g-IGTAGWYNNIYFKQRAQQA..DRRAINIVGDAFSQDVREQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KP.....N.......-......G..E....FWRSAIK....PIG..E.A......V.S...G...STI......NL.........E...T...Q...AWE.DTLL........EPA......S.......D.E.EIEGTLKVMGGEDWESWIDTLVNSDSVANGFKTVALSYVGPEIT..HPIYLDGTLGRAKVDLHQTSHALNLE..L.SN.FDGN...AYAAVCKALVTKASVFIPGLSPYLLALYKTMKEQGTHEECIEQMQRLFATKLY..................................
#=GR A0A090T1G2_9VIBR/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A139CBH8_9GAMM/86-321              ................................KPGTAGWYNAAAFDRYAKEE..GLYSRAINGDAFAHETREKAIEMIKQDL..G......EVDLVIYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSALK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTIAVMGGEDWELWIDALDKAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDKR..L.AG.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFRDRLY..................................
#=GR A0A139CBH8_9GAMM/86-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H2ZQJ2_9GAMM/83-318              ................................RPGTAGWYNAAAFDRFAKAD..GIYSKSINGDAFSHEARDKAIELIKRDM..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSALK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TIT.EAEV........EPA......T.......D.E.EVADTVTVMGGEDWELWINALDDARVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDAK..L.KP.HGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFAERLY..................................
#=GR A0A1H2ZQJ2_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P4R4Z6_9ACTN/85-321              ................................RTATAGWYRTAATAELARQH..GHEMVFLNGDAFSDAMKDQVAEVLRERF..G......RLDHLIYSVA.......A..P..RRT..DP.....D.......T......G..A....TYASALK....PIG..E.A......Y.R...T...KTL......AF.........D...S...DgtpEVK.EVET........APA......T.......D.D.DIEQTVAVMGGADWERWIDHLAERELLADGFSTAALSYIGSPLT..DGIYRQGTIGAAKCHLEATARTLNER..L.EKlVGGR...AVTSVNGAAVTQSSTAIPGIALYVGLLRGVLGDA--MVPPIAQLTSLWD----qlt...............................
#=GR A0A0P4R4Z6_9ACTN/85-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A248KM97_9ENTR/82-317              ................................KPGSAGWYNSAAFDEAAKRE..GLYSKSINGDAFSDECRDAVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....K.......T......G..E....IVRSALK....PIG..E.V......Y.T...S...KAI......DT.........N...K...D...QII.TASI........EPA......T.......E.E.EVKNTVTVMGGEDWELWMGALSEAGVLAEGVKTVAYSYIGTDLT..WPIYWHGALGKAKEDLDRAAGELRNQ..L.AP.LHGS...ANVAVLKSVITQASSAIPVMPLYISMVFKLMKEQGIHEGCIEQINRLMTTSLY..................................
#=GR A0A248KM97_9ENTR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4PT72_9GAMM/82-317              ................................KTGSAGWYNTAAFQNAADEA..GLWAKNINGDAFSDEIKEKTIDVIKNEL..G......KIDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....TFSSTLK....PIG..E.G......V.T...T...KNL......NT.........S...K...R...IID.EVSV........EAA......S.......D.E.EIANTVKVMGGEDWQLWIDALNEAGVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAVQEIKAS..T.AD.ISGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKEDGTYEGTIEQITALFKENLY..................................
#=GR A0A0F4PT72_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0U2Y7F0_9BURK/82-317              ................................KPATPGWYNTAAFDKFATEK..GLYAKSINGDAFSKDIKAKTIETIKNDL..G......QVDLVVYSLA.......A..P..RRI..HP.....E.......T......G..Q....VFNSVLK....PIG..K.S......V.T...L...RGI......DT.........D...K...E...VVK.ESVL........EPA......S.......Q.E.EIDNTVAVMGGEDWQMWIDALADAGVLAPGAKTTAFTYLGEKIT..HDIYWNGSIGAAKRDLDDKVLNIRAK..L.AA.NGGD...ARVAVLKALVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQIYGLYKDSLY..................................
#=GR A0A0U2Y7F0_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E8LQH8_9VIBR/82-318                  ...............................g-TGSAGFYNDYYFKRHAKRA..GRVAVNIHGDAFSQQIKDDVVEAIETYF.eG......EVDLVIYSVA.......S..G..MRP..KA.....E.......S......G..Q....FWRSAIK....PIG..Q.P......V.S...G...TTL......VL.........E...N...D...QWH.NSTL........EPA......T.......E.E.EAEATRKVMGGEDWEAWIDALINSESVAKGCKTIAFSYIGPEIT..HPIYLDGTLGRAKIDLHQTSHALNLK..L.AN.FDGG...AYATVCKALVTKASVFIPGLTPYIIALYKVMKEKGTHEGCIEQMQRLFSSKLY..................................
#=GR E8LQH8_9VIBR/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6QVR3_9BACL/81-316              ................................RTASAGWYNSAAFEQAAQQA..GLKSFSVTGDAFTDETKQKAVDLIKQEL..G......QVDLVVYSVA.......S..A..RRT..DP.....K.......T......G..E....TANSVLK....PIG..A.T......Y.T...N...KTV......NF.........H...S...G...EVT.SISI........EPA......T.......E.Q.EIQDTVTVMGGDDWQMWMDALQQGGVLAEGATTISYSYIGSQIT..QAIYREGSIGQAKDHLEATAKKLSEQ..L.SS.IGGR...AFVTVSKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQTYRLFTERLY..................................
#=GR A0A1I6QVR3_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V3PZT9_9GAMM/83-317              ................................KTGTAGWYNSAAFDKAAKQA..GLYSKSINGDAFANETRARAIEIIKNEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..Q.P......F.T...N...TSV......DT.........N...K...D...TVI.EATI........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSAAGVLAEHAKTVAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKQLRSR..H.--.PGLD...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHENPIEQANRLFHDRLY..................................
#=GR A0A1V3PZT9_9GAMM/83-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K6YFL0_9ALTE/82-317                  ................................KTATAGWYNTAAFHQQAKQA..GIYAQTINGDAFSNEIKQQVIDTLKADM..G......KVDLIIYSLA.......S..P..RRT..DP.....E.......T......G..E....VYKSTLK....PVG..Q.D......Y.K...T...KTY......DT.........D...K...D...LIH.EVEL........EAA......S.......E.E.EIANTIKVMGGEDWELWLNALAEADLLADNCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAASEIIKQ..H.SD.KNVV...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKQEGTHEGCIEQISGLFQQKL-l.................................
#=GR K6YFL0_9ALTE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7FVK4_9GAMM/83-318              ................................RTGTAGWYNSAAFDKLAKQE..GLYSNAINGDAFSHAAREQAIELIKRDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSALK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTIEVMGGEDWELWMDALDSAGVLAKGAKSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAEIDKR..L.AQ.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRTMKEQGLHEGTIDQLNRLFGERLY..................................
#=GR A0A1M7FVK4_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2EW76_CLOS4/81-313                  ................................RTASAGWYNTAAFEAFAAAD..GLYAKTVNGDAYSQQCKDEVIAQIKADL..G......QVDVVIYSLA.......A..P..RRT..LK.....D.......-......G..T....TVSSVLK....TTG..S.D......Y.T...N...KTI......DL.........K...E...R...TLS.EITI........PQA......S.......E.E.EIAHTVAVMGGEDWEDWMLALQGAGVLAEGAVTAAYSYIGPELT..HPMYKDGSIGRAKDHLFATAAKLAQE..I.--.PGLR...SYLSVNKALVTQSSAAIPIVPLYISLLYKVMKEKGLHEGCIEQMYRLVHDRLY..................................
#=GR U2EW76_CLOS4/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C0EHW6_9FIRM/81-313                  ................................RTASAGWYNTAAFEELAQAE..GLYAKTINGDAFSKEIKEQVIQTIKSDL..Q......TVDLVVYSLA.......A..P..RRT..AP.....D.......-......G..T....TYSSVLK....TTG..E.E......Y.T...N...KTI......DL.........K...T...K...AVS.EVTI........PQA......S.......E.Q.EIADTVKVMGGEDWLDWMEALQGAGVLAEGAETVAYSYIGPALT..HPMYLNGSIGMAKRHLAKTAQEITQK..F.--.GGVK...AYLSVNKALVTQSSAAIPIVPLYISILYKVMKEMGLHEGCIEQMYRLFHERLF..................................
#=GR C0EHW6_9FIRM/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A165S0D8_9GAMM/82-317              ................................KPGTAGWYNSAAFHKFAEEE..GLYAKSINGDAFSDDIKQKTIETIKADM..G......QVDLVVYSLA.......A..P..RRQ..HP.....V.......T......G..E....VHNSTLK....PIG..K.D......T.V...Q...KGV......NT.........D...K...E...EVQ.DFHI........EQA......N.......D.D.EIANTVAVMGGEDWQMWIEALDAAGVLADGAKTTAYTYIGEKLT..WDIYWHGTIGAAKKDLDKRVIDIRER..L.AA.QGGD...ARVSVLKAVVTQASAAIPAMPIYLALLFKVMKENGTHEGCIEQVDGLFRDSLY..................................
#=GR A0A165S0D8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A069IKJ9_9BURK/82-317              ................................KPGTAGWYNTAAFHRFAADK..GLYAKGINGDAFSDEIKQKTIDAIKRDL..G......QVDLVVYSLA.......S..P..KRT..HP.....K.......T......G..E....VFNSTLK....PVG..K.A......V.S...L...RGL......DT.........D...K...E...VVR.ETIL........EPA......T.......Q.S.EIDNTVAVMGGEDWQMWIDALQAAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGLRDK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A069IKJ9_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A081FU68_9GAMM/113-348             ................................KTGTAGWYNAAAFERLAHEA..GLYAKSLNGDAFSHDAKQKVVDLIKADL..G......QVDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSALK....PIG..E.P......Y.R...S...TAI......DT.........N...K...D...CII.EAEV........EPA......T.......E.Q.EVADTVTVMGGEDWELWLNALREADVLAPGCKTVAYSYIGTDIT..WPIYWHGALGKAKQDLDRAASELNTA..L.AA.DGGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMREKGVHEGCMEQVYRLFATGLY..................................
#=GR A0A081FU68_9GAMM/113-348  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5AT72_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSLNGDAFSHEAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...QLI.EASV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALNDAGVLAEGCKTVAYSYIGTELT..WPIYWEGALGKAKMDLDRAANALNQT..L.AA.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFTQRLY..................................
#=GR A0A0F5AT72_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G7YWQ0_9VIBR/83-319              ...............................g-TGSAGWYNNHYFQKYAERE..GRVAANIQGDAFSAEIKEEVVEAIETYF.eG......EVDLIIYSVA.......A..G..VRP..NP.....Q.......T......G..D....MWRSAIK....PIG..Q.S......Y.S...G...AMI......QL.........E...D...D...SWH.QQTL........SAA......S.......D.E.EIEATLKVMGGEDWESWVDTLINSESIAPGCQTIAFSYMGSEVT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FDGG...AYATVCKALVTKASVFIPGLMPYLISLYKVMKEKGTHESCIEQMQRLFSDKLY..................................
#=GR A0A1G7YWQ0_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5QY73_9BACL/81-316              ................................RTASAGWYNSAAFERKAAEA..GLKSISVTGDAFTDETKDRVLDAIAKEF..G......QVDLVVYSVA.......A..P..RRT..DP.....D.......T......G..E....TFNSVLK....PIG..A.P......Y.S...N...KTV......NF.........H...T...G...EVT.DVTI........EPA......E.......G.D.DIAQTVAVMGGADWQRWIDRLQAAGLLAEGAVTIAYSYIGSEIT..QAIYRDGTIGQAKDDLEATALRLGDQ..L.SP.IGGR...AYVSVSKALVTQSSSAIPVVPLYVSALYKIMKEKGLHENTIQQSHRLFADRLY..................................
#=GR A0A0F5QY73_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4GA42_9SPHI/81-316              ................................KTASPGWYNSAAFEKEAHAA..GLYAKSINGDAFSKEIKEKTLATIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..G.T......Y.T...N...KTV......DF.........H...T...G...NVT.EISI........EPA......T.......E.E.DIVNTVAVMGGEDWSMWIDALKAENLLAEGATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFTIADK..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGTIEQIQRLYAERLY..................................
#=GR A0A0Q4GA42_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E3EFV0_PAEPS/81-315                  ................................RTASAGWYNTVAFEKAARAA..GYIAESINGDAFSHEIKQETLKLVKEKL..G......KVDLIVYSVA.......S..P..RRT..HP.....D.......T......G..E....TFNSVLK....PIG..Q.P......F.T...N...KTV......NT.........N...T...G...VVS.EITL........EPA......T.......Q.E.EIENTITVMGGEDWSLWLKALEEADLLAEGVTTLAYSYIGPEIT..EAIYRKGTIGQAKNDLEATAHTLTKQ..L.EP.YHGK...AYVSVNKALVTQSSSAIPVVPLYISLLFKVMKEKGLHEGCIEQAQRLFE-MLY..................................
#=GR E3EFV0_PAEPS/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4MPJ4_9GAMM/82-317              ................................KTGSAGWYNSAAFDKAAKEE..GLYSKSINGDAFSNECRDTVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSALK....PIG..E.P......Y.E...S...TAL......DT.........N...K...D...KLV.SAVV........EPA......N.......E.Q.EIADTIQVMGGQDWELWMNALADAGVLADNAKSVAYSYIGTELT..WPIYWHGTLGKAKEDLDRAAQAIDNR..L.KA.KGGS...ANVAVLKSVVTQASAAIPVMPLYISIAFKIMKEQGIHEGTIEQIQRLFATKLY..................................
#=GR A0A0Q4MPJ4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV2_VIBCH/83-323                   ...............................q-TGSAGYYNNLFFKQHAEQA..GRIAVNLEGDVFSVDMREQVIEAIETYF.eG......EVDLIIYSIA.......S..G..MRR..KP.....R.......S......E..KadpeFWRSAIK....PIG..E.A......V.S...G...ATL......LL.........E...N...D...TWI.ETTL........QPA......S.......E.E.EIEGTLRVMGGDDWENWIDTLINAESLAEGCKTIAFSYMGPDVT..HPIYLDGTLGRAKIDLHQTSHALNLK..L.AN.FDGG...AYAVVCKALVTKASVFIPGLSPYLLALYQVMKNKGTHEGCIEQMQRLFSDKLY..................................
#=GR FABV2_VIBCH/83-323        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A291P3M2_9GAMM/83-318              ................................KPGTAGWYNAAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......E.Q.EIEDTIAVMGGEDWELWIDALDRAGVLAPGAKSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDKR..L.GE.QGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEKGLHEGTIDQLNRLFGECLY..................................
#=GR A0A291P3M2_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I1DTC9_9GAMM/82-317                  ................................KTASAGWYNTAAFEQAADAA..GLWNKHINGDAFTDELKAQAIDIIRSEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......T......G..E....VFSSVLK....PIG..Q.A......Y.T...A...RTL......NT.........S...K...R...EIE.EVSV........EPA......N.......D.E.EIYHTVKVMGGEDWERWLDQLNAAGVLADNCQTVAYTYIGKELT..WPIYGKATIGRAKEDLDRAAAAITAK..L.AD.KKGK...AYVASLKALVTQASSAIPIMPLYISLLYRVMKAEGSHEGCIEQINGLFRQGLY..................................
#=GR I1DTC9_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A011RN20_9LACT/83-319              ...............................n-LGTAGWYNNIAFKEAAEKE..GLTAKNFVTDAFSHKAKQEVITYIKEEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....E.......T......G..E....TYTSSIK....AIK..E.P......V.V...G...PNI......NM.........Q...K...E...EFY.TETL........EPA......T.......E.Q.EIADTVKVMGGEDWELWMKALKEADVLSEGVLTTNYSYLGTELN..RPYYGGGTLGQAKADCDEKADKINAL..L.GD.LNGK...ALIVVATAVTTKASSVIPFFIVYCIGLYKVMEEKGTHETPIMHQDRIYRDMIY..................................
#=GR A0A011RN20_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_SHEON/82-317                    ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINCDAFSHEAKQKVIELIKQDL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...CII.EATV........EPA......T.......E.Q.EIADTVTVMGGQDWELWINALAEAGVLSDNCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAKALNDK..L.SV.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRQEGLHEGCMEQIYRMFSERLF..................................
#=GR FABV_SHEON/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PSEHT/82-317                    ................................KTGSAGWYNTAAFQNAADEA..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDLIIYSLA.......S..P..RRT..DP.....N.......T......G..E....VFSSTLK....PIG..N.A......V.T...T...KNL......NT.........S...K...R...EID.EITV........EAA......N.......Q.D.DIDNTIKVMGGEDWEMWIDALKQADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKAS..T.SD.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIQALFSENLY..................................
#=GR FABV_PSEHT/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R1L9F5_9LACO/85-321              ...............................l--GAAGWWNQVFFKQAAEAA..GLVAKNFNANAFLPATKRDVIHYIQSEL.dG......PIDLLVYSIA.......A..A..KRV..NP....fD.......P......S..E....VWRSVIK....PIG..K.S......V.T...D...FTV......DL.........E...R...N...QLL.STTI........DPA......T.......P.S.EIAATEHVMGGEDWELWVQSLQAAGVLAPNCKTILFSYEGPAAT..APIYHDGTLGRAKRAAEASARQLQKQ..L.LP.SGGE...ALISVNRSVTTKASVVIPGFSRYCTALYQVEQALGTHERPIEQQDRLFRDMVY..................................
#=GR A0A0R1L9F5_9LACO/85-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q7KUH7_9BURK/82-317              ................................KPGSPGWYNTAAFHRAATAE..GRYAKTINGDGFSDAVKQQAIDTIRADL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSVLK....PIG..K.A......V.T...L...RGL......DT.........D...S...G...AVK.ESVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDEKVLDIRAQ..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKAQGTHEGCIEQVHGLYADSLY..................................
#=GR A0A0Q7KUH7_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H9HZW7_9GAMM/82-318              ................................KPGTAGWYNSAAFDKFAKAK..GLYSRSINGDAFSNEARAKVIELIKTEM.gG......QVDLVIYSLA.......S..P..VRK..LP.....D.......T......G..E....LKRSALK....PIG..Q.V......Y.T...A...TAI......DT.........N...K...D...SII.QASV........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALSAAGVLAPKARTLAFSYIGTDIT..WPIYWHGALGKAKADLDATAQRLDAR..L.KA.SGGG...AQVAVLKSVVTQASAAIPVMPLYISMVYKIMKQKGLHEGTIEQLNRLFRDFLY..................................
#=GR A0A1H9HZW7_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M3CGI5_9SPHI/82-318              ................................KPGTAGWYNTAAFEKEAHEA..GLYAKSINGDAFSDEIKKQTIALIKQDL..G......QVDLIIYSLA.......S..P..RRT..HP.....K.......T......G..V....SYASVLK....PID..V.P......F.T...N...KTV......DF.........H...T...G...VIS.DITI........NPI.....dN.......E.E.DIANTVAVMGGEDWKFWIEDLKEAGVLADGVKTVAYSYIGPELT..FPIYRNGTIGRAKDDLEGTVPALNDL..L.KD.INGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A0M3CGI5_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q5TIP0_9SPHI/81-316              ................................KTASPGWYNSAAFEKEAHAA..GLYAKSINGDAFSKEIKAKTIELIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..G.T......Y.T...N...KTV......DF.........H...T...G...NVT.EISI........EPA......T.......E.D.DIANTVAVMGGEDWAMWIDALQAENLLAKGAKTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFTIADS..L.KD.IKGS...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGTIEQIQRLYAERLY..................................
#=GR A0A0Q5TIP0_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S2DZS3_9GAMM/82-318              ................................KAGTAGWYNSAAFDKFAKAD..GLYSKSINGDAFSNEARDTAIELIKNEM.gG......QIDLIVYSLA.......S..P..VRK..LP.....D.......T......G..E....LKRSALK....TIG..E.P......Y.V...S...TAI......DT.........N...K...D...TII.QATV........EPA......T.......E.Q.EIEDTVTVMGGQDWELWIDALERAGVLAPGARTVAFSYIGTEIT..WPIYWHGALGKAKVDLDLTAQRLDAR..L.RK.IGGG...ANVAVLKSVVTQASAAIPVMPLYISLVFKVMKEKGLHEGTVDQLSRLFRERLY..................................
#=GR A0A0S2DZS3_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V3PYY8_9GAMM/83-317              ................................KTGTAGWYNSAAFDKAAKQA..GLYSKSINGDAFANETRARAIEIIKNEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..Q.P......F.T...N...TSV......DT.........N...K...D...TVI.EATI........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSAAGVLAEHAKTVAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKQLRSR..H.--.PGLE...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHENPIEQANRLFHDRLY..................................
#=GR A0A1V3PYY8_9GAMM/83-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5P249_9ACTN/84-320              ................................RTGTAGWYRTAATARLAREH..GRDMVFLNGDAFSDAMKEQVADLLAERF.gG......RLDFLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYSSVLK....PVG..S.P......Y.T...T...KTLv...fdEY.........G...A...P...EVK.DVTT........APA......E.......G.D.DIEQTVAVMGGTDWERWITFLADRSLLADGFTTAALSYIGSPLT..AAIYRQGSIGAAKAHLEATARTLDER..L.GKtVRGR...AVTSVNAAAVTQSSTAIPGIALYTGLLRGVLGEA--MVAPVGQLVELW-----dql...............................
#=GR A0A1E5P249_9ACTN/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A069DHR0_9BACL/59-294              ................................RTASAGWYNSAAFEQAANAA..GLKSYSVNGDAFTDETKQKTVEVIREQL..G......QVDLVVYSVA.......A..P..RRL..DP.....A.......T......G..E....MVNSVLK....PIG..D.A......F.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVRNTVTVMGGDDWKLWIKALKDGGVLADHATTIAYSYIGSEIT..RAIYREGSIGQAKDHLEATAHQLNEE..L.SS.TGGR...AYVAVSKALVTQSSSAIPIVPLYVSALYKVMKEKGLHEGTIEQMYRLFADRLY..................................
#=GR A0A069DHR0_9BACL/59-294   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_SHEAM/82-317                    ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEAKAKAIELIKADL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSSLK....PIG..Q.P......Y.S...S...TAV......DT.........N...K...D...TII.EASV........EPA......T.......E.Q.EIADTVTVMGGQDWELWLNALDEAGVLAEGCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAHALNDK..L.AA.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRAEGLHEGCMEQILRMFSERLY..................................
#=GR FABV_SHEAM/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E3H714_ILYPC/82-319                  ................................KVGSAGWYSNIWFREEAEKK..GLIAKNILGDAFSHNMKEEVIKYIKEEF.gG......KIDLLVYSLA.......S..G..MRT..DP.....D.......T......N..K....IYKSNLR....PQG..E.S......L.T...G...FTF......NV.........E...K...E...SME.EVTL........SPA......T.......E.E.DLTNTVKVMGGEDWELWVKALIEANVVSEGFKTMAYSYIGPAVM..EGIYRHGTIGSAKEHLEKTARDLDEV..L.KDeKSGE...AYVAVNKAIVTKASAYIPIFPLYASALMRVMEEKGIEENAIEHTHRLFADMVY..................................
#=GR E3H714_ILYPC/82-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B0HW71_9BACL/81-241              ................................RTASAGWYNSAAFEQAAQDA..GLKSYSVTGDAFAKETKDKTIELIKEKI..G......KVDLVIYSVA.......S..A..RKT..DP.....A.......T......G..E....TFNSVLK....PIG..K.P......F.S...N...KTV......NF.........H...T...G...EVT.DITI........EPA......T.......E.K.EIQETVAVMGGDDWEAWIEALRAAEVLSEDVTTISFSYIAPRSR..--------------------------..-.--.----...-----------------------------------------------------kpsiatvrsvg.......................
A0A1I4Z437_9FLAO/82-318              ................................KPGTAGWYNTAAFEKEAQEA..GLYAKSINGDAFSDEIKKQTIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....VYTSVLK....PIG..E.P......F.T...N...KTV......DF.........H...T...A...NVT.DITI........NPI.....eS.......Q.E.EIDNTIAVMGGEDWKFWMEDLKEAGVLAEGVKTVAYSYIGPELT..HRIYKDGAIGMAKIDLENTVPVINNL..L.AD.LNGV...SYVSVNKALVTQSSSAIPVVPLYVSLLYKVMKAKGIHEGTIEQMQRLFTDRLY..................................
#=GR A0A1I4Z437_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A2MJM4_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHAA..GLYAKSINGDAFSKEIKQQTIDLIKADL..G......QVDLVIYSLA.......S..P..VRQ..HP.....E.......T......G..V....LHRSVLK....PIG..G.V......Y.T...N...KTV......DF.........H...T...G...KVS.EISI........QPA......Q.......D.G.DIENTVAVMGGEDWAMWIDALKAANLLAPGAQTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFEITDS..L.KD.IDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGLHEGTIEQIQRLYAERLY..................................
#=GR A0A0A2MJM4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J8GSM2_9ALTE/81-316              ................................RCASAGWYNTAAFQKAADSA..GLWAKNINGDAFSHEIKAKTIETIKQEL..G......KVDLVIYSLA.......S..P..RRT..DP.....D.......T......G..E....VYSSTLK....PIG..E.T......V.T...T...KNL......NT.........S...K...R...IID.EVTV........EAA......N.......E.A.EIQGTIDVMGGADWELWIKALQEADVLAEGFKTSAYTYIGKKLT..WPIYGHATIGKAKEDLDRAAKAIIDS..T.DS.IKGQ...AYVTSLNAVVTQASSAIPIMPLYISALFKVMKEQGTYEGVIEQIQGLFSENLY..................................
#=GR A0A0J8GSM2_9ALTE/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R1F4C0_9GAMM/82-317                  ................................KTGSAGWYNSAAFDKAAKEA..GLYAKSINGDAFSHECRAKVIELIKAEL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSALK....PIG..E.T......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......N.......E.E.EIQNTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAAAAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRLMRTRLY..................................
#=GR R1F4C0_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A6G626_9DELT/100-340                 ................................RIGSPGWHRNAAIERALKAK..GLQAVSHNIDAFDPAARAGVIASIRETF.pG.....qKLAGVVWSLA.......A..P..KGL..DP.....R.......T......G..K....AVSSALK....PLG..N.T......T.V...V...KTFtg..ptDD.........A...P...P...SIV.NLEI........KPG......T.......P.E.EAIRTQFVMGGQIVEAWMQDLMSAELLAEGHTLLTISYRGSPLN..APLYRDGLIGLAKADLEFTTKALDVQ..L.SKqLQGR...AVAVEGPAVITEASGGIPGVPLYMALLLDVMGAR--HEDPLASMRRMFQEYF-f.................................
#=GR A6G626_9DELT/100-340      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A089WSN7_9PSED/83-320              ................................KAGTAGWYNAAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLVIYSLA.......S..P..VRK..LP.....G.......S......G..E....VVRSALK....PIG..Q.P......Y.T...S...TAI......DT.........N...K...D...CIT.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALAGADVLAEGARTVAFSYIGTEIT..WPIYWHGALGQAKQDLDETALRLDQK..L.SAsIHGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTGDQLNRMFRERLY..................................
#=GR A0A089WSN7_9PSED/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G5BJY8_9BACL/81-316              ................................RTASAGWYNSAAFEKAADAA..GLKSYSITGDAFANETRDKAVELIRSEL..G......QVDLVVYSVA.......S..A..RRT..DP.....N.......T......G..E....VSNSVLK....PIG..Q.A......Y.T...N...KTV......NF.........H...T...G...EIT.SVTL........ETA......T.......E.E.EIRQTVNVMGGEDWELWMDALKQGGVLADNATTIAFSYIGPELT..QAIYREGSIGQAKDHLEATARKMHEQ..L.SA.KGGR...AYVTVAKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQLQRLFADRLY..................................
#=GR A0A1G5BJY8_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_MARMS/82-317                    ................................KTGTAGWYNSAAFDKVAKEE..GLYAKSINGDAFSNEARATVIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSVLK....PIG..Q.P......Y.R...S...TAI......DT.........N...K...D...VII.EAEI........EPA......T.......E.E.EVAATTTVMGGQDWELWMSALQEAGVLAEGTRTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRASAAIDSQ..L.AK.IGGG...ANVAVLKSVVTQASSAIPVMPLYLAMVFKVMREKGIHEGCMDQIYRMFAERLY..................................
#=GR FABV_MARMS/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1JR53_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKEE..GLYAKSFNGDAFSHEAKEKVIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSTLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EVQDTVTVMGGQDWELWINALADAGVLADGCKTVAYSYIGTEIT..WPIYWNGALGKAKMDLDRAAKALDER..L.AA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFTQRLY..................................
#=GR A0A0J1JR53_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S2SKC0_9GAMM/82-317              ................................KPGTAGWYNSAAFDKAAKEA..GLYAKSVNGDAFSNECRAKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.SATV........EPA......N.......E.E.EIQNTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR A0A0S2SKC0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G7GZJ5_9FLAO/82-318              ................................KMGTAGWYNSAAFEKEAHEA..GLYAKSINGDAFSDEIKKETIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYSSVLK....PIG..Q.S......F.T...N...KTV......DF.........H...T...G...VVS.DITI........APV.....eN.......E.E.DISNTVAVMGGEDWKFWIEDLKAAGVLAEGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATVPVLNDL..L.KD.LNGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGTHEGTIEQMQRLFADRLY..................................
#=GR A0A1G7GZJ5_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M8SL48_9ACTN/70-303              ................................RTASAGWYRTAAAARLAAEA..GHDFVFLNTDAFSEKGKREVLDLVEQRF..G......KVDHLIYSLA.......A..P..RRT..DP.....E.......T......G..T....VHHSVIK....PLG..A.P......Y.E...A...PAL......DF.........S...D...Nt.pKVT.SVRL........EAA......T.......E.E.ERYGTEQVMGGADWQLWVRALAERSLLADHFTTAALTYIGSDLT..APIYRQGTIGAAKEHLERTAGRLNAG..V.LA.GRGR...AMTVVAGAAVTQASSAIPSIALYTTFLRTVLGDG--FRTAAQQAADLW-----dql...............................
#=GR A0A0M8SL48_9ACTN/70-303   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6F7B8_9FLAO/81-316              ................................KTATPGWYNSAAFEQEAQKA..GLYAKSINGDAFSDEIKQKTIDMIKSDL..G......QVDLIIYSLA.......S..P..VRL..HP.....K.......T......G..V....LHRSALK....PIG..Q.T......F.S...D...KTV......DF.........H...T...G...VVS.QVSI........EPA......V.......Q.E.DIDNTVVVMGGEDWTMWIEAMKNAGVLADGATTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEISDV..L.KD.LGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKEKGLHEGCIEQMQRLFADRLY..................................
#=GR A0A1M6F7B8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090V5C0_ESCVU/82-317              ................................KPGSAGWYNSAAFDEAAKRE..GLYSKSINGDAFSDECREEVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....K.......T......G..E....VVRSALK....PIG..E.V......Y.T...S...KAI......DT.........N...K...D...QII.TASI........EPA......T.......E.E.EVQNTVTVMGGEDWELWMGALSEAGVLADGVKTIAYSYIGTDLT..WPIYWHGALGKAKEDLDRAAGALRNQ..L.AP.LNGS...ANVAVLKSVITQASSAIPVMPLYISMVFKLMKEKGIHEGCIEQINRLMTTSLY..................................
#=GR A0A090V5C0_ESCVU/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z9L2T0_9GAMM/82-316              ................................RTASPGWYKSAAFTEAAHAR..GLYAKNFNGDAXSQSMKDAVIDCIEKDW..G......QVDLVVYSLA.......A..P..GRT..LP.....S.......-......G..E....TVRSTLK....PIG..E.P......F.S...G...ATI......DF.........N...S...R...ELR.SIAL........EPA......S.......D.D.EIAATVKVMGGEDWEDWMQQLLNRGCLAEGALTTNYTYLGSEVT..WPIYYHGTIGRAKEDLDRAAAALATI..L.SP.VKGR...ADVVVMKGLLTQAASAIPGMSVYLSLLFKAMKAAGTHEGCLEQVERLFRSQLF..................................
#=GR A0A1Z9L2T0_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A4C220_9FLAO/102-337                 ................................RPGSPGYYNTAAFEKHAHAA..GLYAKSVNGDAFSNEIKDQVVQLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....N.......T......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...AVS.EISI........NPA......E.......G.D.DIENTVTVMGGEDWKMWMDALQAENLLSEGAITVAYSYIGPDVT..RPVYRNGTIGAAKDHLEATAFAITDD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAKGIHEGCIEQMQRLFSQRLF..................................
#=GR A4C220_9FLAO/102-337      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F0M0E8_VIBFN/83-319                  ...............................g-VGSAGYFNNLAFKKFAERE..GHIAVNINGDVFSDAVREQVVEAIETYF.eG......EVDLVIYSIA.......S..G..MRR..KP.....G.......S......D..E....FWRSAIK....PIG..D.A......V.S...G...ATI......VL.........E...N...D...TWV.DTTL........EPA......N.......D.E.EIDSTLHVMGGEDWESWIDTLINNESIAPGCKTIAFSYVGPSIT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FDGG...AYATVCKALVTKASVFIPGLSPYMLALYRVMKEKGTHEGCIEQMHRLFSDKLY..................................
#=GR F0M0E8_VIBFN/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D6TJN8_9FLAO/81-316              ................................KTASPGWYNSAAFEDEAKKA..GLYAKSINGDAFSNEVKQQTLDLIKQDL..G......QVDLVIYSLA.......S..P..VRL..HP.....V.......T......G..V....LHRSTLK....PIG..G.T......F.T...N...KTV......DF.........H...T...G...KVS.DVSI........EPA......N.......E.D.DIENTVTVMGGEDWAMWMKALKDADLLADGAQTIAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFEIADE..L.KS.INGR...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYADRLF..................................
#=GR A0A0D6TJN8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D1PDK9_BRAEL/82-314              ................................RSASAGWYNNRAFEIEAEKI..GRSPLTLEGDAFSDELKKTFIERVREKF..G......QLDMLVYSMA.......A..P..VRT..DP.....D.......T......G..K....TYRSVIK....PLG..A.P......V.E...I...KTL......DT.........E...T...G...EVF.QTTL........EPA......N.......E.E.QTAATVAVMGGDDWKRWIDQLADAGVLAPGFRTLNYTYIGSELT..WPIYWNGTLGRAKVDLDSKAEAIRGR..L.GA.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR A0A0D1PDK9_BRAEL/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A5T7Y3_9BACT/82-317              ................................KTGTAGWYNTVAFDKLAKAE..GLYSKSLNGDAFSDEAKRKVIELIKEDM..N......QVDMIIYSLA.......S..P..IRR..LP.....K.......T......G..E....IIRSSLK....PIG..E.I......Y.T...S...IAV......DT.........S...R...D...EII.EAHV........APA......T.......E.Q.EIKDTVTVMGGEDWELWLQALFDAGVLAEGCKTLAYSYIGTKLT..WPIYWNGTLGRAKMDLDRAAIALNEK..L.SG.MGGT...AHVAVLKSVVTQASSAIPVMPLYIAIVFKKMRQEGVHEGCMEHIYRLFRERLY..................................
#=GR A0A2A5T7Y3_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G7ZLA9_9VIBR/82-317              ................................KPGTAGFYNAAAFEKLAHEE..GLYAKSLNGDAFSNEAKQKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....G.......T......D..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...TLI.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWINALSDAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAAELNDK..L.SA.LGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGIHEGCMEQIFRMFSQRLY..................................
#=GR A0A1G7ZLA9_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X1MYI4_9VIBR/83-318              ................................KPASAGWYNNEHFTDLARSE..GRIAINIVGDAFSDETRQQVIEAIETYF.eG......EVDLIVYSLA.......T..G..LRP..KG.....S.......-......G..E....YWRSAIK....TIG..E.P......V.T...G...ATI......ML.........E...N...D...EWV.ETTV........NAA......T.......D.D.EIESTIKVMGGEDWESWVDLLINQEQIAQGCQSIAFSYIGSKLT..HPIYHTGTLGRAKVDLHQSSHFIHRK..L.AN.FGGG...GYAVVCKALVTKASVFIPAFTPYMLALYKVMKKKGTHEGCIEQMQRLFTENL-s.................................
#=GR A0A1X1MYI4_9VIBR/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0M2K5B8_9GAMM/82-317              ................................KPATAGWYNSAAFEAAARAK..GLYATSINGDAYSNEVKEKTIELIKQDL..G......QVDLVVYSLA.......A..P..RRI..HP.....V.......T......G..E....VFNSTLK....PVG..K.T......L.V...T...RGL......NT.........D...K...E...TIT.DITL........EPA......S.......E.E.EIAGTVAVMGGEDWQMWIDALKSAGVLVDGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKRVLSIRES..L.AE.IAGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A0M2K5B8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E8M5U3_9VIBR/83-319                  ...............................g-VGSAGFYNNIAFKKNAEKE..GRLAINIQGDAFSKSVKDEVVEAIETYF.eG......EVDLIIYSVA.......S..G..VRP..NP.....E.......T......G..E....MWRSAIK....PID..Q.D......V.S...G...ATI......ML.........E...D...D...SWH.TSKL........KAA......S.......N.E.EAEQTIKVMGGEDWEAWVDRLINSESIAHGCRTIAFSYMGPALT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FEGG...AYATVCKALVTKASVFIPGLSPYIIALYKVMKEKGTHEGCIEQMQRLFSDKLY..................................
#=GR E8M5U3_9VIBR/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5PX83_9RHIZ/82-315              ................................KTASAGWYNNRAFEIRAKAA..GRVAVTIEGDAFSDAVKAEAIEAIRQSL..G......QVDLIVYSVA.......S..P..VRT..DP.....K.......D......G..V....SYRSAIK....PYG..A.A......V.T...S...KTL......NT.........G...T...G...EVS.EISV........EPA......T.......E.E.EAAATVKVMGGEDWELWIAALAEAGVLADGFQSLNYTYLGSKLT..WPIYHKGTLGKAKGDLDRAAAVIRGQ..H.G-.-AHA...AHVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIQQIDRLFRHKL-a.................................
#=GR A0A0F5PX83_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0K6GY61_9GAMM/82-317              ................................KTATAGWYNTAAFHNAAEQE..GLYAHTINGDAFSNEIKQEVIEKIKQDL..G......QVDLVIYSLA.......S..P..KRK..DP.....V.......T......G..D....LYSSTLK....PIG..Q.A......Y.T...T...KTY......HT.........D...K...D...QVT.EITL........EPA......N.......D.D.EIQQTIKVMGGEDWELWLAALHDAGVLAPNAKTTAYTYIGKKLT..WPIYGHATIGKAKEDLDRAAAAMRTR..Y.TD.LNLE...AYVSSLKALVTQASSAIPVMPLYISLIYGVMKEEGTHEGCIEQTHRLLRDGLY..................................
#=GR A0A0K6GY61_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N8HJI0_9GAMM/84-319              ................................KAGTAGWYNSAAFDKFAKQE..GLYSQAINGDAFSHETRAKAIELIKANM..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSVLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......E.Q.EIEDTVTVMGGQDWELWMQALDDAGVLAEGARSVAFSYIGTEIT..WPIYWHGALGRAKEDLDRAAGSIHEK..L.SA.KGGR...AHVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLNRFYAERFY..................................
#=GR A0A0N8HJI0_9GAMM/84-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6P1R8_9BACL/81-316              ................................RTATAGWYNTAAFEEEAHRE..GLYAKSINGDAFSNELKQETIHLIKQDL..G......QVDLVIYSLA.......S..P..KRK..HP.....V.......T......G..E....VFSSVLK....PIG..E.S......Y.T...N...KTV......DF.........H...T...G...TVS.EVSI........EPA......N.......E.D.EIRQTVAVMGGEDWEMWIDALDKAGVLAEGATTLAYSYLGPSLT..WPIYRDGSIGKAKIDLDATSHRLDRR..L.KE.QGGR...AYVSVNKAVVTQSSSAIPVVPLYISILFKLMKEQGTHEGCTEQIYRLLAERLY..................................
#=GR A0A1I6P1R8_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A227NN83_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......D.E.DITNTVAVMGGEDWTMWIDALKAENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KE.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFKDRLY..................................
#=GR A0A227NN83_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8ZGZ6_9FLAO/82-317              ................................KPATPGWYNTVAFEKEAHEK..GLYAKSINGDAFSNEIKQKTIDLIKSDL..K......KIDLVIYSLA.......S..P..RKV..HP.....D.......T......Q..Q....VYNSVIK....PIG..K.T......F.E...N...KTV......DF.........H...S...G...TVS.NVVI........EPC......T.......E.E.EVNNTVEVMGGDDWERWIDILKKEDVLSSECLTIAYSYVGPEVT..TPIYRNGSIGRAKDHLEQSAFKISEK..L.KD.IDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKAMKEEGVHEGCIEQIYRLFETKLF..................................
#=GR A0A1B8ZGZ6_9FLAO/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E9CJW7_9GAMM/82-317                  ................................KTGSTGWYNSAGFDKVAKEA..GIYAKSINGDAFSNECRQSVIDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLV.EALV........EPA......N.......E.K.EIADTVKVMGGQDWQLWMDALDEAGVLADNIQTVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAQAIDQK..L.KA.KGGA...AYVAVLKSVVTQASSAIPVMPLYISIVFKIMKEQGIHEGCIEQVQRLFASKLY..................................
#=GR E9CJW7_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H3XEU2_ALKAM/82-317              ................................KTASAGWYNTAAFEQEASKA..GLWCKHLNGDAFTDELKAKTIEVIQQEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......S......D..E....IYSSVLK....PIG..K.A......Y.T...E...KNL......NT.........S...K...R...VIE.EVSV........EPA......N.......D.E.EIFNTVKVMGGEDWERWLDQLNAAGVLADNCQTVAYTYIGKELT..WPIYGKATIGKAKEDLDRAAAALTAK..L.AD.KKGK...AYVASLKAVVTQASSAIPIMPLYISLLYRVMKAEGSHEGCIEQIDGLFRQGLY..................................
#=GR A0A1H3XEU2_ALKAM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G7UUB8_PSEUP/82-318                  ................................KPGTAGWYNAAAFDKFAKAQ..GLYSRSINADAFSDQTRAKVIELIKAEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....A.......T......G..E....LKRSALK....PIG..S.T......Y.Q...S...TAI......DT.........N...K...D...TII.HASI........EPA......T.......E.Q.EIQDTVAVMGGQDWELWINALGEAGVLAPAAKTVAFSYIGTEIT..WPIYWHGALGKAKADLDATAKRLNAR..L.SA.NGGS...ANVAVLKSVVTQASSAIPVMPLYISIIFKVMKQQGLHEDAIEQLNRLFRARMY..................................
#=GR G7UUB8_PSEUP/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6C3V2_9ALTE/82-317              ................................KTGTAGFYNAAAFQQAADKA..GLWAKNINGDAFSHQAREKAIKVIQQEM..G......KIDLVVYSLA.......S..P..RRQ..DP.....D.......T......G..D....VYSSVLK....PVG..K.T......Y.V...S...KSL......NT.........D...T...M...KIS.EATV........EPA......S.......E.E.EIANTVKVMGGEDWQLWMSALQQAGVLAEGCKSVAYTYLGEKLT..WPIYGKATIGKAKEDLDRAAREINES..L.AP.LAGD...AKVGVLKAVVTQASSAIPIMPLYLSTLFKVMKEQGSHEGCIEQLYRLFTEGLY..................................
#=GR A0A1Y6C3V2_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0L8EXI3_9CLOT/82-318              ................................RLGTPGWYNNIFFKEFAEKE..GLIAKNFIGDAFSDEAKDEVIKYIKEKF..G......KIDLFVYSVA.......A..P..RRK..DY.....K.......T......G..I....VYNSKIK....TTS..G.E......F.E...G...PTI......DI.........E...K...G...EMV.LKKV........NSA......T.......V.D.EIEDTRKVMGGEDWENWCDILLKEECFSKGALTISYSYIGSPRT..YKIYREGTIGAAKKDLENIAHEINEK..L.KKeIDGK...AFVSVNKALVTKASAYIPTFPLYAAVLYKVMKEKGIHENCIMQMQRMFSEKIY..................................
#=GR A0A0L8EXI3_9CLOT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N8P2U0_9GAMM/82-317              ................................KTGSAGWYNSAAFEKQAHQD..GLYAKSINGDAFSHEMKDKVIALIKKDL..G......QIDAIIYSVA.......A..P..VRK..MP.....D.......T......G..E....VIRSSLK....PIG..E.T......Y.I...S...TAI......DT.........N...K...D...III.EAQV........EPA......S.......E.E.EIANTVTVMGGQDWELWLSALGDAGVLAKGVKTVAYSYIGTELT..WPIYWDGALGKAKIDLDRASTAIQAQ..L.AP.LQGE...AYVSVQKSVVTQASSAIPVMPLYISMVFKIMKEKGLHEGCMAQIYRLFTTQLY..................................
#=GR A0A0N8P2U0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A101XRS1_9BACL/81-316              ................................RTATAGWYNTAAFEKQARDA..GLYAKSINGDAFSDAVKAETIETIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..E....TFVSALK....PIG..K.V......Y.Q...N...KTV......NF.........H...T...G...EVS.VVTL........EPA......S.......D.D.EIQQTVHVMGGEDWSMWIHELRAAGVLAEGVVTLAYSYIGPEVT..KAVYRDGTIGRAKDDLEATAHALTKE..M.SD.IGGK...AYVSVNKAVVTQSSSAIPVVPLYISLLFRVMKEKGLHEGCTEQMYRLFADRLY..................................
#=GR A0A101XRS1_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2CQU1_9GAMM/82-316              ................................KPGTAGWYNSWAFDEAAKQA..GLYSKSMNGDAFANETRARAIEIIKNEM.gG......PIDLVIYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TVG..E.T......F.T...A...TSV......NT.........D...K...D...EVI.QASV........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSQAGVLAPDARTIAYSYVGTEIT..WPIYWHGTLGKAKQHLDNTAADLRQR..H.--.PGLD...ARVGVMKSVVTQASAAIPVIPLYVSLAFRIMKEKGIHEGCIEQANRLLREFMY..................................
#=GR A0A1I2CQU1_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085GB46_9GAMM/82-317              ................................KTGSAGWYNAAAFDKAAKEE..GLYSKSVNGDAFSNECRDTVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......S......G..E....LVRSALK....PIG..E.P......Y.Q...S...TAL......DT.........N...K...D...KLV.SAVV........EPA......N.......E.Q.EIADTIKVMGGQDWELWINALADAGVLADNAKSVAYSYIGTELT..WPIYWHGTLGKAKEDLDRAAHAIDTK..L.KA.KGGS...ANVAVLKSVVTQASAAIPVMPLYISIVFKIMKEQGIHEGCIEQIQRLFATKMY..................................
#=GR A0A085GB46_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0G3LMK9_XANCT/82-318              ................................KAGTAGWYNAAAFDKHAKAA..GLYSKSINGDAFSDEARAQVIELIKTEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PIG..Q.T......Y.T...A...TAI......DT.........N...K...D...AII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWIDALAAAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKVHLDQTAQRLHAR..L.QQ.SGGS...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIDQLDRLFRERMY..................................
#=GR A0A0G3LMK9_XANCT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C9P431_VIBME/82-317                  ................................KTGTAGFYNAAAFDKLAHQE..GLYAKSLNGDAFSDQAKQKAIELITQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....VVRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...III.EASV........EPA......T.......E.Q.EINDTITVMGGQDWELWMQALDDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAQALNEK..L.AA.KQGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGIHEGCMEQIYRLFSQRLY..................................
#=GR C9P431_VIBME/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I8UAZ4_9ALTE/82-317                  ................................KTGSAGWYNTAAFEAAADAA..GLWNKHLNGDAFTDELKAKAIDLIRSEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......T......G..E....VYSSVLK....PIG..Q.A......Y.T...A...KNL......NT.........S...K...R...EIE.EVSV........EPA......N.......D.D.EIFNTVKVMGGEDWERWLDQLNAAGVLADNCQTVAYTYIGKELT..WPIYGKATIGKAKEDLDRAAAAITAK..L.SA.QHGK...AYVASLKALVTQASSAIPIMPLYISLLYRVMKAEGTHEGCIEQINGLFRQGLY..................................
#=GR I8UAZ4_9ALTE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8P6X0_HALEL/83-318              ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEAREKAIELIKQDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......E.Q.EIADTIDVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGRAKEDLDRAAGEIDKR..L.GQ.QGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFGERLY..................................
#=GR A0A1B8P6X0_HALEL/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R1CAT1_9BACL/81-316              ................................RTASAGWYNSAAFEEAAAAA..GRKSYSIVGDAFSDEIKAKTIDLIRTEL..G......QIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PLG..G.T......Y.T...N...KTV......NF.........H...S...G...DVT.QATI........EPA......T.......E.D.ELRQTIAVMGGEDWQMWIDELSQAGALAEGATTVAYSYIGPEIT..HAVYREGTIGAAKNDLEATAHRLNEQ..L.SH.QGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQMYRLFSDRLY..................................
#=GR A0A1R1CAT1_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D5VCF0_9BURK/82-317              ................................KAGTAGWYNTAAFEKFAKEK..GLYATSINGDAFSDEVKQRTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......T......G..Q....VFTSTLK....PVG..K.A......V.K...L...RGI......DT.........D...K...E...VVK.ETVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALLDAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKDSMY..................................
#=GR A0A0D5VCF0_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B7GS11_9BACT/82-318              ................................KTGSAGWYNTAAFTTAAKAA..GLYARNFNGDAFSDALKAEVLAAIKADL..G......QVDLIVYSLA.......S..P..RRT..HP.....K.......T......G..V....VHKSVLK....PVG..Q.S......Y.T...N...KTV......DT.........D...K...G...IVS.QITI........DPA......S.......E.T.EITDTAAVMGGEDWEMWINALSDAGLIAPGATSVAYSYIGPEVT..WPIYKNGTIGLAKNDLERAAKSINAT..L.KThGYGR...AFISVNKALVTQASSAIPVVPLYISILYKVMKAKGTHEGCIEQIQRLFAGQMY..................................
#=GR A0A1B7GS11_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5L5A6_9SPIR/82-319                  ................................KTATPGWYNNQAFSEFAKRD..GLKEKTIVGDAFLESSKESIIKQAKEFF.dG......KIDILIYSLA.......T..G..IRK..DE.....K.......E......N..I....TYRSTLK....PIG..K.K......Y.N...G...IGV......DF.........M...K...E...ELI.NVEI........EPA......T.......E.E.DIKATVKVMGGEDWSLWIEDLIKADMLSENALTLAYSYIGPEIT..KAIYRDGTIGKAKDDLEETAIKLDKM..M.QDkLKGH...AYVSVAKAVVTRASAVIPAMPLYISILFKITKDKGIHEGCIEQMYRQFNDKLY..................................
#=GR R5L5A6_9SPIR/82-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H8VRB3_9FIRM/81-316              ...............................t-TATAGWYNTVTFEKEAAAA..GLYSRSINGDAFSNEIKEKTIELIKQDL..K......KIDLVVYSIA.......A..P..RRT..DP.....A.......T......G..E....MSSSVIK....PIG..K.P......F.T...S...KTI......NL.........N...S...H...DLY.DVTL........EPA......S.......E.E.EIRQTVKVMGGEDWQLWLETLENAGVLAEGVKTVSYSYIGPELT..YPIYTGGTIGKAKEHLVATAKLLNDQ..L.ES.VGGQ...AFVSVNKALVTQASAAIPVVPLYLMLLTKVMESKNINEDCIEQIYRLFADRLY..................................
#=GR A0A1H8VRB3_9FIRM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A108U680_9GAMM/82-319              ................................KPGTAGWYNSAAFDKFAKAK..GLYSKSINGDAFSDEARAQVIELIKNEM.gG......QVDLIVYSLA.......S..P..VRK..LP.....G.......G......G..E....LKRSALK....TIG..E.P......Y.T...S...TAI......DT.........N...K...D...TII.QATV........EPA......T.......E.Q.EIEDTVTVMGGQDWELWIDALERADALAPGARTVAFSYIGTEIT..WPIYWHGALGKAKVDLDQTARRLDAR..L.SQkLGGG...ANVAVLKSVVTQASSAIPVMPLYISLVFKVMKEKGLHEGPIDQLDRLFRERMY..................................
#=GR A0A108U680_9GAMM/82-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F8EZE4_TRECH/86-327                  ................................KPGTPGWYDNLAFDTEAAKA..GLISKTLDGDAFSNEMKDQAIAAIREVA..AkadipaQVDLVIYSLA.......S..P..VRT..DP.....R.......D......G..V....MYRSVIK....PIG..Q.A......Y.S...G...KTM......DM.........L...T...G...KIS.IASA........EPA......T.......E.E.EIAHTVKVMGGEDWELWIDALQSAGVLAPQVRTLAYTYIGPELS..WPIYKNGTIGKAKEHLEKTSHLLHER..L.SK.TGGA...AWVSVNKALVTRASAVIPIIPLYISALFKVMKEKGLHEGCIEQLVRLYKDRLY..................................
#=GR F8EZE4_TRECH/86-327       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H9V9D3_9SPHI/81-316              ................................KTASPGWYNSAAFDHEAHQA..GLYAKSINGDAFSKEIKDKTIELIKADL..G......QIDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..G.T......Y.T...N...KTV......DF.........H...T...G...NVS.TISI........EPA......N.......E.E.DIANTVAVMGGEDWSMWIDALKAENLLAEGATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFTITDK..L.KD.LNGK...AFVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGTIEQIQRLFAERLY..................................
#=GR A0A1H9V9D3_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H6IB36_9FLAO/82-318              ................................KMGTAGWYNSAAFEKEAHAA..GLCAKSINGDAFSDDIKKQTIDLIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..Q.P......F.T...N...KTV......DF.........H...T...G...VVS.DITI........NPV.....eN.......D.E.DIANTIAVMGGEDWKFWIEDLKAAGVLAEGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATVPVLNEL..L.KD.LHGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGTHEGTIEQMQRLFADRLY..................................
#=GR A0A1H6IB36_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
L0MEZ9_9GAMM/82-317                  ................................KPATAGWYNSAAFDKAAKEE..GLYAKSINGDAFSNECREKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QIV.SATV........EPA......T.......E.E.EIENTITVMGGQDWELWMSALEGAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.SA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVYRLMRTRLY..................................
#=GR L0MEZ9_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4J0D9_9ACTN/83-319              ................................RTATAGWYRTAAAAQLAAEG..GHDIRFVNIDAFATDAKTQVMDLLEQHY..G......PVDHLIYSLA.......A..P..RRT..DP.....A.......T......G..T....VHHSVIK....PLG..A.A......Y.E...A...PAL......DF.........Sg.tD...P...KVT.RARI........EAG......T.......E.S.ETRATVAVMGGDDWALWVRALAARRLLADKFTTAALTYVGSEVT..APVYREGTIGAAKEHLEQTALDLNSSaaL.KE.QDGR...AFTVVAGAAVTQASSAIPSIALYTAFLRTVLGAQGFR-TTAEQAVDLWD----ql................................
#=GR A0A0F4J0D9_9ACTN/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U3AHQ2_9VIBR/82-317                  ................................KPGTAGFYNAAAFDKLAHAE..GLYSKSLNGDAFSNEAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSALK....PIG..D.T......Y.T...S...TAV......DT.........N...K...D...QII.EASI........EPA......T.......E.Q.EIADTVTVMGGEDWELWINTLSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRASTALNEK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMQQIYRMFSQRLY..................................
#=GR U3AHQ2_9VIBR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y0MYY0_9FLAO/81-316              ................................RPGSPGFYNTAAFEKHANAA..GLYAKSINGDAFSNEIKEQVVNLIKEDL..G......QIDLVIYSLA.......S..P..VRT..DP.....T.......T......G..K....RYKSVLK....PVG..G.E......F.S...N...KTV......DF.........H...T...G...TVS.DISI........KPA......E.......G.E.DVENTIKVMGGEDWKMWMDALQSENLLAEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTITDD..L.KS.LGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A1Y0MYY0_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W8JD56_9VIBR/83-320              ...............................h-SGSAGFYNNYYFKQYAQRE..GRTAINIQGDVFSRRTKEAVIEAIETYF.eG......EVDLIIYSVA.......S..G..KRR..KA.....E......gS......D..S....FWYSAIK....PIG..Q.S......I.Q...S...VLL......DL.........G...H...D...QWH.DVIL........EPA......L.......E.E.EIDSTLKVMGGEDWEAWIDALINSESIADGCQSIAFSYIGSALT..HPIYLDGTLGRAKVDLHQTSHSLNMK..L.AN.YGGH...AYAVVCQALLTRASIFIPGLSPYLIALNQAMHALGVNENCNSQMQRLFTTKLY..................................
#=GR A0A0W8JD56_9VIBR/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0G9H8Y2_9GAMM/82-316              ................................KTGTAGWYNSAAFDKLATQA..GLYSRSINGDAFSDETRAKAIEIIKADM.dG......PIDLVVYSLA.......S..P..VRK..LP.....G.......T......D..T....VVRSALK....TIG..E.T......F.T...A...SSV......DT.........N...K...D...AVI.QASV........EPA......T.......Q.Q.EIDDTVTVMGGEDWALWIAALSDAGVLAANATTVAYSYVGTEIT..WPIYWHGTLGQAKQHLDRTAKQLGER..H.--.KGLR...SYVGVMKSVVTQASSAIPVIPLYVSMVFKIMKAKGIHEGTIEQINRLFHERLY..................................
#=GR A0A0G9H8Y2_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5CS16_9GAMM/82-314              ................................RTASAGYYNSAAFEEEAHKA..GLYAKSINGDAFSDEIKAKAIEMIKEDM..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....LYSSVLK....PIG..K.S......Y.T...A...KNL......NT.........D...K...L...EIS.DISV........DPA......N.......E.E.EIAATVKVMGGEDWELWLDALNQAGVLADGCKTVAYTYIGEKLT..WPIYGHATIGKAKEDLDRAAKAISDS..G.K-.--AD...ANVAVLKALVTQSSSAIPVMPLYISLVYKVMKEEGTHEGCIEQLYRLYTEGLY..................................
#=GR A0A1M5CS16_9GAMM/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A125Y669_AERCA/81-315              ..............................gl--GSAGWYNNIWFRQAAEQA..GRIAVNLIGDAFSDTMRQQAIDVIRQQL..G......QVDLVVYSLA.......S..G..VRV..MP.....D.......-......G..T....QVRSVLK....TTG..Q.P......L.Q...G...WGL......DL.........E...H...D...ALV.QQSL........VPA......T.......P.E.EIRDTVTVMGGEDWQRWMQALQQADCLAPGARTVAYSYIGPEST..YPLYRDGTIGYAKEHLHATAETINLQ..L.AG.IGGH...AWVSVCKALVTKASVFIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFADKMY..................................
#=GR A0A125Y669_AERCA/81-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W4S955_9XANT/82-318                  ................................KAGTAGWYNSAAFDKHAKAA..GLYSKSINGDAFSDAAREKVIELIKTEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PIG..N.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......S.......E.Q.EIEDTVTVMGGQDWELWIDALEGAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLNAR..L.AK.RGGS...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR W4S955_9XANT/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A010SJ80_PSEFL/82-317              ................................KLGTAGWYNTAAFHSFAESE..GLYAKSINGDAFSDEVKRLTIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..DP.....K.......T......G..E....VYSSTLK....PVG..K.S......V.T...Q...RGL......NT.........D...K...E...EVN.VTTL........AEA......T.......Q.E.EIDGTVKVMGGEDWQMWIDALHEAGVLAEGAKTTAFTYLGEKLT..HDIYWNGSIGAAKKDLDQKVLSIRER..L.AD.LGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYALYKDSLF..................................
#=GR A0A010SJ80_PSEFL/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
B5JM92_9BACT/82-318                  ................................RCASAGWYNSIAFEKQAKAA..GLYAKSLNGDAFSDELKAQAIERIKADM.gG......KIDLIVYSIG.......A..P..RRT..DP.....K.......T......G..E....VYKSAIK....PIG..K.P......F.S...N...KYL......DT.........D...K...K...LID.VATL........EPG......T.......D.E.EIQGTVKVMGGEDWELWIDALSEAGVLAEGFKSVAYDYIGPQFT..WPIYKDGALGQAKLDVRRAKAAINEK..L.AP.IGGK...AFVSVNKALVTQSSSAIPGVNLYITVLYKVMKEKGTHEGCIEQMYRLFADRLY..................................
#=GR B5JM92_9BACT/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0L0JCE3_9ACTN/86-322              ................................RTATAGWYRTAATADLARTA..GRDLVFLNGDAFSDGMKDQVAELIETRF.gG......KLDHLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..Q.A......S.R...T...KTLv...fdDQ.........G...V...P...EVR.EVET........APA......E.......G.D.DVEQTIAVMGGADWERWIDHLSARDLLAEGFSTAALSYIGSHLT..EAIYRQGTIGAAKAHLEAAARTLDER..L.AKtVGGK...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGDD--MVSPIGQLAALWD----ql................................
#=GR A0A0L0JCE3_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2YTP7_9GAMM/85-320              ................................KPGTAGWYNAAAFDRYAKEE..GLYSKAINGDAFAHETREKAIELIKQDL..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......E.Q.EIADTIQVMGGEDWELWIDALDRAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDKR..L.GE.KGGS...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIEQLNRLFRDRVY..................................
#=GR A0A1I2YTP7_9GAMM/85-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C5AK57_BURGB/82-317                  ................................KPGTAGWYNTAAFEKFAKAE..GRYARTINGDAFSDEVKRVTLETIKADL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....VHQSTLK....PIG..K.T......V.Q...F...RGL......DT.........D...R...E...VIR.ETVL........EPA......T.......Q.E.EVDNTVAVMGGEDWKMWVDALREAGLLAEGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDRTVIGLRES..L.AP.LGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKETGTHEGCIEQVYGLLHDTLY..................................
#=GR C5AK57_BURGB/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P9GU56_9BACL/81-316              ................................RTATAGWYNTVAFEEMARDA..GLFAATVNGDAFSDAIKAEVIDLIKEHF..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..E....SFSSVIK....PVG..Q.A......F.T...S...KTV......DV.........H...S...G...KVS.EVTI........EPA......T.......E.D.EVKNTIAVMGGEDWEMWINALDEAGLLADNATTVAYSYIGPELT..YAIYREGTIGRAKDDLEATAKRMNAK..L.SG.RGGR...ALVSVNKAVVTQSSSAIPVVPLYISILFKLMKEQGLHEGCIEQMYRMYKDRLY..................................
#=GR A0A0P9GU56_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I5N664_9BACT/81-316              ................................KTASPGWYNSAAFQDQAKKA..GLYAKSINGDAFSEEVKNKTIDLIKADL..G......KIDLVIYSLA.......S..P..VRT..HP.....V.......T......G..V....THRSVLK....PIG..N.T......F.T...N...KTV......DF.........H...T...G...IVS.DITI........TPS......N.......E.E.DIENTVAVMGGEDWEMWIDALLKADVLAENAMTVAYSYIGPGLT..EAVYRKGTIGRAKDHLEATAFQISDK..L.KG.IHGK...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKEKGIHEGCIEQIQRLFSERLY..................................
#=GR A0A1I5N664_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R9PNE6_AGAAL/82-317                  ................................KPGTAGWYNAAAFDQKAREA..GLYAKSINGDAFSHQAKQAAVDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...TII.EASV........EPA......T.......E.Q.EIADTVTVMGGEDWELWIKALDEAGVLAEGCKTVAYSYIGTALT..WPIYWDGALGKAKMDLDRAATALNEK..L.SS.KQGS...ANVAVLKSVVTQASSAIPVMPLYISMVFKIMKEQGLHEGCMEQIYRLFNERLY..................................
#=GR R9PNE6_AGAAL/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090P405_9VIBR/82-317              ................................KPGTAGFYNAAAFDKLAGEA..GLYAKSLNGDAFSNEAKQKAIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......S......G..E....LIRSALK....PIG..Q.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIKDTVTVMGGEDWELWVNALADAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAASALNTK..L.AE.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A090P405_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A078KT49_9FIRM/81-315              ................................RTATAGWYNTAAFQKQALDD..GLYAKSIMGDAFSKETKDKTIELIKRDL..G......SVDLVVYSLA.......A..P..RRT..VD.....S.......-......G..K....TYSSVIK....PIG..K.A......Y.T...G...KTI......DM.........N...T...H...KLS.TATV........EPA......T.......E.E.EIEGTIKVMGGEDWRLWIEALKGAGVLAQGAITLAYSYIGPEIT..HAIYADGTIGMAKKDLEKTAKDITDL..L.AP.INGK...AYVSVNKAVVTQASSAIPAVPLYTSILFKVMKKLGIHEGCIEQMYRMFAEKLY..................................
#=GR A0A078KT49_9FIRM/81-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G4F736_9GAMM/83-318                  ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMDALDQAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAATAIDSK..L.KA.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGEHLY..................................
#=GR G4F736_9GAMM/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W0LJL2_9GAMM/82-317                  ................................KPATAGWYNSAAFDKAAKEE..GLYAKSINGDAFSNECRAKVIELIKADL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......T.......E.E.EIQNTITVMGGQDWELWMSALEEAGVLADGAKSVAYSYIGTNLT..WPIYWHGTLGRAKEDLDRAATAIRGS..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVYRLMRTRLY..................................
#=GR W0LJL2_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A209DCV8_9BACL/82-317              ................................RTASAGWYNSAAFERKAAEA..GLKSFSVAGDAFADDTKAKTVEVIRQEL..G......KVDLVVYSVA.......T..A..RRV..DP.....H.......T......G..E....IANSVLK....PIG..T.S......Y.T...N...KTV......NF.........H...N...G...EVS.DVTL........HPA......T.......E.E.EIAATVTVMGGDDWKLWIDTLAEGGVLADGATTIAYSYIGPELT..QPIYREGTIGRAKDHLEQTAHQLNEQ..L.AA.HGGR...AFVSVSKALVTQSSSAIPVVPLYISALYQVMKEKGLHEGCIEQTYRLFADRLY..................................
#=GR A0A209DCV8_9BACL/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S1J268_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKTDL..G......QVDLVIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVS.EVFI........APA......N.......E.E.DIANTVAVMGGEDWTMWMDALKAENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFSITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A1S1J268_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E4IV69_9BURK/82-317              ................................RPGSPGWYNTAAFHRAAEAE..GRYAKSINGDGFSDEVKQLTIDAIRADL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSVLK....PIG..K.S......V.S...L...RGL......DT.........D...S...G...TVK.ESVL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDQKVLGIRET..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVHGLYADSLY..................................
#=GR A0A1E4IV69_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0T9PEP0_9GAMM/82-318              ................................KPGTSGWYNSAAFHKFAEQK..GVYAKSINGDAFSDKIKQLTIEAIKQDL..G......QVDQVIYSLA.......S..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..H.E......V.T...V...RSL......DT.........D...K...E...VIK.EIVL........QPA......T.......Q.T.EIDNTVAVMGGEDWQMWIDALLEAGVLADGAQTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLTIRNS..L.SAhGGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYALYKDSL-c.................................
#=GR A0A0T9PEP0_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H0J5I0_9GAMM/83-318                  ................................KTGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSSLK....PIG..D.T......Y.R...A...TAI......DT.........N...K...D...VII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMEALDHAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAAAIDAK..L.QT.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGEYLY..................................
#=GR H0J5I0_9GAMM/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1J5MRD1_9GAMM/82-317              ................................KPGSAGYYNAAAFDKAATEA..GLYAKSFNGDAFSHEAKAKVIEAIKEDL..G......QIDLIVYSLA.......A..P..VRK..LP.....E.......T......G..E....VVRSCLK....PIG..E.T......Y.T...S...TAI......DT.........N...K...D...TII.EASV........EPA......S.......E.Q.EIEDTITVMGGQDWELWVNTLADAGVLSDTCKTVAYSYIGTEIT..WPIYWDGALGKAKEDLDRAAHLLNER..L.GK.TGGQ...ANVAVLKSVVTQASSAIPVMPLYIAMAFKIMKEKGLHEGCMEQVFRLFSTQLY..................................
#=GR A0A1J5MRD1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0X8H206_9FIRM/82-317              ...............................s-SGSAGYYNNLFFHEIAQEK..GLLCDDLNADCFSHETKDAVINHFKSCN..K......TIDLVVYSVA.......S..G..IRI..DP.....D.......T......H..V....KTVSSLK....PIQ..Q.T......Y.S...G...YTV......DI.........A...R...E...TLK.YESV........EPA......T.......P.Q.EIEDTVTVMGGADYALWAQALSKAQVLSEGCTFVTYTYLGAQST..HAIYKNGTIGAAKKDLNRANQDVNDI..L.AP.LHGK...AVISASKAVVTKASVFIPTMALYASALFQVMKERGTHETTVEHTYRLFKEMIY..................................
#=GR A0A0X8H206_9FIRM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G4QJ38_GLANF/86-321                  ................................KTGTAGWYNTAAFHDQAKAA..GLYAETINGDAFSDDIKKTTIEKIKQDL..G......QVDLIIYSLA.......S..P..RRT..DP.....D.......T......G..E....VYKSTLK....PVG..Q.G......Y.T...T...KTY......DT.........D...K...D...KVH.EITL........EPA......N.......Q.D.EIDQTVKVMGGEDWERWLVMLNEAGVVAKGAKTTAYTYIGKELT..WPIYGQATIGLAKEDLDRAASAIIDR..L.KS.NNVS...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIAGLYTTCLY..................................
#=GR G4QJ38_GLANF/86-321       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A257M0C9_9BACT/82-317              ................................RTGTAGWYNSAAFEKEAAAA..GLYARSFNGDAFSNEMKREVIEAIKADL..G......QVDCVIYSLA.......S..P..RRV..HP.....D.......S......G..E....VLKSVLK....PIG..Q.T......Y.T...N...KNL......NT.........T...T...K...VVD.SVTI........ESA......N.......D.D.EIAQTISVMGGEDWEMWLDALKDAGVLAAGVTTVAYSYIGPEVT..WPIYKNGTIGRAKEDLERAQRALDEK..L.AS.LGGK...AWVSVNKALVTQASSAIPVVPLYISLLYKIMKAKGSHEDTIEQMDRLFRDRL-c.................................
#=GR A0A257M0C9_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A291QJX2_9ACTN/84-319              ................................RTGTPGWYNTAALEGELARI..GRYGRTVVGDAFSDEVKHRTARAVRDDL..G......QVDLVLHSLA.......A..P..RRT..HP.....E.......T......G..R....THRSAIK....PLG..A.P......F.T...A...KTY......DS.........A...T...R...EVA.AATL........EPA......S.......D.E.EIGDTVAVMGGDDWRRWMDVLGDAGVLAPDVTTLAFSYQGNAAL..APTYRAGTLGRAKEHLEATAHALHDR..L.AP.TGGR...AVTAVMRAMVTQASRVIPAQTLYTVILSRVMRERGLEEGPVAQAHRLLGEHLY..................................
#=GR A0A291QJX2_9ACTN/84-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M4WD50_9LACT/83-319              ...............................n-LGTAGWYNNIYFKQAAEKE..GLIAKNFVQDAFSHETKQDVIRYIKKEF.dG......KVDLVVYSLA.......S..G..IRF..DP.....D.......T......G..E....RISSVIK....SIG..Q.E......V.V...G...PNV......NM.........Q...K...Q...EFY.EQTL........EPA......T.......E.E.EIEDTVSVMGGEDWLLWMKALKEADVLAEGIQTVNYSYLGSDLN..KPYYGEGTLGQAKADCEVKSAKINEL..L.AD.INGK...STIVVATAVTTKASSVIPFFPVYCMGLYRVMADKGTHETPIMHQDRIYRKMLY..................................
#=GR A0A1M4WD50_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E2V400_9GAMM/83-318              ................................RTGTAGFYNAAAFEEKAKAE..GLYSKSFNGDAFSDEMKDRVVETIKAEM..G......KIDLVVYSLA.......S..P..KRT..DP.....K.......T......G..E....LHSSVLK....TIG..K.P......H.T...A...KNL......NT.........D...T...L...QVG.EVTI........DPA......T.......D.E.EIEATVKVMGGADWAMWLQALAAADLLAEGVQTTAYTYLGDKIT..WPIYGHATIGRAKEDLDRTANELNKQ..L.AP.IQGQ...AQVAVLKALVTQASSAIPVMPLYMSILFKLMKAQGTHEGCIEQAQRLFTEGLY..................................
#=GR A0A1E2V400_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PSEFS/82-316                    ................................KLSSAGWYNSAAFEKFAVEK..GLYAKSINGDAFSDEIKRLTIETIKKDL..G......KIDLVVYSLA.......A..P..RRT..DP.....Q.......-......G..V....VHTSTLK....PIG..K.A......V.T...L...RGI......NT.........D...K...G...VVV.DTTL........EPA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALRDADVLAEGAKTTAFTYLGEKLT..QDIYWNGSIGEAKKDLDKKVLTLRDN..L.AA.LKGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR FABV_PSEFS/82-316         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N8TXB1_9GAMM/82-317              ................................KTGSAGWYNTAAFQTAAEAE..GLWSKNINGDAFSNEIKQKTIDTIKAEL..G......KVDCIIYSLA.......S..P..RRT..DP.....N.......T......G..E....VFSSTLK....PIG..N.A......V.T...T...KNL......NT.........S...K...R...EID.EVTV........EAA......N.......Q.D.DIDNTIKVMGGEDWEMWIDALKDADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKAA..T.QD.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHALFNENLY..................................
#=GR A0A0N8TXB1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5DPD6_9BACT/88-324              ................................KTGTPGWYNNMAFDKFAHEA..GLESVTFNGDAFSHEMRKNVINTLNKMG..R......KVDLLVYSVA.......S..S..VRV..DP.....D.......N......G..T....LYRSVLK....PIG..E.T......F.S...G...ATI......DC.........M...T...G...KIS.TISA........EPA......N.......E.E.EMANTVKVMGGEDWALWVRQLKDAGVLAEGVKTVAYSYIGPKLS..HAIYRDGTIGGAKKHLEATARELNVE..L.EReLKGE...AYVSVNKGLVTRSSAVIPIIPLYLSVLFKVMKEQGSHEGCIEQMERLMNERLY..................................
#=GR A0A1M5DPD6_9BACT/88-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
V5UC99_9BURK/82-317                  ................................KPGTPGWYNTAAFDKFATEK..GLYAKSINGDAFSREIKAKTIETIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....E.......T......G..Q....VFNSVLK....PVG..Q.S......V.T...L...RGI......DT.........D...K...E...VVK.ESVF........EPA......T.......Q.E.EIENTVAVMGGEDWQMWIDALSEAGVLAPGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDEKVLNIRAK..L.AA.NGGD...ARVAVLKALVTQASSAIPMMPLYLSLLFKVMKANGTHEGCIEQIYGLYKDSLY..................................
#=GR V5UC99_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A209DM51_9BACL/81-316              ................................RTASAGWYNTAGFEAEAAKL..GVKSFNIVGDAFSNEIKTQTIDLIKKEL..G......QVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....TFTSVIK....PIG..A.P......Y.S...N...KTM......NF.........H...T...G...EVS.MTTI........EPA......A.......E.E.EVRQTIAVMGGEDWKMWMDALQEAGALAQGATTVAYSYIGPEVT..HAIYREGTIGKAKNDLENTASVLNDS..L.DS.IGGR...AFVSVNKALVTQSSSAIPVVPLYISALYQVMKEKELHENCIEQMYRLFADRLY..................................
#=GR A0A209DM51_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E3E5Q6_PAEPS/81-316                  ................................RTASAGWYNSAAFEKAAQDA..GLKSLSVTGDAFSDEVKAKTVEAIREEL..G......QVDLVVYSVA.......S..G..RRT..NP.....R.......T......G..E....TSNSVLK....PIG..E.P......Y.T...N...KTV......NF.........H...T...G...EVS.SVTL........EPA......T.......E.E.EVQGTVEVMGGEDWKLWIDTLRAGGVLADNATTFSFSYIGSDIT..QAIYREGSIGSAKDHLEATARQLNDQ..M.KT.TGGR...AFVAVTKGLVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQSYRLFAERLY..................................
#=GR E3E5Q6_PAEPS/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_CLOPE/81-315                    ................................RTASAGWYNIESLKKFVEGE..GKKFISVNGDAFSNEVKSEVIDLIKENM..G......KVDLVIYSLA.......A..P..KRK..DP.....V.......S......G..E....VYSSCLK....TVG..A.P......F.T...S...KTL......DF.........H...T...G...EIQ.NITI........NPA......T.......E.E.EIEGTRKVMGGEDWMLWIEALKEANVLENGVKTIAYSYIGPEVT..YPIYREGTIGRAKNDLEKTAGEITKV..L.KS.LNGE...GYISVNKALVTQASSAIPIVSLYISILYKVMKEKGTHEGCIEQIYRMFKE-L-y.................................
#=GR FABV_CLOPE/81-315         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A8UPL9_9FLAO/81-316                  ................................RTASPGWYNSAAFETQAHKD..GLYAKSINGDAFSHEIKAQTLNLIKEDL..G......QIDVLIYSLA.......S..P..VRT..HP.....D.......T......G..E....RFKSVLK....PIG..G.T......F.T...D...NTV......DF.........H...T...G...EVK.EISI........EPC......A.......G.D.DIKNTVAVMGGEDWQMWIDLLKSEGALSNDFKTVAYSYIGPSLT..EAVYRKGTIGKAKDDLEATAFKITDT..L.ND.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIERLFNERLY..................................
#=GR A8UPL9_9FLAO/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V2AX90_9BACT/81-316              ................................KTATAGYYNSVAFHEEANRA..GIYAQSINGDAFSNEIKQQTIDLIKKDL..G......TVDLIIYSLA.......S..P..VRK..HP.....E.......T......E..V....LHRSVLK....PIN..Q.S......Y.Q...N...KTV......DF.........H...T...G...IVT.NVSI........EPA......T.......G.D.DITNTIAVMGGEDWQMWLEALQAAGALAPDVKTVAYSYIGPELT..NPVYRHGTIGRAKDHLEATAVKITEL..L.KP.LNGS...AVVSVNKALVTQSSSAIPVVPLYISLLYKLMKEKGIHEGTIEQMARLFKDHLY..................................
#=GR A0A1V2AX90_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T1BJ15_9FLAO/81-316              ................................KTASPGWYNSAAFESEAHKA..GLYAKSINGDAFSNEIKREALDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....LHRSTLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...KVS.EVSI........APA......N.......D.E.DIDNTVAVMGGEDWAMWIDALKNENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFTITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFHDRLY..................................
#=GR A0A1T1BJ15_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G1LKZ6_9BACT/82-318              ................................RTATAGWYNSVAFEVAARKE..GLYAKSFNGDAFSNEIKQQVVDAXXXDL..G......TIDFLVYSLA.......S..P..RRT..DP.....K.......T......G..Q....VYKSVLK....PKG..A.P......Y.T...N...KSL......DF.........E...T...D...KLE.SVTL........DSA......T.......E.D.EIKQTVGVMGGEDWQMWMEILESNHCLAKGVRTVAYSYIGPDIT..TDIYRNGTIGAAKDHLEQTAKNLDAH..L.KNkLGGR...AFVSVNKALVTQSSSAIPFIPLYFIILNKVMLAKGINESCIEQIYRLFAKRLY..................................
#=GR A0A1G1LKZ6_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5SYH6_FLAFR/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIANTIAVMGGEDWTMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFSITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEQGIHEGCIEQIQRLFKERLY..................................
#=GR A0A1M5SYH6_FLAFR/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
V9QSG3_9PSED/82-316                  ................................KLSSAGWYNSAAFEKFAVEK..GLYAKSINGDAFSDEIKRLTIDTIKKDL..G......KIDLVVYSLA.......A..P..RRT..DP.....Q.......-......G..V....VHNSTLK....PIG..K.A......V.T...L...RGI......NT.........D...K...G...VVV.DTTL........EPA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALRDADVLAEGAKTTAFTYLGEKLT..QDIYWNGSIGEAKKDLDKKVLTLRDN..L.AA.LKGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR V9QSG3_9PSED/82-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A8DXP1_9XANT/82-318              ................................KAGTAGWYNAAAFDKQAKAA..GLYSKSINGDAFSDEARAKVIELIKQDM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PIG..Q.T......Y.T...A...TAI......DT.........N...K...D...AII.EASI........EPA......T.......E.Q.EIEDTVTVMGGQDWELWIDALDAAGVLAPGARTVAFSYIGTEIT..WPIYWHGALGKAKVDLDQTAQRLHAR..L.QQ.HGGA...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQADRLFRERLY..................................
#=GR A0A0A8DXP1_9XANT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J8YL42_9BACT/82-318              ................................KTATAGWYNSAAFEEFAEEK..GLYAKSINGDAYSDAVKQKTIEMIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....T.......T......G..E....VFNSTLK....PIG..K.P......L.V...T...RGL......NT.........D...K...E...TIT.DVSL........EPA......S.......Q.E.EIEGTVAVMGGEDWQMWIDALMEAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKRVLSIRDK..L.AAhGNGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A0J8YL42_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V3P8X5_9GAMM/83-317              ................................KPGTAGWYNSAAFDKLAKQA..GLYSKSINGDAFANETRARAIEIIKNEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....V.......S......G..E....VVRSALK....TIG..Q.P......F.T...N...TSV......DT.........N...K...D...AVI.EATI........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSAAGVLAKDARTIAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKALRER..H.--.GGLD...ARVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHEGCIEQINRLFHDRLY..................................
#=GR A0A1V3P8X5_9GAMM/83-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X7MT95_9LACT/83-319              ...............................n-LGTAGWYNNIAFREEAEKE..GLIAKNFVQDAFSYESKQEVINYIKNDF.gG......KIDLVVYSLA.......S..G..VRK..DP.....D.......T......G..E....VYHSSIK....AIG..E.P......V.V...G...PTI......DM.........Q...E...Q...LYY.TETL........DYA......T.......D.Q.EIADTVKVMGGEDWQLWMEALKEADVLADGVLTTNYSYLGTELN..HSYYGQATLGAAKADCDEKANNINAL..L.SD.INGK...AQIVVATAVTTKASAVIPFFPVYCIALYKVMAEQGTHETPIMHQDRIYREMIY..................................
#=GR A0A1X7MT95_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D7VRB1_9SPHI/82-318                  ................................KPGTAGWYNSAAFENEAKEA..GLYAKSINGDAFSDEVKKEVIDLIKRDL..G......QVDLVVYSLA.......S..P..RRT..NP.....K.......N......G..V....SYASVLK....PIN..Q.P......F.T...D...KTV......DF.........H...T...G...VVS.DISI........QPI.....eN.......E.E.DIANTVAVMGGEDWKFWIEDLKAAGVLAEGVKTVAYSYIGPKLT..YPIYRNGTIGKAKDDLEATVPVINDL..L.KD.LHGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQIQRLFAERLY..................................
#=GR D7VRB1_9SPHI/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S2K4A1_9GAMM/82-317              ................................KPASAGWYNTAAFQNAAEAA..GLWSKNINGDAFSDELKAKTVETIKAEM..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....THSSVLK....PIG..Q.D......I.T...T...KNL......NT.........S...K...R...IID.SISV........EAA......N.......E.D.EIANTVKVMGGEDWELWINALKDADVLAEGFKTSAYTYIGKELT..WPIYGHATIGKAKEDLDRATKAIREA..T.AE.LKGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVTKADGTYEGTIEQIHGLFNENLY..................................
#=GR A0A0S2K4A1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A178HYJ7_9RHIZ/82-315              ................................KPASAGWYNNRAFENRARAA..GRKAITIEGDAFSDAVKAETIEAIKANL..G......QVDLVVYSLA.......S..P..VRT..DP.....K.......D......G..I....TYRSAIK....PYG..S.Q......V.T...S...KTL......NT.........G...T...G...EVS.EITV........EPA......T.......E.E.EAAATVKVMGGEDWELWIAALAEAGVLADNFLTLNYTYLGSELT..WPIYHKGTLGKAKADLDRAAAAIRDT..H.--.GNHA...AHVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIQQIDRLFRDKL-q.................................
#=GR A0A178HYJ7_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085BH00_9FLAO/82-318              ................................KMGTAGWYNSAAFEKEAHEA..GLYAKSINGDAFSDDIKKQTIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHSSVLK....PIG..N.S......Y.T...N...KTV......DF.........H...T...G...VVS.DVTI........APV.....eN.......E.E.DIPNTVAVMGGEDWKFWMEDLKAAGVLADGVQTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATVTVLNDL..L.KD.LNGK...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGTHEGTIEQIQRLFADRLY..................................
#=GR A0A085BH00_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R6WHE9_9FIRM/81-313                  ................................RTATPGWYNTVAFEKEAEKN..GLYAKSINGDAFSLEVKEKVIEMIKEDL..G......QVDMVIYSLA.......A..P..RRT..TA.....D.......-......G..T....VWASSLK....TTG..E.A......F.T...E...KSL......DL.........R...N...N...TIV.TKTV........EPA......K.......D.G.ELEGTIKVMGGEDWMDWMDTLHGAGVLSENAVTVAYSYIGPKLT..YPIYYDGTIGQAKRHLTKTAEKINEK..Y.S-.-DIK...AYISVNKALVTQASAAIPIVPLYFAILYKVMKVQGTHEGCIEQISRLFHEKLF..................................
#=GR R6WHE9_9FIRM/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7QI69_9BRAD/82-314                  ................................RTGSAGWYNNRAFEIEARKI..GRSPVTLEGDAFSDELKKDFIAQVREKF..G......QLDLLVYSMA.......A..P..VRT..DP.....V.......T......G..K....TYRSAIK....PLG..E.R......V.E...I...KTL......NT.........E...T...G...EVY.ETGL........MPA......T.......E.D.EAAATVAVMGGDDWKRWIDQLADAGVLAPGFQTLNYTYIGSELT..WPIYWKGTLGRAKVDLDQKADAIRKR..L.GP.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR F7QI69_9BRAD/82-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1HEB4_9GAMM/83-319              ...............................g-VGSAGWYNNIFFRQEAEQA..GRVATNIIGDAFSPEVRDQVIKAIRTDL.gG......QVDLVVYSLA.......T..G..VRP..DP.....T.......T......G..E....LWRSVIK....TVG..E.P......L.T...G...QTV......NL.........E...T...G...QLD.TVTV........DAA......T.......P.A.EIEATVKVMGGDDWAAWIDTLLQAGVLAPGCRTVAYSYIGPAIT..YPIYHQGTLGRAKVHLHATAADINRR..L.NA.IGGG...ADVAVCKALVTKASVFIPALGPYILALFKVMKESGTHEGCIEQMQRLFQSRLY..................................
#=GR A0A0J1HEB4_9GAMM/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X9ZBM2_9SPHI/81-316              ................................KTASPGWYNTAAFEKEAHAA..GLYAKSINGDAFSKEIKEKTIELIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..G.T......Y.T...N...KTV......DF.........H...T...G...NVT.EISI........EPA......T.......E.E.DIANTVAVMGGEDWAMWIDALKAENLLAEAATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFKISDK..L.KD.IDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGTIEQIQRLYADRLY..................................
#=GR A0A1X9ZBM2_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0L0TKU6_9BURK/97-332              ................................KPGTPGWYNTAAFTKFATAK..GLYAKSINGDAFSDEIKQKTIDVIKRDL..G......QVDQVVYSLA.......S..P..RRT..HP.....K.......T......G..E....VFSSTLK....PVG..K.A......I.T...L...RGL......DT.........D...K...E...VIK.ESIL........EPA......T.......Q.S.EIDNTVAVMGGEDWQMWIDALRAAGVLAEGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLAIRDS..L.AS.YGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEEGTHEGCIEQVHCLYKDSLY..................................
#=GR A0A0L0TKU6_9BURK/97-332   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0KEB7_AERHH/81-315                  ...............................g-PGSAGWYNNIWFRKEAEQT..GRIAINLIGDAFSIGMRQQAIDTIRQQL..G......QVDLVIYSLA.......S..G..IRV..LP.....D.......-......G..T....QVRSVLK....TTS..Q.P......F.S...G...WGL......DL.........E...H...D...TLV.QQSL........DPA......T.......P.E.EIRDTVSVMGGEDWQLWLQALQQADCLAPGAQTVAYSYIGPEST..YPLYRDGTIGYAKEHLHATAETINLQ..L.AE.LGGH...AWVSVCKALVTKASAYIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMY..................................
#=GR A0KEB7_AERHH/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4NM35_9VIBR/83-319              ...............................g-SGSAGFYNNFYFEKLAHQE..GRVAININGDAFSKQIKDEVVEAIETYF.eG......EVDLVIYSLA.......S..G..IRP..NP.....E.......T......G..E....LWRSAIK....PIG..D.S......I.T...G...NTL......LL.........E...S...D...QWH.QTTL........PPA......T.......D.E.EAQATLKVMGGEDWEEWIDTLINSESIAQGCNTIAFSYIGPECT..HPIYLDGTLGRAKIDLHQTSHALNLK..L.AN.YDGN...AYATVCKALVTKASVFIPALSPYIIALYKVMKEQGNHEGCIEQMQRLFSSKLY..................................
#=GR A0A0F4NM35_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7NJS8_9FLAO/81-316              ................................RPGSPGYYNTAAFEKHAHQA..GLYAKSINGDAFSNEIKEEVVNLIKEDL..G......QVDLVIYSLA.......S..P..VRK..HP.....N.......T......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...KVS.EISI........NPA......E.......G.E.DVENTVTVMGGEDWKMWMDALSKENLLAEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTIAED..L.KA.INGN...AYVSVNKALVTQASSAIPVIPLYISLLFKIMKENGTHEGCIEQIQRLYSERLF..................................
#=GR A0A1M7NJS8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0U2VMB4_9LACT/83-319              ...............................n-LGTAGWYNNIAFREAAEKD..GLIAKNFVQDAFSHESKQEVIDYIKSEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....D.......T......G..E....TYSSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...K...Q...EFY.TETL........DPA......T.......D.Q.EIHDTVKVMGGEDWQLWMEALKEADVLADEVLTTNYSYLGTELN..HDYYGGGTLGRAKADCDEKADNINEL..L.TD.INGK...ALIVVATAVTTKASSVIPFFPVYCIGLYKVMAEKGTHETTIMHQDRIYREMIY..................................
#=GR A0A0U2VMB4_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A246AH21_9SPHI/81-316              ................................KTASPGWYNTAAFEKEAHAA..GLYAKSINGDAFSKEIKQITIDLIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....VHRSTLK....PIG..S.T......Y.T...N...KTV......DF.........H...T...G...NVT.DISI........EPA......T.......E.D.DIANTVAVMGGEDWAMWIDALKAENLLAEGATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFKIGDK..L.KD.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGTIAQIQRLYAERLY..................................
#=GR A0A246AH21_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5SGL9_9CLOT/81-313                  ................................RTASAGWYNTAAFEQFAQND..GHYAKSINGDAYSQEIKEETIALIKKDF..G......QVDMVIYSLA.......A..P..RRK..AP.....D.......-......G..V....TYRSVLK....TVD..K.E......F.T...N...QSI......DL.........L...T...K...ELT.TVTI........PPA......T.......E.E.EINDTIKVMGGEDWMLWMEALQEADVLADGAKTVAYSYIGPELT..YPIYYDGSIGQAKQDLYRTADKINEH..I.--.QGTE...AYVAVNKAVVTQSSSAIPIVPLYISILFKVMKELNLHEGCIEQMYRLVHDRL-c.................................
#=GR R5SGL9_9CLOT/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0X8FD63_9LACT/82-318              ...............................n-LGTPGWYNNVFFRQAAEKE..GLVAKNFVGDAFSQALKDDVVHYIKEEF.gG......KVDLVVYSLA.......T..G..RRT..DP.....E.......T......G..E....TYHSAIK....SIG..Q.E......V.V...G...PNI......NL.........Q...K...E...ELY.EEVL........EPA......S.......E.E.EIEATVKVMGGEDWYGWIKLLKEADVLAEGVQTVIYSYLGSDLN..RSYYQDGTLGRAKADCDEKAEWINQE..L.EY.LGGK...AQVVVATAVTTKASAVIPFFPIYCIALYKVMAERGTHETPIMHQDRIYRDMVY..................................
#=GR A0A0X8FD63_9LACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R1EJ85_9BACL/81-317              ................................RTASAGWYNSAAFERRAAEA..GLTSVSITGDAFADETKDRVMDTIANEF..G......QVDLVVYSVA.......S..S..RRT..DP.....D.......S......G..K....TYNSVLK....PIG..A.P......F.T...G...KAV......NF.........H...T...G...EVTdEVTT........EPA......E.......G.D.DIAQTIAVMGGADWQRWIDRLRQANLLADGAMTIAYSYIGSELT..RAIYREGTIGKAKEDLEATAQRLTRE..L.SA.LGGK...AFVVVSKALVTQSAAAVPVFPLYIAALYKVMKEKGIHENTIQQSYRLFADKLY..................................
#=GR A0A1R1EJ85_9BACL/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G1KYA2_9BACT/83-318              ................................RTATAGYYNSAAFEQKAREA..GLYAKSFNGDAFSDEMKQKVMETIKKDL..G......SVDLVIYSLA.......S..P..RRQ..HP.....R.......T......G..Q....LAKSVLK....PVG..T.T......F.S...N...KSL......DL.........N...S...N...KLE.NVTL........AQA......S.......Q.E.EIDQTISVMGGEDWEMWIEALKNAGLLERHALTVAYSYIGPELT..RGVYRNGTIGKAKDHLEATARKLDEQ..L.KK.YGGR...ALISVNKALVTQSSSAIPFIPLYFILLKKVMKEKKVDEDCIGQIHRLFATRLY..................................
#=GR A0A1G1KYA2_9BACT/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1D7QBE6_9SPHI/81-316              ................................KTASPGWYNTAAFETQAHEA..GLYAKSINGDAFSKEIKEKTLALIKADL..G......QVDLVIYSLA.......S..P..KRV..HP.....V.......T......G..V....THNSVLK....PIG..E.V......F.T...N...NTV......DF.........H...T...G...IVS.EISI........QPA......N.......E.E.DIENTVAVMGGEDWAMWIDELKTAGLLAPGATTVAYSYIGPALT..EAVYRKGTIGRAKDHLEATAFTISDQ..L.KD.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGCIEQIQRLFQERLY..................................
#=GR A0A1D7QBE6_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5DZT6_9VIBR/82-317              ................................KTGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSNEAKQKAIDLIKADL..G......QVDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...III.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWMSALSEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.AS.LNGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLY..................................
#=GR A0A1E5DZT6_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X7AP76_9GAMM/82-317              ................................KPGTAGWYNSAAFEQAAHEA..GLYAKSINGDAFSNAAKEKVIELIKADL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSSLK....PIG..Q.P......Y.V...A...TAV......DT.........N...K...D...QLF.EASV........EPA......T.......E.E.EIANTVTVMGGQDWELWINALSDAGVLAEGCRTVAYSYIGTELT..WPIYWHGALGRAKQDLDRAAGELNQK..L.AA.IGGG...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGLHEGCIEQVWRMLSTRLY..................................
#=GR A0A1X7AP76_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G9CHP2_9SPHI/81-317              ................................KPASPGWYNSAAFEKHAHKA..GLYAKSINGDAFSDEIKQQTLDLIKNDL..G......QVDLVIYSLA.......S..P..KRL..HP.....K.......T......G..V....VHNSVLK....PIG..E.N.....vF.T...N...KTV......DF.........H...T...G...AVS.EVSI........SPA......N.......E.D.EIENTVAVMGGEDWEMWIDALKAANLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTISDK..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEKGIHEGCIEQIQRLFAERLY..................................
#=GR A0A1G9CHP2_9SPHI/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S1N0A2_9GAMM/82-317              ................................KTASAGWYNTAAFQQAADEA..GLWSKNINGDAFSDEIKAKTVETIKAEM..G......KVDLIIYSLA.......S..P..RRT..DP.....K.......T......G..E....VYSSTLK....PIG..R.D......V.T...T...KNL......NT.........S...K...R...EID.EVKV........EAA......N.......E.D.EIANTVKVMGGEDWELWIEALKDADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATAAIKES..T.AA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIDALFRENLY..................................
#=GR A0A1S1N0A2_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C9QFH2_VIBOR/83-317                  ...............................g-VGTAGYYNNHYFKQFAEQA..GRTAINIQGDAFSPQTKAQVVEAIETYF.eG......EVDLIVYSVA.......S..G..VRH..ES.....D.......-......-..N....LWRSVIK....PIG..E.P......V.S...G...TTL......VL.........E...T...D...EWQ.DTTL........APA......S.......A.E.EIDATVKVMGGEDWEAWIDALINSESIGSGCKTIAFSYIGPCVT..HPIYLEGTLGAAKADLHQTSHSLNLK..L.AN.FDGG...AYATVCKALVTKASAYIPGFSPYITALYQVMKQKGTHEGCIEQMQRLFTTKLY..................................
#=GR C9QFH2_VIBOR/83-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P0NK30_9SPHI/81-316              ................................KTASAGWYNTAAFESEAHKA..GLYAKSINGDAFSKEIKEKTLELIKADL..G......QIDLVIYSLA.......S..P..KRV..HP.....V.......T......G..V....VHSSVLK....PIG..E.V......Y.T...N...KTV......DF.........H...T...G...IVS.DISI........QPA......Q.......G.D.DIENTIAVMGGEDWAMWIDELKAAGLLAAGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFQIADQ..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGLHEGCIEQIQRLFKERLY..................................
#=GR A0A0P0NK30_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E7NCI8_KITAU/86-322              ................................RTATAGWYRTAATADLARAA..GRDLVFLNGDAFSDLMKDQVAELIEQRF.gG......RLDYLIHSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..R.A......N.R...T...RTL......VF.........D...E...QgvpEVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRGLLGEGFATAALSYIGSPLT..AAIYRQGTIGAAKLHLEATARTLNER..L.GRtVGGR...AVTSVNGAAVTQSSTAVPGIALYTGLLRGVLGED--MVPPVRQFASLWD----ql................................
#=GR A0A1E7NCI8_KITAU/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H6US87_9FLAO/81-316              ................................KTATPGYYNSAALEIEAAKV..GLYAKSINGDAFSNEIKQQTIDLIKKDL..G......QVDLVIYSLA.......S..P..VRM..HP.....T.......T......G..V....LHRSTLK....PIG..G.K......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........EPA......N.......Q.E.DIDNTVVVMGGEDWSMWMNALKDAGVLANDAMTLAYSYIGPEVT..EPVYRKGTIGRAKDHLEATAFEITKQ..L.ED.VNCK...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKAEGIHEGCIEQIQRLYSNRLF..................................
#=GR A0A1H6US87_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T4VMC9_9GAMM/83-319              ...............................g-VGTAGWYNNVFFREEAEKQ..GLIAKNFVGDAFSQDMRDHVVAYIQNEF.gG......SVDLVVYSLA.......T..G..VRP..NP.....E.......T......G..E....LWRSSIK....TVG..E.P......V.S...G...PTI......NI.........E...L...D...TLE.SMDV........ETA......S.......E.D.ELEATVKVMGGEDWESWITMLSNAGVMAKGCKTVAYSYVGPEVT..YPIYHHGTLGRAKAHLHGTADLLNDR..L.KA.LDGE...AYVSVCKALVTKASVFIPAFSPYILSLFKVMKENGTHEGCIEQMQRLFADRLY..................................
#=GR A0A1T4VMC9_9GAMM/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0YG50_9GAMM/62-297                  ................................KTGTAGWYNSAGFHHYAEAD..GLYAKSINGDAFSDEIKQKTIDVIKQDL..G......QVDLVVYSLA.......S..P..RRQ..HP.....K.......T......G..V....IHNSTLK....PIG..K.N......V.V...Q...TGV......DT.........D...K...E...ILK.SFSI........EAA......N.......Q.D.EIDNTVAVMGGEDWQMWIDALDDAGVLAPGCKTTAYTYVGERVT..RDIYWNGTIGQAKKDLDKKVLSIRDK..L.AA.SGGD...ARVSVLQAVVTQASAAIPVMPLYQSLLFKVMKAAGKHDGCIEQVALLFRESLY..................................
#=GR A0YG50_9GAMM/62-297       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W0JAL1_9BACT/82-318                  ................................KTGTPGWYNTAAFTAAAKAA..GLYARNFNGDAFSDALKADVLAAIKADL..G......QVDLIVYSLA.......S..P..RRT..HP.....K.......T......G..V....THKSVLK....PVG..Q.P......Y.T...N...KTV......DT.........D...K...G...IVS.SVTI........EPA......S.......E.A.EIADTTAVMGGEDWEMWINALDEAGLIAPGATSVAYSYIGPEVT..WPIYRNGTIGLAKNDLERAAKAIDAT..L.KThGYGR...AFISVNKALVTQASSAIPVVPLYISILYKIMKAKGTHEGCIEQIQRLFEKQMY..................................
#=GR W0JAL1_9BACT/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_STRAW/79-313                    ................................RSATAGWYRTVATDAIAREL..GADFSFRNADAFADTTKTETLDLLAERF..G......GVDYLIYSVA.......A..P..RRT..DP.....R.......S......G..T....TYQSVLK....PLG..A.P......H.T...T...RNLe...faDD.........G...A...A...QVR.EVTV........APA......T.......E.A.EAAATVGVMGGEDWSRWITALAERGLLRSGFRTVALTYIGSPLT..SAIYRGGTIGAAKAHLESTARALTER..L.AA.VDGR...AFTSVNGALVTQALTAIPGIPLYVSLLRGVLGDR--FPSPVAQSLDLW-----hql...............................
#=GR FABV_STRAW/79-313         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H5K787_9FLAO/81-316              ................................RPGSPGFYNTAAFEKEAHAA..GLYAKSINGDAFSNEIKEEVINLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....V.......S......G..K....RFKSVLK....PIG..G.E......F.S...N...KTV......DF.........H...T...G...KVS.EISI........KPA......E.......G.D.DIENTITVMGGEDWKMWMDALKAENLLSEGATTVAYSYIGPSLT..EAVYRKGTIGAAKDHLEATAFTISDD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKEKGIHEGCIEQIQRLYSERLY..................................
#=GR A0A1H5K787_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_ALISL/82-317                    ................................KTGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSDEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..N.T......Y.T...A...TAV......DT.........N...K...D...AII.EASV........EPA......T.......E.Q.EIQDTITVMGGEDWELWMSALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATTLNEK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCQEQILRMFSQRLY..................................
#=GR FABV_ALISL/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PARXL/82-317                    ................................KAGTAGWYNTAAFEKFATEQ..GLYATSINGDAFSDAVKQRTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......S......G..E....VFSSTLK....PVG..Q.A......V.N...L...RGI......DT.........D...K...E...VIR.ETVL........EPA......T.......Q.D.EIDHTVAVMGGEDWQMWIDALLEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR FABV_PARXL/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B9XXE6_9FLAO/81-316              ................................KPGSPGFYNTAAFEQEAEKA..GLYAKSINGDAFSNEIKEQVVQLIKEDL..G......QVDLVIYSLA.......S..P..VRT..HP.....E.......S......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...KVS.EISI........NPA......E.......G.E.DVANTVTVMGGEDWKMWMDALQSENLLSEGATTVAYSYIGPEVT..KPVYRNGTIGAAKDDLEATAFKISDD..L.KS.INGN...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKEKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A1B9XXE6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A095XYB5_9GAMM/82-317              ................................KPGTAGWYNSAAFHAEAEAA..GLGAWSINGDAFSSELKAQTIAAIREHL..G......SVDLVVYSLA.......A..P..RRK..HP.....V.......S......G..E....LHTSTLK....PIG..K.D......T.T...Q...KGI......NT.........D...K...G...EIQ.DFHL........EAA......T.......Q.E.EIDHTVAVMGGEDWQYWIEALDDAGVLADGCRTTAYTYIGEQIT..WDIYWHGTIGAAKQDLDRRVVAIRER..L.AA.RGGD...ARVSVLKAVVTQASAAIPAMPIYLAILFRVMKAAGTHEGCIEQVYRLFSESLY..................................
#=GR A0A095XYB5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A6D1N1_9VIBR/83-318                  ...............................g-VGSAGWYNNIYFKKRAEQA..GRRAINIVGDAFSTDVREQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..NS.....E.......-......G..G....FWRSAIK....PIG..E.S......V.S...G...ATI......NL.........E...T...E...QWE.DTTL........EPA......N.......D.E.EIEGTLKVMGGEDWESWIDTLVNSDSVADGFKTIAFSYIGPAVT..HPIYLDGTLGRAKVDLHQTSHALNLE..L.SN.FNGN...AYAAVCKALVTKASVFIPGLSPYLLALYKTMKAQGKHEECIEQMQRLFSTKLY..................................
#=GR A6D1N1_9VIBR/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S0FMA9_9FIRM/81-316                  ................................KTASAGWYNSAAFERLAKEE..GLYAKSINGDAFSNEIKQQTIDLIKKDL..G......KVDLVIYSIA.......S..P..RRT..HP.....V.......T......G..E....VFNSVLK....PIG..A.P......C.T...V...KTV......DF.........H...S...R...QVS.ETTI........EPA......T.......E.E.DIRQTVAVMGGEDWAMWMNALKEADVLEQGAVTIAYTYVGPDMT..HAIYRKGTIGRAKDDLEATAGKITEN..L.NS.IGGN...AYVSINKAVVTQASAAIPVISIYISVLFKVMKEMNIHEGTIEQMYRMLSDRVY..................................
#=GR S0FMA9_9FIRM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W1L771_9GAMM/82-317              ................................KTGSAGWYNTAAFQNAADEA..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDLVIYSLA.......S..P..RRT..DP.....N.......T......G..E....TYSSTLK....PIG..D.A......V.T...T...KNL......NT.........S...K...R...EID.AITV........EAA......S.......Q.D.DIDNTIKVMGGEDWEMWIDALKKADVLADNFKTSAYTYIGKELT..WPIYGHATIGKAKEDLDRATVAIKES..T.KA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHALFTENLY..................................
#=GR A0A0W1L771_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B1VDT9_9VIBR/82-317              ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A1B1VDT9_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E3BED3_9VIBR/82-317                  ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKEKTIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LVRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...III.EASV........EPA......T.......E.E.EIADTVTVMGGEDWELWIQALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAAAALNDK..L.SQ.SGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRQEGVHEGCMEQIFRMFSQRLY..................................
#=GR E3BED3_9VIBR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5VF13_9GAMM/82-317              ................................KPGSAGWYNSAAFDKFAKAE..GLYSKSLNGDAFSHEMKQKVIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....D.......S......G..E....LVRSSLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EIEDTVKVMGGQDWELWINALADAGVLAEGCKTVAYSYIGTEIT..WPIYWHGALGKAKMDLDRAASELSNK..L.AD.IKGT...ANVAVLKSVVTQASAAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A0A0F5VF13_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A238VRU1_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QIDLVIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......D.E.DITNTVAVMGGEDWAMWIDALKAENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KS.IGGQ...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A238VRU1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A014M2J8_9GAMM/82-317              ................................KPATAGWYNSAAFEAAAEAK..GLYATSINGDAYSDEVKQKTIELIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSTLK....PVG..K.S......L.T...T...RGL......NT.........D...K...E...TIT.DITL........EPA......S.......Q.E.EIAGTVAVMGGDDWQMWIDCLKEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGEAKKDLDKRVLSIRET..L.AE.KGGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKESLY..................................
#=GR A0A014M2J8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9YST5_CAPCC/82-318                  ................................KPGTSGWYNSAAFEKEAHAA..GLYAKSINGDAFSDEVKKQTIDLIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..K.P......Y.V...N...KTV......DF.........H...T...G...VVS.EVTI........NPV.....eT.......Q.E.EIENTVAVMGGEDWKFWMEELQKAGVLAQGVKTVAYSYIGPELT..FPIYRNGTIGKAKDDLEATAFTITDL..L.KE.VSGK...AYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQIYRLFNERLY..................................
#=GR F9YST5_CAPCC/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q8ZXV1_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWIDALKNENLLAEGATTIAYSYIGPELT..EAVYRKGTIGRAKDHLEATAFTITDN..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQERLY..................................
#=GR A0A0Q8ZXV1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6WBM0_9GAMM/82-317              ................................KPGTAGWYNTAAFDKFAKAE..GLYSKSVNGDAFSHEAKQKVIELIKQDL..G......EIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...CII.EATV........EPA......T.......E.Q.EIADTVTVMGGEDWELWIKALSDAGVLADNCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAKALNEQ..L.SR.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRQEGLHEGCMEQIYRLFTERLF..................................
#=GR A0A1N6WBM0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1J8QD80_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSINGDAFSHEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.Q.EIDDTITVMGGEDWELWMDALDQAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAATAIDSK..L.KA.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGEQLY..................................
#=GR A0A1J8QD80_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C3IC83_9VIBR/83-319              ...............................g-VGSAGWYNNVFFKQQAEKS..GHTAINIVGDAFSETIREQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KP.....N.......S......D..D....LWRSVIK....PIG..E.P......V.T...G...ASI......LL.........E...N...D...QWV.ETTL........EPA......T.......E.E.EAEATIKVMGGEDWESWIDTLINSESLAEGCKTIAFSYVGPEAT..HPIYLDGTLGRAKVDLHQTSHALNLK..L.AN.FDGG...AYVTVCKALVTKASVFIPALSPYLLALYRVMKEQGTHERCIEQMQRLFTTKLY..................................
#=GR A0A0C3IC83_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A158IV10_9BURK/82-317              ................................KPGTPGWYNTAAFTQFATAK..GLYAKSINGDAFSDEVKQKTIDVIKRDL..G......QVDQVVYSLA.......S..P..RRT..HP.....K.......T......G..E....VFSSTLK....PVG..K.A......V.T...L...RGL......DT.........D...K...E...VIK.ESIL........EPA......T.......Q.S.EIDNTVAVMGGEDWQMWIDALLAAGVLAEGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLAIRES..L.SS.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEEGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A158IV10_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2KH51_TRELE/82-317                  ................................KWGTPGWYNNLAFDQAAKEA..GLTAVTIDGDAFSDGIKETVIGEAKNRG..M......KFDLVVYSLA.......S..P..VRV..DP.....D.......T......G..V....MHKSVLK....PFG..K.A......F.C...G...KTL......DP.........F...T...G...KLS.EITA........EPA......T.......D.E.EAAATVKVMGGEDWQRWMDKLYKAGVLADGCITVAYSYIGPDAT..QALYRKGTIGKAKEHLEATAHTLNKE..M.AA.FGGK...AFVSVNKGLVTRASAVIPVIPLYLASLFKVMKQKGNHEGCIEQMNRLFDERLY..................................
#=GR U2KH51_TRELE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T5GQ59_9FLAO/82-318              ................................KIGTAGWYNSAAFEKEAATA..GLYAKSINGDAFSDEVKKETIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..E.P......F.T...N...KTV......DF.........H...T...G...VVS.DISI........QPV......D......kD.E.DIENTIAVMGGEDWKFWMEDLKNAGVLADGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATVPVLNDL..L.KD.LNGT...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGTHEGTIEQMERLFSERLY..................................
#=GR A0A1T5GQ59_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F0GHF2_9BURK/82-317                  ................................KPGTAGWYNSAAFEKFAAEK..GLYARSINGDAFSDKVKQVTIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PIG..K.S......V.S...F...RGI......DT.........D...K...E...VIR.ETVL........EAA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDRKVLSIRDK..L.AA.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLLKDSLY..................................
#=GR F0GHF2_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4RBN1_9BACL/81-316              ................................RTASAGWYNSAAFEKAAAEA..GRKSYSIVGDAFSDEIKAQTIDLIRSEL..G......SIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PIG..G.T......Y.T...N...KTV......NF.........H...S...G...DVT.EATI........EPA......T.......E.E.EISQTIAVMGGEDWQMWIDQLEEAGVLADGATTVAYSYIGPEIT..HAVYREGTIGYAKNDLEATAKRLSEQ..L.ST.KGGR...AYVSVNKALVTQSSSAIPVVPLYISALYKVMKENGTHEGCIEQMYRLFSDRLY..................................
#=GR A0A0Q4RBN1_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A9KNR3_LACP7/81-315                  ................................RTATPGYYNTEALEEFLHQD..GYYGESINGDAFSREVKEMTIAKIKEDL..G......QVDMVIYSLA.......A..P..RRT..DE.....D.......-......G..V....TYSSVLK....TTS..V.P......Y.T...N...KSL......DL.........R...N...N...QIS.EVTV........PAA......T.......E.E.EEIATVKVMGGEDWALWIDALKDAGVLSEGVITIAYSYIGPKLT..YPIYYEGTIGKAKEDLYQTSVLLNET..L.KD.LQGK...AYISVNKALVTQASAAIPVVPLYISILYKVMKEQQLHEGCIEQMDRLFFENL-d.................................
#=GR A9KNR3_LACP7/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A257X7Q9_9BACT/82-318              ................................RCGTAGWYNSAAFENEARAA..GLYARSFNGDAFSDAMKTTVIEAIKADL..G......QVDCVIYSLA.......S..P..RRT..HP.....K.......T......G..E....VFKSVLK....PIG..SaS......Y.T...N...KNL......NT.........G...T...G...VVN.EVTI........EPA......N.......E.D.EIAQTVAVMGGEDWEMWIDALQSAGVLAEGVQTVAYSYIGPEVT..WPIYKNGTIGRAKEDLERVQRVLDGK..L.AP.LKGK...AWVSVNKALVTQASSAIPVVPLYISLLYKVMKAEGTHEDCIEQMDRLFRERLY..................................
#=GR A0A257X7Q9_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1C7I9S6_9FIRM/81-313              ................................RTATPGWYNTAAFEALAQEE..GLYAKSINGDAFSAEVKQQAIEMIKEDL..G......QVDMVIYSLA.......A..P..RRT..TA.....D.......-......N..K....TWSSTLK....TTT..G.A......F.T...E...KSL......DL.........R...N...N...TIV.TKTV........ESA......N.......D.E.ELEGTIKVMGGEDWMDWMDALTNAGVLAENAVTVAYSYIGPELT..YPIYTEGTIGQAKKHLTETAGRIREK..H.--.PGIQ...AYISVNKALVTQASAAIPIVPLYFAILYKVMKEQGTHEGCIEQISRLFHDKLF..................................
#=GR A0A1C7I9S6_9FIRM/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G9A4V3_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKQA..GRYSKSINGDAFSHEVREKAIELIREDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSALK....PIG..E.P......Y.R...A...TAI......DT.........N...K...D...VVT.EAEV........EPA......T.......E.Q.EIEDTIAVMGGEDWELWIEALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDAK..L.AA.SGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKVMKEKGLHEEPIDQLNRLFGERLY..................................
#=GR A0A1G9A4V3_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5Q785_9RHIZ/82-315              ................................KTASAGWYNNRAFEQRAKAA..GRVAITVEGDAFSDAIKAEAIEAIRGSV..G......QIDLIVYSVA.......S..P..VRT..DP.....K.......D......G..V....TYRSAIK....PYG..A.A......V.T...S...KTL......NT.........G...T...G...EVS.EISV........EPA......S.......E.E.EMASTVKVMGGEDWELWIKALSEAGVLADGFQSLNYTYLGSELT..WPIYHKGTLGMAKADLDRAAAAIRAA..H.G-.-EHA...AHVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIQQIDRLFRAKL-q.................................
#=GR A0A0F5Q785_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F2P3R0_9GAMM/82-317              ................................KPATAGWYNSAAFHKFAEQD..GLYAKSINGDAFSDEIKQKAIDTIKQDL..G......QVDLVIYSLA.......S..P..RRQ..HP.....K.......T......G..E....VFTSTLK....PIG..K.S......V.T...Q...RGI......NT.........D...K...E...QIQ.EVTL........EAA......S.......D.E.EIASTVAVMGGEDWQMWIDALSEAGVLAEGAKTTAFTYIGEKLT..WDIYWDGTIGQAKKDLDRRVVDIRAK..L.AA.TGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKADGSHEGCIEQLYRLFSECLY..................................
#=GR A0A0F2P3R0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I0NCC9_9GAMM/111-351             ................................KTGTAGWYNAYAFDKAAREA..GLFAKSINGDAFANETRAKAIEIIREEM.gG......KVDLVVYSLA.......S..P..VRK..LP.....E.......GtkmgepG..T....VVRSALK....TMG..D.T......F.T...A...SSV......DT.........N...K...N...EVV.QATV........EPA......T.......E.Q.EVKDTVTVMGGEDWAMWIDALSEAGVLAENATTIAYSYVGTSIT..WPIYWHGTLGQAKQHLDRTAKELGER..H.--.KGLR...SYVGVMKSVVTQASSAIPVIPLYVSMVFKIMKAKGIHEGTIEQINRLFHDRLY..................................
#=GR A0A1I0NCC9_9GAMM/111-351  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2EP46_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSVNGDAFSNEIKQQTLDLIKADL..G......QVDLVIYSLA.......S..P..VRM..HP.....V.......T......G..V....LHRSVLK....PIG..G.T......Y.T...N...KTV......DF.........H...S...G...KVS.EISI........EPC......S.......G.D.DIENTVAVMGGEDWAMWIDALKAENLLAAGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFAITES..L.AA.IDGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYQIRLY..................................
#=GR A0A1I2EP46_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S3L4T2_TREMA/85-320                  ................................KWGTPGWYNNLAFDKAAENA..GLFSCTIDGDAFSDEIKNRVIEEAKKKH..I......RFDLVVYSLA.......S..P..VRT..DP.....D.......T......G..I....MYKSVLK....PFG..K.T......F.T...G...KTL......DP.........F...T...G...ELK.EISA........EPA......N.......E.E.EAAATVKVMGGEDWERWIKRLAQARVLSDGCITVAYSYIGPEAT..QALYRKGTIGKAKEHLEATAHSLNSF..M.RS.FSGK...AFVSVNKGLVTRASAVIPVIPLYLASLFKVMKEKGLHEGCIEQINRLFSDRLY..................................
#=GR S3L4T2_TREMA/85-320       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H5TD44_9ALTE/88-323                  ................................KTGTAGWYNTGAFHEQAHRD..GLYASTINGDAFSDEIKAEAIAAIKENL..G......KVDLVIYSLA.......S..P..RRT..DP.....D.......T......G..D....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...LVH.EIAL........EPA......T.......D.D.EIAQTVKVMGGEDWERWLVQLNEAGVLSENCKTTAYTYIGKELT..WPIYGQATIGLAKEDLDRAASAIIEK..L.SG.INAQ...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIVGLFTNCLY..................................
#=GR H5TD44_9ALTE/88-323       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2J3V2_9SPHI/82-318                  ................................KPGTAGWYNTAAFEKEAQSA..GLYAKSINGDAFSDDIKKQAIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PIA..N.P......F.T...N...KTV......DF.........H...A...G...VVS.DISI........QPV.....eN.......E.E.DVANTIAVMGGEDWKFWIEDLKAAGVLADGVKTVAYSYIGPELT..YPIYRNGTIGKAKDDLENTVPVINDL..L.KD.LNGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGIHEGTIEQMQRLFADRLY..................................
#=GR U2J3V2_9SPHI/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0H2MA09_VARPD/82-317              ................................KPGSPGWYNSAAFHRAAAQE..GLYAKSINGDGFSDDLKQKAIDAIREDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..K.A......V.S...L...RGL......DT.........D...N...E...VVR.ETVL........EPA......T.......Q.Q.EIDDTVAVMGGEDWQMWIDALQAAGVLADGAKTTAFTYLGERIT..HDIYWNGSIGAAKKDLDQKVLGIRAG..L.AA.KGGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKAEGSHEGCIEQVHGLYAESLY..................................
#=GR A0A0H2MA09_VARPD/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2N2D0_9CLOT/81-316                  ................................RTATPGWYNNKAFEKFAKEQ..GGFHKSINGDAFSNEIKAEAIDEIKNNM..G......KIDLVIYSLA.......S..P..RRK..DP.....V.......S......G..E....VYSSVLK....TIG..E.D......F.K...S...KTL......DF.........H...S...F...KIS.DVEV........ERA......T.......E.E.EIQGTIKVMGGEDWKLWMEALKEADVLKEGVRTLAYSYIGSELT..YPMYNNGTIGMAKKDLDEKSNEINLM..L.KD.LKGE...AYVSVNKGLVTQASSAIPVVSLYISIMFKVMKEKGIHEGCIEQCYRLFSERLY..................................
#=GR U2N2D0_9CLOT/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R0C8M1_9GAMM/82-316              ................................KPGTAGWYNSAAFEKYAHQA..GLYARSVNGDAFSDEVKQKVIEIIKADL..G......QVDQVVYSLA.......A..P..RRK..HP.....K.......T......G..E....IITSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VLT.ETTL........QPA......T.......A.E.EIAGTVQVMGGEDWQMWIDALLEAGVLAPGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDNKVLDIRSK..L.QA.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEQGTHEGCIEQLDTLYD----ily...............................
#=GR A0A0R0C8M1_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_TOLAT/82-317                    ................................KPGSAGWYNSAAFDKAAKEA..GLYSKSVNGDAFSDECRAKVVELIKADL..G......QVDMVVYSLA.......S..P..VRK..LP.....A.......T......G..E....LIRSALK....PIG..E.V......Y.T...A...TAV......DT.........N...K...D...ELI.EAHV........EPA......N.......E.E.EIANTIKVMGGEDWELWLQALDQAGVLAEGVKTVAYSYIGTDIT..WPIYWHGTLGRAKEDLDRASSAIRQQ..L.SS.KNGT...ANVAVLKSVVTQASAAIPVMPLYIAMSFKLMKEQGIHEGCIEQIQRMFYTRLF..................................
#=GR FABV_TOLAT/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S6GE48_9GAMM/1-183                   ................................--------------------..----------------------------..-......----MIYSLA.......S..P..VRK..LP.....E.......T......G..E....LVRSTLK....PIG..E.A......Y.Q...S...TAI......NT.........N...K...D...TLF.SAEV........EPA......T.......E.Q.EIADTVTVMGGDDWQLWIDALSDAGVLADGCKTVAYSYMGSDIT..WPIYWHGTIGRAKQHVDEIAAVLNTK..M.QK.IGGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMKESNVHEGCIEQIDRLFRTGLY..................................
#=GR S6GE48_9GAMM/1-183        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S1XZC4_9GAMM/82-317              ................................KPGTPGWYNSAAFHQFAEAE..GLYAKSINGDAFSDDIKQKAIDAIKQDF..G......KIDLVVYSLA.......A..P..RRT..HP.....K.......T......G..V....TYNSTLK....PIG..K.D......L.V...Q...TGI......DT.........D...K...E...VIK.EFTL........PAA......S.......D.E.EIANTVAVMGGEDWQMWIDALADADVLAPGAKTTAFTYLGEKVT..KDIYWDGTIGAAKQDLDKRVVDIRHK..L.AA.LGGD...ARVSVLKAVVTQASAAIPMMPLYLALLFKVMKEAGTHEGCIEQVNGLFRDSLY..................................
#=GR A0A1S1XZC4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1K1XQM1_9BACL/82-317              ...............................r-GASAGWYNSMAFEEFAHQE..GLYAKHVNGDAFSNEIKDETIQLIKQDL..G......KIDLVIYSLA.......T..A..KRT..DP.....Q.......T......G..E....AYYSVLK....PIG..S.P......Y.Q...N...KTV......HF.........H...T...G...EVT.NVEI........QPA......N.......E.E.EISDTVKVMGGEDWHSWMLALKEADVLSQGVKTIAFSYIGPEMT..HPIYRNGTIGRAKDHLEETAHELSKE..L.SS.INGQ...AIVTVCKGLVTQSSTAIPVIPLYISALYKVMKEKGIHEGCIEQMNRLYQDFLY..................................
#=GR A0A1K1XQM1_9BACL/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F0RUD8_SPHGB/93-328                  ................................KTATPGWYNTMAFEDIAKRK..GLKASSVFGDAFSTQVKEAVAQRIQDEL..G......QVDLVIYSLA.......S..P..LRN..DP.....A.......T......G..Q....TYKSVLK....PIG..K.T......F.S...A...LSV......DL.........E...S...E...IVK.QATI........EPA......T.......E.E.QVTETVKVMGGEDWSLWIDFLLKKHLLAKDAMTVAYSYIGPRIT..YPVYREGTIGKAKEHLENSAAQLTNK..L.KA.INGK...AYVSVNKALVTRASAVIPVVPLYMALLYQVMKEKGLHEHCTQQIYRLFTTLLY..................................
#=GR F0RUD8_SPHGB/93-328       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q8EI47_9GAMM/82-318              ................................KAGTAGWYNSAAFDKAAKDA..GLYSRSINGDAFSDEARAKVIELIKTEM.gG......QVDLVIYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PIG..A.P......Y.T...S...TAI......DT.........N...K...D...AIV.QATI........EPA......T.......E.Q.EIADTVTVMGGQDWELWIDALDKAGALADGARTVAFSYIGTDIT..WPIYWHGALGRAKVDLDETAQRLDAR..L.QK.TGGT...ANVAVLKSVVTQASSAIPVMPLYISIVFKVMKELGLHEGTIEQLDRLFRDRMY..................................
#=GR A0A0Q8EI47_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8BDJ9_9PSED/82-318              ................................KAGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNDM.gG......KVDLVIYSLA.......S..P..VRK..LP.....Q.......S......G..E....VIRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...TII.EAAI........EPA......N.......E.Q.EIADTVTVMGGQDWELWIDALEQAGVLAPQARTAAFSYIGTEIT..WPIYWHGALGKAKQDLDETAVRLDKR..L.QA.NGGG...ANVAVLKSVVTQASAAIPVMPLYLSMVFRIMKEKGLHEGTIEQLNRTFRDCLY..................................
#=GR A0A1G8BDJ9_9PSED/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5EMM8_9GAMM/82-317                  ................................RPGTAGWYNTAAFTKYAKEA..GLYAHNVNADAFSNECRDKVIEIIKRDL..G......QVDLVVYSLA.......A..P..VRK..MP.....E.......T......G..E....VVRSSLK....PIG..Q.T......Y.T...S...TAI......DT.........N...K...N...EII.TSSL........EPA......T.......H.E.EIDNTVKVMGGQDWELWIEALKNADVLADGCKTVAYSYIGTEIT..WPIYWHGALGKAKEDLDRAAKANEQR..L.AS.LHGD...ARVAVLKSVVTQASSAIPVMPLYISMCFKIMREQGIYESVIEHIYRLFATTLY..................................
#=GR R5EMM8_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K6ZJ58_9ALTE/82-317                  ................................KTGTAGWYNTAGFHAKASEA..GLYAKTLNGDAFSKELKQQVIDTLKADM..G......KVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..E....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...N...IIH.EIAL........DPA......N.......E.D.EIQQTIKVMGGEDWELWLEALGKADLLADNCKTTAYTYVGKELT..WPIYGQATIGKAKEDLDRAAAAIVKT..Q.AA.KNVQ...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHQGCIEQIYDLFTDKL-t.................................
#=GR K6ZJ58_9ALTE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y4MF02_9FIRM/81-311              ................................RTATAGWYNTAAFEEFAKED..GIYAKTICGDAYSKEIKDETAKLISQDL..G......QIDLLVYSLA.......A..P..RRQ..MP.....D.......-......G..T....VYTSVLK....TVD..E.T......F.T...S...KSL......DL.........G...K...N...ILT.EKTV........EPA......T.......P.E.EVEATVRVMGGEDWKDWVKALKEKGLLSENFRTVAYSYIGPEMT..YPIYNDGTIGQAKKDLYNTAVEMEKE..-.--.-GVS...AYVSVNKAVVTQSSSAIPVVPLYMSILYKVMKEKGLHEDTIQQMSRLWNG---gli...............................
#=GR A0A1Y4MF02_9FIRM/81-311   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0G9HKA9_9XANT/82-318              ................................KAGTAGWYNSAAFDKHAKAA..GLYSKSINGDAFSDAARDKVIELIKTEM.gG......SVDLVVYSLA.......S..P..VRK..LP.....G.......S......G..E....VKRSALK....PIG..S.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......S.......A.Q.EIDDTVTVMGGQDWELWIDALEGAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLNAR..L.GK.HGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR A0A0G9HKA9_9XANT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U3BG67_VIBPR/82-317                  ................................KPGTAGFYNAAAFEKLAHEE..GLYAKSVNGDAFSHEAKQKVVDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIEDTITVMGGQDWELWINALSDAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAATELSDK..L.SA.IGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR U3BG67_VIBPR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R1AM43_9BACL/81-316              ................................RTASAGWYNSAAFEEAAAAA..GRKSFSIVGDAFSDEIKAKTIDLIRTEL..G......QIDLVVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PLG..G.T......Y.S...N...KTV......NF.........H...N...G...DVT.QATI........EPA......T.......E.D.ELRQTIAVMGGEDWQMWIDELEKAGALAEGATTVAYSYIGPEIT..HAVYREGTIGAAKNDLEATAHRLNEQ..L.ST.NGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQMYRLFSERLY..................................
#=GR A0A1R1AM43_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A261TRG7_9BORD/82-317              ................................KAGTAGWYNSAAFHEQAEAA..GLYAKSINGDAFSDEIKARTIDAIKADL..G......QVDLVVYSLA.......S..P..RRK..HP.....K.......T......G..E....VFNSTLK....PIG..K.E......L.K...M...RGL......DT.........D...K...E...IIK.ETVL........PPA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALSEAGVLAPGAKTTAFTYLGDTIT..QDIYWNGTIGAAKKDLDDKVLGIRAK..L.AA.TGGD...ARVAVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQLDTLFRQGLY..................................
#=GR A0A261TRG7_9BORD/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6GNZ5_9GAMM/82-317              ................................KTATAGWYNTAAFHTAAKQE..GLYAHTINGDAFSNEIKQEVIEKIKADF..G......QVDLVVYSLA.......S..P..KRK..DP.....V.......T......G..D....VYSSTLK....PVG..Q.A......Y.T...T...KTY......NT.........D...K...D...EVS.EITL........EPA......N.......D.D.EIQQTIKVMGGEDWELWLAALHDAGVLAPNAKTTAYTYIGKKLT..WPIYGHATIGKAKEDLDRAAAAMRTR..Y.TD.INLE...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQTHRLLRDALY..................................
#=GR A0A1I6GNZ5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E1R1P1_SEDSS/83-318                  ................................RPATPGWYNTRTFDEEAKKA..GIPALSFNGDAFSNEMRAKVGDALKSLG..G......PADLVIYSLA.......S..G..VRT..DP.....A.......D......G..T....LYRSALK....PLG..E.V......Y.K...A...KSV......DF.........I...N...G...RLG.EVEI........APA......T.......E.E.ERRATVKVMGGEDWRLWIDYLGAQGLLAPDVKTVAYSYIGPEVT..HAVYREGTIGSAKKDLEETAKGLNKE..L.SA.SGGG...AYVSVNKAVVTRASAVIPVVSLYISLLFKVMKQKGVHEGCIEQMVRLFSQRLY..................................
#=GR E1R1P1_SEDSS/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4NVL9_PSEO7/82-317              ................................KTASAGWYNTAAFQQAAEEA..GLWSKNINGDAFSDELKQKTIDTIKAEL..G......KVDLVVYSLA.......S..P..RRK..DP.....K.......S......D..E....VYSSTLK....PIG..S.A......I.T...T...KNL......NT.........S...K...R...VID.EMTV........EAA......N.......E.D.EIANTVKVMGGEDWELWIDALKQADVLADGFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATLAIRET..T.AD.INGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKGDGTYEGTIEQIHGLFTENLY..................................
#=GR A0A0F4NVL9_PSEO7/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A0DKU2_9SPIO/81-316              ................................KPASPGWYSNMYFDEAAKKE..GLIAESLNADAFAHETRLTVIDKIRELF..G......QVDLVVYSLA.......S..P..ARK..DP.....N.......S......N..E....IYKSVLK....PLG..K.T......Y.T...A...KSV......DF.........I...R...K...TVA.EVSI........EAA......T.......E.E.EELNTVKVMGGGDWMLWINALLEANVLAEGAKSIAYSYIGPEIT..YAIYRSGTIGSAKENLEKTAGALDSM..L.KS.IGGE...AFVSVNKALVTRASSVIPVVPLYISLLYKIMKEKGIHEGCIEQMYRMLRTKIY..................................
#=GR A0A0A0DKU2_9SPIO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F7M2D6_9GAMM/82-317              ................................KPGTAGWYNSAAFHKFADQE..GLYAKSINGDAFSDEIKEKTIAQIKADL..G......QIDLVVYSLA.......S..P..RRQ..HP.....K.......T......G..E....VHMSTLK....PIG..K.D......V.T...Q...RGI......NT.........D...K...E...TIE.SVTL........PAA......S.......D.E.DIANTVAVMGGEDWQMWIDALDDAGVLADGAKTTAYTYLGDRIT..WDIYWHGTIGAAKKDLDKRVLNIRER..L.AK.KGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKADGSHEGCIEQVYGLFNNSLY..................................
#=GR A0A0F7M2D6_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V4IG30_9CLOT/81-316              ................................KIATAGWYNTAAFEKAADEA..GYYAKTINGDAFSNEVKDETIEAIKKNF..G......KVDLVIYSIA.......S..P..RRK..DP.....N.......T......G..E....VFYSKLK....PVG..E.S......Y.T...N...KTV......DF.........H...N...K...VVS.DIEL........EPA......T.......E.D.EINGTVKVMGGEDWELWIKRLKEANVLEQGAKTVAYSYIGPEIT..YPIYREGTIGKAKEHLEMTVSKINTL..L.NG.INGE...AYVSVNKALVTQSSLAVPVVPLYISLLYKVMRKKQIDENSIEQMYRLFSEKLY..................................
#=GR A0A1V4IG30_9CLOT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y0M7N1_9FLAO/81-316              ................................KTGSAGYYNTAAFEKHAHKA..GLYAKSINGDAFSNEIKRKTLDLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....D.......T......G..V....RYKSVLK....PIG..G.V......F.S...N...KTV......DF.........H...T...G...NVS.EISI........NPA......E.......G.E.DIANTVAVMGGEDWKMWMDALKSENLLSENATTVAYSYIGPSLT..EAVYRKGTIGAAKDHLEATAFTITDD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A1Y0M7N1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A098M9Q8_9BACL/81-316              ................................RTATAGWYNTAAFEAKAKQN..GLKSFSIVGDAFSDSIKAKTIELIKAEF..G......QVDLVVYSLA.......S..P..RRT..HP.....V.......T......G..E....IFSSVIK....PIG..P.T......Y.T...N...KTL......NF.........H...S...G...EVS.FTSI........EPA......T.......D.E.EIRQTTAVMGGEDWRMWIEQLSEAGVIAKGATTVAYSYVGPEVT..QPVYREGTIGKAKNDLENTAIQLNDL..L.QS.QGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKELHENCIEQMYRLFSERLY..................................
#=GR A0A098M9Q8_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A286A862_9SPHI/81-316              ................................KTASPGWYNTAAFEKQAQAD..GLYAKSINGDAFSNEVKQQTIDLIKADL..G......QVDLIIYSLA.......S..P..VRT..NP.....K.......T......G..V....THRSTLK....PIG..G.T......F.S...D...KTV......DF.........H...T...G...VVS.TVTI........EPA......N.......E.E.EIENTVAVMGGEDWEMWIDDLKAAGVLAEGFTTVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFTITDK..L.AG.LNGK...AYVSVNKALVTQASSAIPVIPLYISFLYKTMKEKGLHEGCIEQIERLFSERLY..................................
#=GR A0A286A862_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R0BX63_9GAMM/82-316              ................................KPGTAGWYNSAAFHEFAQAE..GLYARSVNGDAFSDEVKARVIEIIKADL..G......QVDQVVYSLA.......A..P..RRK..HP.....R.......T......G..E....VISSTLK....PIG..A.P......I.T...L...KGL......DT.........D...K...G...VLT.ETTL........QPA......S.......E.E.EIAGTVAVMGGEDWQMWIEALLAAGVLAEGATTQAFTYVGEEIT..QAIYWNGSIGAAKKDLDKRVLDIRRQ..L.AA.IGGD...ARVSVLKAVVTQASAAIPTMPLYLSLLFKVMKEQGTHEGCIEQLDTLYD----ily...............................
#=GR A0A0R0BX63_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W1SDF7_9GAMM/82-317              ................................KTATAGWYNTAAFHQEAESE..GLKFHSINGDAFSDEIKQESIDYIKNNM..G......KIDLVVYSLA.......S..P..KRK..DP.....E.......S......G..E....LYSSVLK....PIG..K.Q......Y.T...T...KTY......NT.........D...K...D...QVH.EVTL........DPA......T.......D.D.DIANTVKVMGGEDWERWIKALHDADLLANDCQTTAYTYIGKKLT..WPIYGHATIGRAKEDLDRASSALDDT..Y.KD.VNLK...AYVSSLKALVTQASSAIPVMPLYISLIYGVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR A0A0W1SDF7_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G7CAU4_9FLAO/81-316              ................................RPASPGWYNSAYFEEQAHKA..GLYAKSINGDAFSHEIKKQTVDLIKADL..G......KIDLVIYSLA.......S..P..VRV..HP.....D.......S......G..E....KFKSVLK....PLE..G.V......F.T...N...NTV......DF.........H...T...G...VVS.EISI........EPG......N.......Q.E.DIDNTVTVMGGEDWGFWIDALQEADVLAPGFKTVAYSYIGSELT..EAVYRKGTIGRAKDHLEATAFTITDK..L.KA.LEGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEKGLHEGCIEQIQRLFSERLY..................................
#=GR A0A1G7CAU4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2ZI73_VIBPR/98-334                  ...............................g-VGSAGWYNNHFFKQHAEKE..GRIAININGDAFSQQVRNEVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..NP.....E.......T......G..E....LWRSAIK....PIG..E.P......V.S...G...SSI......LL.........E...N...D...QWI.DSKL........EPA......S.......E.K.EIEATIKVMGGEDWEDWIDTLINNDSIAEGCKTIAFSYIGPEVT..HSIYLDGTLGRAKVDLHQTSHSLNLK..L.AN.YNGG...AYATVCKALVTKASVFIPGLSPYMIALYKVMKEKGTHEGCIEQMHRLFEEKLY..................................
#=GR U2ZI73_VIBPR/98-334       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E2VBJ0_9GAMM/82-317              ................................KPGTAGYYNSWAFEQAAQEA..GLYAKSINGDAFSHEMRAKAVELIQQDL..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSVLK....PIG..E.T......Y.R...S...TAI......DT.........N...K...D...QII.KAEV........EPA......T.......E.Q.EIQDTIEVMGGEDWELWMQALGEAGVLAKGARTVAFSYIGTEMT..WPIYWHGALGKAKEDLDRAAKVLNDK..L.AP.EGGS...ANVAVLKSVVTQASAAIPVMPLYIALVYKVMKEKGLHEGTIEQLNRLFATQLY..................................
#=GR A0A1E2VBJ0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0H3J994_CLOPA/95-328              ................................KTATAGWYNTAAFEQAALDK..GYYSKTINGDAFSKEIKDKTVELIKKDF..G......KLDLVIYSIS.......A..P..RRR..DP.....F.......S......G..E....IYYSALK....PIG..N.V......Y.K...N...KTV......NF.........H...T...F...EVS.NIEI........EPA......N.......Q.D.EIDGTIKVMGGQDWELWIDRLMEENLLEKGANTIAYSYIGPEIT..HPIYRHGTIGKAKEDLEDTSLRIDYK..L.KA.VDGK...AFISINKALVTQSSSAIPVVPLYISVLDKVVKEKNIQEDSIEQIYRLFSK---i.................................
#=GR A0A0H3J994_CLOPA/95-328   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U1FL06_TRESO/91-327                  ................................KGGTPGWYNNAAFDRAAKKE..GLASVTLNADAFADETRALVIDEVKKLG..A......KFDLIIYSLA.......S..P..VRT..DP.....D.......T......K..V....LYKSVIK....PRG..K.P......Y.S...G...KCI......DI.........M...T...E...TLK.DSSA........EPA......T.......E.E.EIASTIKVMGGDDWRRWIKQLSDAGVLAQGCRTIAYSYIGPELS..HAIYRDGTIGTAKLDLEKAALDLDKE..L.KSsVGGG...AYISVNKGLVTRSSAVIPIISLYLSILFKVMKEKGTHEGCIEQMERLFTERLY..................................
#=GR U1FL06_TRESO/91-327       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7YPZ0_VIBA7/84-319                  ................................KPGTAGFYNAAAFDKLAHEA..GLYAKSLNGDAFSHQAKQKAIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSSLK....PIG..Q.T......Y.T...A...TAV......DT.........N...K...D...III.EASV........EPA......T.......E.Q.EIADTVTVMGGQDWELWIHALAEAGVLAQGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAASALNEQ..L.SV.LGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCIEQIYRMFSQRLY..................................
#=GR F7YPZ0_VIBA7/84-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1U9N8L5_9GAMM/82-314              ................................KTATAGYYNTSAFHDAAKAE..GLYAHTINGDAFSDACKEKVIAELKNGI..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....VYNSVLK....PIG..K.E......Y.T...S...KNL......NT.........D...T...L...KIS.DVTI........EPA......S.......D.E.EIANTVKVMGGEDWEMWIDALKGADLLADNFQTVAYTYLGDKLT..WPIYGKATIGKAKEDLDRAAKTLSAK..H.--.-GGN...ARVAVLKAVVTQASSAIPVMPLYLAILFKVMKAQGTHEGCIEQIQRLFKECLY..................................
#=GR A0A1U9N8L5_9GAMM/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A231MZV8_9GAMM/82-317              ................................KTGTAGWYNAAAFDKAAKEE..GLYAKSINGDAFSNECREKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VVRSALK....PIG..E.P......Y.K...S...VAL......DT.........N...K...D...VLV.EAVV........EPA......N.......E.Q.EIADTIQVMGGQDWELWMNALEAAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAHAIDAK..L.KA.GGGN...AHVAVLKSVVTQASAAIPVMPLYISMAFKVMKEQGIHEGCIEQIQRLFHDRLY..................................
#=GR A0A231MZV8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_COXBU/82-319                    ................................RTASPGWYNTAAFEKTALAA..GLYAKSINGDAFSDEIKQQTIDLIQKDW.qG......GVDLVIYSIA.......S..P..RRV..HP.....R.......T......G..E....IFNSVLK....PIG..Q.T......Y.H...N...KTV......DV.........M...T...G...EVS.PVSI........EPA......T.......E.K.EIRDTEAVMGGDDWALWINALFKYNCLAEGVKTVAFTYIGPELT..HAVYRNGTIGRAKLHLEKTARELDTQ..L.ESaLSGQ...ALISVNKALVTQASAAIPVVPLYISLLYKIMKEKNIHEGCIEQMWRLFKERLY..................................
#=GR FABV_COXBU/82-319         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D6SAB6_9PSED/82-317              ................................KAGTAGWYNSAAFEKAAQAK..GLYARSINGDAFSDEVKRVTIETIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSVLK....PVG..K.T......V.N...F...RGL......DT.........D...K...E...VIK.ESVM........EPA......T.......E.A.EIAHTVAVMGGEDWQMWIDALQEAGVLADGAKTTAFTYLGEEIT..HDLYWNGSIGAAKKDLDQKVLGIREK..L.AA.TGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVDGLFRESLY..................................
#=GR A0A0D6SAB6_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B7UHJ5_9GAMM/82-317              ................................KTGSAGWYNTAAFEQAAAAE..GLWNKHLNGDAFTDEMKSKAIDIIQSEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......S......G..E....IYSSVLK....PIG..Q.S......Y.T...A...KNL......NT.........S...K...R...EIE.EVSV........EPA......N.......D.D.EIFNTVKVMGGEDWERWLDQLHAAGVLAENVQTVAYTYIGKELT..WPIYGKATIGRAKEDLDRAASAITGK..L.SA.QHGH...AYVASLKALVTQASSAIPIMPLYISLLYRVMKEEGTHEGCIEQIYGLFQTALY..................................
#=GR A0A1B7UHJ5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
L8JCF9_9GAMM/83-319                  ...............................g-VGSAGWYNNIYFKQEAEKN..GLKAVNLIGDAFSPKMREQVIRTIKEEF.dG......QVDLIIYSLA.......S..G..VRP..NL.....Q.......T......G..E....FWHSAIK....PIG..N.A......I.N...G...LTL......NL.........E...H...E...ELT.ETSL........SPA......S.......D.Q.EVHDTIKVMGGEDWEEWITLLNNAGVLAEGCKTIAYSYIGPKST..YPIYHLGTLGQAKLDLHNKADLIHQK..L.QD.IKGE...AHVAVCKALVTKASVFIPGFSPYLLALFKVMKTMGLHEGCIEQAQRLFNSKLY..................................
#=GR L8JCF9_9GAMM/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B1FYG3_9BACT/81-316              ................................RPASPGYYNSAAFEKHAAEA..GLYAKSINGDAFSKEIKQQTIDMIKEDL..G......QVDLAIYSLA.......S..P..VRT..NP.....N.......T......G..K....RHKSVLK....PIG..G.V......F.S...N...KTV......DF.........H...T...G...NVT.EVSI........DPA......N.......E.D.DIANTVEVMGGDDWEMWIDEMKAAGVLADGAQTFAYSYIGPKLT..EPVYRKGTIGAAKDHLEATAFKIQDK..L.AD.INGK...AVVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLYADRIY..................................
#=GR A0A1B1FYG3_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D0K857_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRETLDLIKADL..G......QVDLIIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWIDALKAENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFKDRLY..................................
#=GR A0A0D0K857_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C1DKX4_9FLAO/81-316              ................................KTASPGWYNSAAFEAEAHKA..GLYAKSINGDAFSNEVKQQTLDLIKADL..G......QIDLVIYSLA.......S..P..VRL..HP.....V.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........EPC......T.......E.E.EIANTVAVMGGEDWSMWMDALKKENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFAITDS..L.KD.LDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGLHEGCIEQIQRLFQDRLY..................................
#=GR A0A0C1DKX4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F6CVE2_MARPP/82-317                  ................................KPGTAGWYNAAAFDKAAKEE..GLYAKSINGDAFSNEARDKVIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....VVRSVLK....PIG..Q.P......Y.R...S...TAI......DT.........N...K...D...VII.EAEI........EPA......T.......E.E.EIAATTTVMGGEDWELWMSALQEAGVLAEGVRTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRASAAINTE..L.SA.LNGG...ANVAVLKSVVTQASSAIPVMPLYLAMVFKVMREKGLHEGCMDQIYRMFAERLF..................................
#=GR F6CVE2_MARPP/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A193KBH8_9VIBR/82-317              ................................KPGTAGYYNAAAFDKLAHEE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSSLK....PIG..D.T......Y.T...S...TAV......DT.........N...K...D...QII.EASI........EPA......T.......E.E.EIADTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRASTALNEK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMQQIYRMFSQRLY..................................
#=GR A0A193KBH8_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D3VCM0_9BACL/81-316              ................................RTASAGWYNSAAFEEAAKEA..NRQSFSIVGDAFSDEIKEKTIDLIRTEL..G......KIDLVIYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PIG..E.T......Y.T...N...KTV......NF.........H...N...G...EVT.ETTI........EPA......S.......E.E.EIRQTIAVMGGEDWEMWIDELEQAGVLAEGATTVAYSYIGPEIT..HAVYREGTIGYAKNDLEATAKRLHEK..L.GT.HGGR...AFVSVNKALVTQSSSAIPVVPLYIAALYKVMKEQGIHEGCIEQMYRLFSDRLY..................................
#=GR A0A0D3VCM0_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV1_PHOPR/82-317                   ................................KPGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSHEAKQKTIDLIKADL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSSLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWINALSEAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGKAKMDLDRAASELNNK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMQQIYRMFTQRLY..................................
#=GR FABV1_PHOPR/82-317        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D4ZAB7_SHEVD/82-317                  ................................KSGTAGWYNSAAFDKLAKAE..GLYSKSLNGDAFSHEAKQKAIDIIKADL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...LII.ETSV........EPA......S.......E.Q.EIQDTVTVMGGEDWELWLAALSEAGVLADGCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAKALDEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRKEGLHEGCIEQINRMFAERLF..................................
#=GR D4ZAB7_SHEVD/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A5HZ93_9VIBR/83-319              ...............................g-VGSAGFYNNIAFKKFAEEE..GRIAVNIQGDAFSDSIKEQVIEAVETYF.eG......EVDLIVYSVA.......S..G..VRP..KS.....N.......S......G..E....MWRSAIK....PIG..Q.S......V.S...G...ASI......LL.........E...T...D...TWQ.QTTL........PPA......T.......D.Q.EVDETIKVMGGEDWEAWVDALINSESIGEGCKTLAFSYIGPELT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FNGG...AYATVCKALVTKASVFIPGLTPYILALYKVMKERGTHEGCIEQMQRLFRDKVY..................................
#=GR A0A0A5HZ93_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J3C3J0_FLASC/81-316                  ................................KTASPGWYNSAAFEAEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRQ..HP.....T.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DITNTVAVMGGEDWAMWIDALKSENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDNLEATAFTITDS..L.KS.VGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR J3C3J0_FLASC/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0W8JGR3_9VIBR/82-317              ................................KPGTAGFYNAAAFDKCAHEA..GLYAKSINGDAFSHEAKQKAIELIRQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....LVRSALK....PIG..E.T......Y.T...S...TAV......DT.........N...R...D...VII.EASI........EPA......T.......E.Q.EIEDTVTVMGGQDWELWINALNDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAATALNQQ..L.SA.KQGS...ANVTVLKSVVTQASSAIPVMPLYISMVFKKMREEGVHEGCMAQIYRLFSERLY..................................
#=GR A0A0W8JGR3_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0L0WDE5_CLOPU/81-314              ................................RTATAGWYNTASFEKLAKES..EYYAKSINGDAFSNETKEKTIELIKRDL..G......KIDLVIYSVA.......S..P..KRV..DP.....V.......T......G..E....IFHSVLK....PIG..K.P......Y.K...N...KTV......DF.........H...N...Y...NIS.EIEI........EPA......T.......E.E.EINQTVAVMGGYDWKLWIDLLRQSDVLEKGAMTIAYSYIGPEIT..YPIYRNGTIGKAKEHLEATAQLLNDD..L.RN.INGK...ALVSVNKALVTQSSSAIPVVPLYISLLSKIMKGKGIDEGCIEQIYRLFSN---i.................................
#=GR A0A0L0WDE5_CLOPU/81-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B8WRJ0_9BACI/81-316              ................................RTASAGWYNSAAFEEQANQL..GLKSYSIVGDAFSNEIKEKTIELIKNEF..K......NVDLVIYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PIG..T.A......Y.S...N...KTM......NF.........H...T...G...EVS.DTTI........EPA......T.......E.E.EVRQTIAVMGGEDWGMWIDELSKAGVLADGATTVAYSYIGPEVT..HAIYREGTIGKAKNDLEQTAVKLNEQ..L.GV.KGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKGIHENCIEQIYRLFSDRLY..................................
#=GR A0A1B8WRJ0_9BACI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090IJB8_9GAMM/82-317              ................................KPGTAGWYNSASFEKYAAEE..GLYAKSINGDAFSDQAKQTAINLIKEDL..G......QIDLVVYSLA.......S..P..VRK..LP.....N.......T......G..E....VVRSCLK....PIG..E.T......Y.T...A...KAV......DT.........N...K...N...KIF.EASV........EPA......T.......E.Q.EIKDTITVMGGEDWELWMSALSDAGVLADGCKTVAYSYIGTEIT..WPIYWDGALGKAKQDLDRAAHAIDAD..L.KV.KGGS...ANVAVLKSVVTQASAAIPVMPLYIAMAFRVMKEHGLHEGCLEQISRLFRGSLY..................................
#=GR A0A090IJB8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H4B4L6_9FLAO/81-316              ................................RPASPGYYNSAAFEDQAHKD..GLYAKSINGDAFSNEIKAQTIKLIKEDL..G......KIDLLVYSLA.......S..P..VRQ..HP.....V.......T......G..E....KFKSTLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...EVK.DITI........EPC......T.......E.E.EIKNTVAVMGGEDWEFWIDALKEQDVLAEDFKTVAYSYIGPSLT..KAVYRDGTIGRAKDHLEATAFKIKDQ..L.KD.IKGE...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIERLFNQRLY..................................
#=GR A0A1H4B4L6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A6CX48_9VIBR/83-319                  ...............................g-VGTAGWYNNIYFRQEAEKR..GLIAKNFVGDAFSSEMRQQVIDYIKSEF.gG......KVDLVVYSLA.......T..G..VRP..DP.....E.......S......G..H....LWRSAIK....TVG..E.P......V.S...G...PTI......NI.........E...H...D...KLE.SMEV........GTA......S.......A.E.EMEATIKVMGGEDWQSWMEILSDADVLAHGCKTVAYSYVGPEVT..YPIYHHGTLGRAKQHLHHTADELNQK..L.AT.LGGE...AYVSVCKALVTKASVFIPAFSPYILSLFKVMKQKGTHEGCIEQMQRLFSQRLY..................................
#=GR A6CX48_9VIBR/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R2UC91_9GAMM/81-316              ................................KPGSAGWYNSAAFHKHADAN..GIYAKSINGDAFSDEVKQRAITTIKEDL..G......QIDLVIYSLA.......A..P..RRQ..HP.....K.......T......G..E....VFNSTLK....PVG..K.N......I.S...M...RGI......NT.........D...K...E...TIQ.EFSL........EAA......S.......E.Q.EIQDTVAVMGGEDWQMWLEALSVAGVLAEGAKTTAFTYIGEKMT..WDLYWDGTIGQAKKDLDTKVISIRDS..L.AR.SGGD...ARVAVLKAVVTQSSSAIPIMPLYLAMLFREMKADGSHEGCIEQLYRLFTEGLY..................................
#=GR A0A0R2UC91_9GAMM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085F744_9RHIZ/82-315              ................................KTASAGWYNNRAFEQRAKAA..GRLALTIEGDAFSDAIKAETIEAIRSNL..G......QVDLIVYSLA.......S..P..VRT..DP.....A.......T......G..E....TYRSAIK....PFG..A.A......V.A...A...KTL......NT.........A...T...G...EVS.EVVI........EPA......T.......D.E.EAAATVKVMGGEDWQLWISALADAGVLADGFTTLNYTYLGSELT..WPIYHKGTLGVAKADLDRAAGEIRGR..F.G-.-DTS...AYVVALKAVVTQASSAIPVVPLYGTLLLKVMAEMGLNEGTIEQIDRLFRTKL-a.................................
#=GR A0A085F744_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C5VPQ2_9GAMM/82-317              ................................RTASAGWYNTKAFESFAHEA..GVYARSFNVDAFSNEAKAAVIEAAKSEL..G......PIDLVIYSLG.......S..P..RRT..DP.....N.......T......G..I....THSSSLK....AIG..E.P......V.T...R...KNL......NT.........D...T...R...QVG.EFTL........EPA......N.......D.E.EIANTIKVMGGEDWELWMEALVEAGVLADGVKTTAFSYIGKELT..WPIYGGATIGRAKQDVDRACKVIAQR..L.KP.LNGS...AHVSVLKAVVTQSSSAIPVMPLYLSILIKVMKEQGTNEGCIEQVNGLFNNELY..................................
#=GR A0A0C5VPQ2_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4R1I7_9GAMM/82-317              ................................RTASAGWYNTAAFQQAADEA..GLWSKNINGDAFSDELKAKAIETIKAEM..G......KVDLIIYSLA.......S..P..RRT..DP.....K.......S......G..E....TFSSVLK....PIG..Q.T......V.T...T...KNL......NT.........T...M...R...SIE.EVSV........EAA......R.......E.E.EIANTVKVMGGEDWELWLEALKEADVLAEGFKTSAYTYIGKELT..WPIYGHATIGKAKEDLTRAADAIKAS..T.QA.LNGE...AYVASLNAVVTQASSAIPIMPLYISTLFRVTKEDGTYEGTIEQIHGLFSENLY..................................
#=GR A0A0F4R1I7_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y4FCX4_9FIRM/82-313              ................................RTATAGWYNTAAFEKFAKEE..GLYAKSLNGDAFSAEMKEKVIETIKNDW..G......KADMVIYSLA.......A..P..RRT..DK.....D.......-......G..T....VYTSSLK....TTG..D.A......F.T...E...KSL......DL.........K...N...N...TVG.EKTI........EPA......T.......E.E.ELKGTIKVMGGEDWEDWIHALTEADVLTEDAVTIAYSYIGPELT..YPIYYNGTIGNAKKHLTESAKRIGKN..Y.--.-PVQ...AYVSVNKGLVTQASAAIPIVPLYFTILYKVMKEQNVHEGCIEQIARLFEDRLY..................................
#=GR A0A1Y4FCX4_9FIRM/82-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C5WK54_9GAMM/83-319              ...............................g-VGSAGWYNNIFFRQEAEKA..GRIATNIVGDAFSQPVRQQVIEAINKDL.gG......QVDLVVYSLA.......T..G..VRP..NP.....E.......T......G..E....MWHSVIK....TTG..Q.P......V.V...G...PTL......NL.........E...T...D...SLA.EMTV........EKA......T.......E.Q.EIADTVKVMGGEDWADWIQCLSEAGVLAQGCRTVAYSYIGPEVT..YPIYHHGTLGRAKEHMHTTADTLNTQ..L.AA.IGGQ...AHVAVCKALVTKASVFIPAFTPYMLALFKVMKQKGTHEGCIEQMQRLFNGRFY..................................
#=GR A0A0C5WK54_9GAMM/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7LC75_9FIRM/87-321              ................................RTATAGWYNTAAFESFAAND..GLYAQTINGDAFSREIKDETIAKIKRDL..G......KVDMVIYSLA.......A..P..RRT..MA.....D.......-......G..T....VFSSVLK....ATT..D.T......F.V...S...KSL......DL.........R...H...N...TIE.EASI........PTA......T.......E.E.EIESTIKVMGGEDWAEWIDALVAADAIEGNAITVAYSYIGPELT..YPIYKEGTIGHAKEHLHKTANLITKE..Y.QQ.RGIH...AYISVNKALVTQASAAIPVVPLYISLLYKVQKELGTHEGCIEQINRMFTEKL-l.................................
#=GR A0A1M7LC75_9FIRM/87-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A167FGJ7_9BACL/81-316              ................................RTASSGWYNSAAFEAAAEAA..GLKSFSVTGDAFSPETKAKTIELIRTEL..G......QIDLVIYSVA.......S..P..RRT..DP.....H.......T......G..E....MVNSVLK....PIG..K.P......F.T...N...KTV......NF.........H...T...G...EVS.QITI........DPA......T.......E.D.EIRDTVTVMGGDDWEMWIHDLHEAGVLANDAMTVSYSYIGSEIT..KAVYRDGSIGQAKDHLEATATRMNEQ..L.SV.TGGS...AYVCVSKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQTYRLFSERLY..................................
#=GR A0A167FGJ7_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5VRV6_9FIRM/84-316                  ................................RTATAGFYNTRAFEEEAHAA..GLYAKSINGDAFSQEIKDQVIDTIKADL..G......KVDMVVYSLA.......A..P..RRT..TA.....D.......-......G..T....KYTSVLK....TVG..Q.E......Y.S...N...KTL......VL.........K...D...N...TVT.EAHI........SAA......N.......E.D.EINATIKVMGGEDWIDWMQALSDAGVLADDVITVAYSYIGPKIT..FPIYAEGSIGQAKKDLYKSADIINEK..F.P-.-NIK...AKIAINKALVTQSSAAIPIVPLYITLLYKVMKEKGLHEGCIEQMQRLFMDKI-l.................................
#=GR R5VRV6_9FIRM/84-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1U7JIH9_9RHOB/83-319              ...............................s-VGSAGWYNALYFREAAEQE..GLIAKNFIGDAFSAEMRQQIIDYIKTEF.gG......TVDLVVYSLA.......T..G..VRP..DP.....E.......T......G..Q....KIRSSLK....TVG..E.P......L.T...G...YTV......NL.........E...K...D...CFD.EGVL........EAA......D.......P.Q.EIEDTVRVMGGEDWAEWIKVLSDAGVLAEGCQTVAYSYIGSQIT..RRIYHEGTLGHAKEHLHKTADVLDEQ..L.RK.IGGQ...AHVAVCKALVTKASVFIPAFSPYILALFKVMKELGLHEGCIEQMQRLFAQRLY..................................
#=GR A0A1U7JIH9_9RHOB/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R1LEB4_9GAMM/82-317              ................................KTGTAGWYNSAAFDKAAKSA..GLYSKSINGDAFSHQAKQTAIDLIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VVRSCLK....PIG..E.T......Y.R...S...TAV......DT.........N...K...N...CII.ETEV........EPA......T.......E.Q.EIEDTITVMGGQDWELWMDALDQAGVLAEGCRSVSYSYIGTSIT..WPIYWDGALGKAKIDLDRAAGEINAK..L.AK.KGGG...ANVAVLKSVVTQASSAIPVMPLYIAMAFKVMKEKGVHEGCIEQIDRLFRTQLF..................................
#=GR A0A1R1LEB4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6IWM9_9VIBR/83-320              ................................KSGGAGFYNNYYFKQYAQRE..GRTAINIQGDVFSRQTKESVIEAIETYF.eG......EVDLIVYSVA.......S..G..KRR..KT.....E.......N......G..D...tFWYSAIK....PIG..Q.S......I.H...S...ALI......DL.........G...N...D...QWQ.DVLL........EPA......S.......E.E.EIESTLKVMGGEDWEAWIDALINSESIAEGCQSVAFSYIGSELT..HPMYLDGTLGRAKVDLHQTSHSLNLK..L.AN.YSGG...AYAAVCQALLTRASIFIPGLSPYLIALNQVMQSQEIHEDCNRQMQRLFTEKLY..................................
#=GR A0A1Y6IWM9_9VIBR/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K2JK91_9GAMM/82-317                  ................................KTATAGWYNTAAFHQQAEQA..DLYYHTINGDAFSDECKADVIERIKADL..G......QVDLVIYSLA.......S..P..KRR..DP.....K.......T......G..E....VYSSTLK....PVG..Q.T......Y.T...T...KTY......DT.........D...K...D...RVH.DVTL........EPA......N.......D.E.EIANTVKVMGGEDWELWLSALHEAGVLAPNCRTTAYTYIGKKLT..WPIYGHATIGRAKEDLDRAAAALNER..Y.QD.IQLQ...AWVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR K2JK91_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_XANCP/82-318                    ................................KAGTAGWYNSAAFDTHAKAA..GLYSKSINGDAFSDEARAKVIELIKTDM.gG......QVDLVVYSLA.......S..P..VRK..LP.....S.......T......G..E....VKRSALK....PIG..N.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......T.......E.Q.EIEDTITVMGGQDWELWIDALDSAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLDAR..L.QA.SGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR FABV_XANCP/82-318         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
V6S195_9FLAO/81-316                  ................................KTASPGWYNTAAFEQEAKKA..GLYAKSINGDAFSNEVKQQTIDMIKADL..G......QVDLIIYSLA.......S..P..VRV..HP.....T.......T......G..V....THRSVLK....PIG..N.T......F.T...N...KTV......DF.........H...T...G...NVS.QVSI........DPA......N.......Q.E.DIDNTVVVMGGEDWSMWMDAMKAAGVLADGAMTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEITDK..L.KD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQMQRLFEQRLY..................................
#=GR V6S195_9FLAO/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7H6A9_9FLAO/81-316              ................................KTASPGWYNSAAFENEAHKA..GLYAKSVNGDAFSNEIKKQTLNLIKADL..G......QVDLVIYSLA.......S..P..VRM..HP.....V.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...S...G...KVS.EISI........EPC......S.......G.D.DIENTVAVMGGEDWGMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.AD.IEGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYQERLY..................................
#=GR A0A1M7H6A9_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A143XGL5_9FIRM/81-311              ................................RTATAGWYNTAAFEDLANQD..GLYAKTIIGDAYSPSVKEEVMSLIRKDF..G......QIDLLVYSLA.......A..P..RRA..MP.....D.......-......G..T....LYTSVLK....TTK..E.P......F.T...S...KSL......DL.........N...K...N...QLT.EKTV........LPA......T.......Q.D.EIESTIHVMGGEDWSDWISALRNEHLLSENIRTVAYSYIGPEMT..YPIYTEGTIGQAKQHLYHTALQLNAE..-.--.-GIP...AYVSVNKAVVTQSSSAIPIVPLYISILYKVMKEAGIHETTIEQMYRLWNY---yll...............................
#=GR A0A143XGL5_9FIRM/81-311   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8D9A1_9FLAO/81-316              ................................RPASPGWYNSAAFETQAHKD..GLYAKSINGDAFSNEIKAQTLKLIQDDL..G......KIDMVIYSLA.......S..P..VRT..HP.....D.......T......G..E....RFKSVLK....PIG..E.T......F.T...N...NTV......DF.........H...T...G...VVK.EISI........EPC......S.......G.D.DIDNTIAVMGGEDWKMWIDLLKSADVLSEDFKTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFEITDS..L.KD.INGK...GYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIERLFNERLY..................................
#=GR A0A1G8D9A1_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M7BKU9_9GAMM/83-317              ................................KTGTAGWYNSAAFDKAAKQA..GLYSKSINGDAFANETRARAIEIIKNEM.gG......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..K.P......F.T...N...TSV......DT.........N...K...D...TVI.EATI........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSAAGVLAEHAKTVAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKQLRSR..H.--.PGLE...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHEGPIEQANRLFHDRLY..................................
#=GR A0A1M7BKU9_9GAMM/83-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I0QW63_9GAMM/82-317                  ................................KTGSAGWYNSAAFDKAAKEE..GLYSKSINGDAFSNECRDTVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....E.......S......G..E....LVRSALK....PIG..A.P......Y.E...S...TAL......DT.........N...K...D...KLV.TAVV........EPA......N.......E.Q.EIADTIQVMGGQDWELWMNALADAGVLADNAKSVAYSYIGTELT..WPIYWHGTLGKAKEDLDRAAQAIDAK..L.KA.KGGS...ANVAVLKSVVTQASAAIPVMPLYIAISFKIMKEQGIHEGTIEQIQRLFATKLY..................................
#=GR I0QW63_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5K1M3_9CLOT/81-313                  ................................RTATAGFYNTRAFEEEAKKA..GLYAKSINGDAFSLEIKQQVIDTIKADL..G......TVDMVIYSLA.......A..P..RRV..TP.....D.......-......G..H....KYSSVLK....TVG..E.E......Y.S...N...KTL......VL.........K...D...N...TVT.MAHI........PAA......T.......E.E.EIENTIKVMGGEDWIDWMQALSDAGVLAEHVTTVAYSYIGPKIT..FPIYAEGSIGMAKKDLYRSSDIINEK..F.A-.-NVT...SYIAINKALVTQSSAAIPVVPLYITLLYKQMKAKGVHEGCIEQMARLFLDKM-a.................................
#=GR R5K1M3_9CLOT/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6FAW8_9LACT/83-319              ...............................n-LGTAGWYNNIAFREAAEKE..GLIAKNFVQDAFSHESKQEVIDYIKSEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....E.......T......G..E....TYTSSIK....AIG..E.P......V.V...G...PHI......NM.........Q...N...Q...TFY.TETL........EPA......T.......D.Q.EIANTVKVMGGEDWELWMKALKEADVLVDGVLTTNYSYLGTELN..HSYYGGGTLGRAKADCDEKAQNINEL..L.AD.INGK...AQIVVATAVTTKASSVIPFFPVYCIGLYKVMSDKGTHETPIMHQDRIYREMIY..................................
#=GR A0A1N6FAW8_9LACT/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1HD48_9GAMM/83-323              ...............................g-IGTAGWYNNIFFRQEAERA..GRIATNIVGDAFSPAVRRQVIDAIQADL.gG......QVDLVVYSLA.......T..G..VRP..KP.....E.......A......T..NtapdMWRSVIK....TLG..Q.P......V.T...G...PTL......NL.........E...R...D...TME.MLTV........GTA......S.......E.Q.EAAETVKVMGGEDWTDWIACLADAGVLAPGCRTVAYSYVGSPLT..YPIYHQGTLGQAKKHLHHSADEINQR..L.AD.IGGQ...AHVAVCKALVTKASVFIPAFAPYILALFKVMKAKGCHEGCIEQMQRMFATKFY..................................
#=GR A0A0J1HD48_9GAMM/83-323   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085HMT1_9ENTR/82-317              ................................KPGSAGWYNSAAFDEAAKRE..GLYAKSINGDAFSDECRDEVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....K.......T......G..E....IVRSALK....PIG..E.V......Y.T...S...KAI......DT.........N...K...D...QII.TASI........EPA......T.......E.E.EVQNTVTVMGGEDWELWMGALSEAGVLADGVKTVAYSYIGTDLT..WPIYWHGALGKAKEDLDRAAGELRNQ..L.AP.LNGS...ANVAVLKSVITQASSAIPVMPLYISMVFKLMKAQGIHEGCIEQINRLMTTSLY..................................
#=GR A0A085HMT1_9ENTR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E3G636_ENTLS/82-317                  ................................KPGSAGWYNSAAFDEAAKKE..GLYSKSINGDAFSDECRDEVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....K.......T......G..E....IVRSALK....PIG..E.V......Y.T...S...KAI......DT.........N...K...D...QIT.TASI........EPA......T.......E.E.EVQNTVTVMGGEDWELWIDALSKANVLADGVKTVAYSYIGTDLT..WPIYWHGALGKAKEDLDRAASALRGQ..L.AP.LHGS...ANVAVLKSVVTQASSAIPVMPLYISMVFKLMKEQGIHEGCIEQINRLMTTSLY..................................
#=GR E3G636_ENTLS/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E8M6W6_9VIBR/82-317                  ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKEKTIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.SV.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCMEQIFRMFSQRLY..................................
#=GR E8M6W6_9VIBR/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1W9N8P8_9SPIO/81-316              ................................KPASPGWYNNKYFDEAAKAA..GIRAESMNADAFSHQTRAAVVQRIKELF..G......EIDLVVYSIA.......S..P..VRT..DP.....D.......S......G..T....AYKSVLK....PLG..K.T......Y.T...A...KSV......DF.........L...K...G...TVG.EASI........EPA......S.......D.D.EKNQTIKVMGGDDWTLWVDALLKGGVLAKGAKTMAYSYIGPEVT..YAVYRAGTIGAAKEHLEKTSKTLNDT..L.SA.HGGE...AFVSVNKALVTRASSVIPVVPLYISLLFKIMKAKGIHEGCIEQMYRLLASKVY..................................
#=GR A0A1W9N8P8_9SPIO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PSEA6/82-317                    ................................KTATAGWYNTAAFHKEAKEK..GLFAQTINGDAFSKEIKAQAIETIKREM..G......QVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..E....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...RIH.DISL........EPA......N.......E.D.EIAQTIKVMGGEDWELWLDALAEADLLAYGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAIVSK..N.QE.KHIE...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIKGLFTERLF..................................
#=GR FABV_PSEA6/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G8QV68_SPHPG/93-328                  ................................KTATPGWYNTMAFEKRAKEA..GLKAESIFGDAFSDETKQKTGALIKSLF..G......QVDLVIYSLA.......S..P..LRT..DP.....K.......T......G..T....TYRSVLK....PLG..K.P......F.S...A...LSV......DM.........D...C...D...VVK.MATI........EPA......E.......G.T.QAEETVHVMGGEDWALWIEYLMQENLLAEGAMTVSYSYIGPKIT..YPVYREGTIGKAKEDLEKTAAELTKK..L.QQ.IQGK...AYVSVNKALVTRASAVIPVVPLYMAILYQVMKERDLHEHCTEQIYRLFTEKLF..................................
#=GR G8QV68_SPHPG/93-328       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1L8PPP6_9LACT/82-318              ...............................s-LGTAGWYNNIAFREAAEKD..GLTAKNFVQDAFSNETKQEVIDYIKNDF.gG......KVDLVVYSLA.......S..G..RRT..DP.....D.......T......G..E....TYYSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...Q...Q...TYY.TETL........DPA......T.......D.Q.EIADTVKVMGGEDWELWMKALKEADVLADDVLTTNYSYLGTELN..QPYYGHGTLGRAKADCDEKADNINEL..L.AD.INGK...AKIVVATAVTTKASSVIPFFPVYCIGLYKIMDEKGTHETPIMHQDRIYREMIY..................................
#=GR A0A1L8PPP6_9LACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_BURCJ/82-317                    ................................KPGTAGWYNSAAFEKFATEK..GLYARSINGDAFSDKVKQVTIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PVG..K.A......V.T...F...RGL......DT.........D...K...E...VIR.EVSL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKKVLSIRDK..L.AA.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLLKDSLY..................................
#=GR FABV_BURCJ/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q5VA17_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEVKDQTIELIKKDL..G......QVDLVIYSLA.......S..P..VRT..NP.....V.......T......G..I....THRSVLK....PIG..D.T......F.S...N...KTV......DF.........H...T...G...KVS.EISI........EPS......K.......E.D.DIENTVAVMGGEDWAMWMEAMKKAGVLAPGAMTIAYSYIGPSLT..EPVYRKGTIGRAKDHLEATAFSITDS..L.KD.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGTIEQIQRLYQQRLY..................................
#=GR A0A0Q5VA17_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K6YID4_9ALTE/82-317                  ................................KTATAGWYNTAAFHKQAKAK..GLFAETINGDAFSNEIKAQAIETIKREM..G......QVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..E....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...RIH.DISL........EPA......N.......D.D.EIAQTIKVMGGEDWELWLAALADADLLADGCKTTAYTYIGKVLT..WPIYGQATIGKAKEDLDRAAAAIVSK..N.KA.KHVE...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIKGLFTQRLF..................................
#=GR K6YID4_9ALTE/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H2ILF3_VIBSJ/83-319                  ...............................g-VGSAGWYNNIFFKQEANNA..GRTAINIVGDAFSDTVRTEVIEAIETYF.eG......EVDLVIYSLA.......T..G..IRP..KP.....N.......S......D..E....FWRSVIK....PIG..E.P......V.T...G...ASI......ML.........E...N...D...QWV.ESTL........QPA......T.......E.E.EAEATIKVMGGEDWESWIDALINAESLAEGCQTIAFSYMGPELT..HPIYLDGTLGRAKIDLHQTSHALNLK..L.AN.FGGG...AYATVCKALVTKASVFIPALSPYLLALYRVMKEKGTHERCIEQMQRLFTTKLY..................................
#=GR H2ILF3_VIBSJ/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R1GZT5_9GAMM/81-288                  ..............................gi--GSAGWYNNIWFKQAAEQE..GRLAVNLIGDAFSDAMRQQAIETIRQQW..G......QVDLVIYSLA.......S..G..LRV..MA.....D.......-......G..R....QVRSVLK....STG..Q.P......F.T...G...LGL......NL.........E...R...Y...ALE.EQTL........PVA......S.......A.E.EIRDTVTVMGGEDWQLWLQALQAADCLAPGVQTVAYSYIGPQST..YPLYRDGTIGYAKEHLHSTAEAINLQ..L.AD.IGGH...AWVSVCKALVTKASAYIPVLPVYLG----------------------------l.................................
#=GR R1GZT5_9GAMM/81-288       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1J3R6_9FIRM/106-340             ................................RTATPGWYNTKAFEEIAQAD..GYYAKTINGDAFSEKVKLETIDIIKKDL..G......KIDMVIYSLA.......A..P..RRT..LG.....D.......-......G..T....VYSSTLK....TVE..Q.D......F.T...N...KSL......NL.........K...D...N...SIS.EATI........HPA......S.......E.E.EITATVKVMGGEDWMDWMKALSEADVLEPNAETVAYSYIGPKLT..YPVYYNGTIGIAKKHLYDTSLQINKD..F.SH.KGIH...AYISVNKALVTQASSAIPIVPLYMAILYKVMKDKNLHEGCIEQINRLFREKL-n.................................
#=GR A0A0J1J3R6_9FIRM/106-340  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q5XTI4_9BACL/81-316              ................................RTASAGWYNSAAFEQAAAEQ..GLKSHSIVGDAFSDAIKTTTIDLIKAEY..G......TVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PVG..T.A......Y.T...N...KTM......NF.........H...T...G...EVS.TVTI........EPA......T.......D.E.EVRQTIAVMGGEDWGMWIDQLQAAGVLADGATTVAYSYIGPKIT..HPIYRDGTIGQAKNDLEQTAIALNQK..L.AA.LGGR...AFVSVNKALVTQSSSAIPVVPLYISALYRVMKDKELHENCIQQMYRLFAEHLY..................................
#=GR A0A1Q5XTI4_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E1V6G5_HALED/83-318                  ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEAREKAIELIKQDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......E.Q.EIADTIDVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGRAKEDLDRAAGEIDKR..L.GQ.QGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFGERLY..................................
#=GR E1V6G5_HALED/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5XTH1_9VIBR/82-317              ................................KPGTAGFYNSAAFEKYAHEA..GLYAKSLNGDAFSHEAKQKTIELIQQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSSLK....PIG..N.T......Y.T...S...TAV......DT.........N...R...D...VII.EASV........EPA......T.......E.Q.EIEDTVCVMGGQDWELWINALDDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAATALNSK..L.SA.KNGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A1M5XTH1_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0K2L9F8_9LACO/87-324              ..............................ml--GTAGWYNNIYFRQEAEKA..GLIGKNFIGDAFAQDMKDQVIQYIKDSF.gG......KIDLLVYSVA.......A..P..KRT..NP.....D.......N.....aD..E....TWRSVIK....TVG..K.S......V.T...G...ENI......NL.........E...E...N...KLF.EQTV........EPA......T.......D.D.EVEATKHVMGGEDWEIWVDELKAAGVLADGFKTILYSYIGPKST..YDFYHEGTLGAAKDAAEASSHKIQDK..I.KD.IDGE...ALISVSRAVTTKASVVIPIFPMYCIALYKIEEETGTHETPIMHKDRLFRDMVY..................................
#=GR A0A0K2L9F8_9LACO/87-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q9GG88_9GAMM/82-317              ................................KPGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSHEAKQKVIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VVRSTLK....PMG..D.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......N.......E.Q.EVADTVTVMGGQDWELWINALSEAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAATELNNK..L.SA.TGGA...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLY..................................
#=GR A0A1Q9GG88_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I1L8D1_9PSED/82-317              ................................KAGTAGWYNSAAFEKFAHAK..GLYARSINGDAFSDEVKKVTIETIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSVLK....PVG..K.A......V.N...F...RGL......DT.........D...K...E...VIK.ESVM........EPA......T.......P.E.EIANTVAVMGGEDWQMWMDALQEAGVLADGVKTTAFTYLGEEIT..HDLYWNGSIGAAKKDLDQKVLGIREK..L.AA.TGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVDGLFRDSLY..................................
#=GR A0A1I1L8D1_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4IQR4_9ACTN/86-322              ................................RTATAGWYRTAATAELARAA..GRDLVFLNGDAFSDPMKDQVAELLQQRF.gG......RLDHLVYSVA.......A..P..RRT..DP.....G.......T......G..A....TYASVLK....PIG..G.A......S.R...T...STLv...fdDE.........G...A...A...EVR.EVET........APA......E.......G.D.DIEQTVAVMGGADWARWIDHLAGRGLLAEGFTTAALSYIGSPLT..EAIYRKGTIGAAKVHLEATARALDER..L.GReLGGR...AVTSVNGAAVTQSSTAVPGIALYTGLLRGVLGES--MVPPVHQLAALWD----ql................................
#=GR A0A0F4IQR4_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
B1TB16_9BURK/82-317                  ................................KPGTAGWYNSAAFEKFAAEK..GLYARSINGDAFSDKVKQVTIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PVG..K.S......V.T...F...RGL......DT.........D...K...E...VIR.DVSL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKKVLSIRDK..L.AA.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVYGLLKDSLY..................................
#=GR B1TB16_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A099KIM3_9GAMM/82-317              ................................RTGSAGWYNTAAFQNAADDA..GLYAKNINGDAFSHDIKAKTIETIKADL..G......QVDLVVYSLA.......S..P..RRT..DP.....D.......T......G..E....VYASALK....PIG..N.G......F.T...T...KSL......NT.........S...K...R...VIE.EVAV........EPA......S.......E.E.EIAGTIKVMGGEDWELWMNALKDAGVLSENVKTVAYTYIGKELT..WPLYGKATIGRAKEDLDRAATEIRKV..T.SD.LNGE...AFVTSLNAVVTQASSAIPIMPLYISGLFKVMKADGTQENPIDQIQGLFRDNLY..................................
#=GR A0A099KIM3_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I5IQP7_9RHIZ/83-319              ...............................g-VGSAGWYNLIHFSHMARKE..GLIARNFVGDAFAPDMRAKVADYIRNEF.gG......SVDLVVYSLA.......T..G..ARP..DP.....E.......T......G..E....LVRSTIK....PIG..T.A......T.R...G...YTI......NL.........E...K...D...FLE.EQCL........EPA......T.......D.Q.EIKDTVKVMGGEDWQSWISFLKGEGLLAEGFETLAFSYIGPERT..YDIYHHGTLGRAKADLHQTADRIDAA..L.KA.QKGQ...AHVVVCKALVTKASVFIPGLSPYLLALFRVMKEMGLHEGCIEQMQRLYADTLY..................................
#=GR A0A1I5IQP7_9RHIZ/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1W9JIC2_9PROT/82-317              ................................KPGTPGWYNSAAFHKFAEAE..GLYAKSINGDAFSDEIKQKTIDAIKQDL..G......KVDLVIYSLA.......A..P..RRT..NP.....K.......T......G..F....THNSTLK....PIG..K.D......L.V...Q...NGI......DT.........D...K...E...IIK.EFTL........PAA......T.......E.E.EIANTVAVMGGEDWQMWIDALADADVLAEGAKTTAYTYLGEKIT..WDIYWDGTIGAAKKDLDKRVIDIRSK..L.AA.LGGD...ARVSVLKAVVTQASAAIPVMPLYLALLFKTMKAEGTHEGCIEQVNGLFRDSLY..................................
#=GR A0A1W9JIC2_9PROT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T5C779_9SPHI/82-318              ................................KPGTAGWYNTAAFEKEAHAA..GLYAKSINGDAFSDDIKKQTIELIKKDL..G......QVDLIVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PIA..Q.S......F.T...N...KTV......DF.........H...A...G...VVS.DISI........QPV.....eN.......E.E.DIANTIAVMGGEDWKFWIEDMKAAGVLADGVKTVAYSYIGPELT..YPIYRNGTIGKAKDDLEGTVPVINDL..L.KD.LNGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A1T5C779_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
M4UNK9_9GAMM/82-317                  ................................KTGSAGWYNSAAFEKQAHQD..GLYAKSINGDAFSHAMKDKVIALIKEDL..G......QIDAIIYSVA.......A..P..VRK..MP.....D.......T......G..E....VIRSSLK....PIG..E.V......Y.V...S...TAI......DT.........N...K...D...III.EAQV........EPA......S.......E.E.EIANTVTVMGGEDWELWLSALGDAGVLAAGVKTVAYSYIGTELT..WPIYWDGALGKAKIDLDRASTAIQAQ..L.AP.LQGE...AYVSVQKSVVTQASSAIPVMPLYISMVFKIMKEKGLHEGCMEQIHRLFTTQLY..................................
#=GR M4UNK9_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A066USW7_9VIBR/83-319              ...............................s-LGSAGWYNNIYFKQEAKRE..GRKAINIVGDAFSKETRSQVVEAIETYF.eG......EVDLIIYSLA.......A..G..VRP..KA.....N.......T......D..E....FWRSAIK....PIG..Q.S......V.T...G...NTI......SL.........E...D...D...SWN.TTTL........EPA......T.......E.E.EAESTLKVMGGEDWSQWVDELINSESIAEGCKTIAFSYVGPEVT..HPIYLDGTLGRAKIDLHQASHALNLE..M.AN.FSGG...AYATVCKALVTKASVFIPGLSPYLLALYQVMKEKGTHETCIQQMQRLFSTKLY..................................
#=GR A0A066USW7_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A239NDM9_9ACTN/86-322              ................................RTATAGWYRTAATADIARTA..GRDLVFLNGDAFSDTMKDQVADLVERRF.gG......RLDHLVYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PIG..R.A......H.L...T...KTLv...fdDQ.........G...V...P...EVR.EVET........GPA......E.......P.D.DVEQTVAVMGGADWERWIDHLSDRGVLAEGFSTAALSYIGSPLT..AAIYRQGTIGVAKAHLEATARTLDER..L.GKtVGGR...AVTCVNGAAVTQSSTAIPGIALYTGLLRGVLGQD--MLPPVRQLAALW-----ddl...............................
#=GR A0A239NDM9_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y3YI53_9FIRM/81-313              ................................RTATPGWYNTAAFEEEAAKE..GVYAKSINGDAFSKEVKEQAISIIKEDL..G......KVDMVIYSLA.......A..P..RRT..DA.....Q.......-......G..K....MWVSTLK....TTD..K.P......F.T...E...KSL......DL.........R...T...N...TIV.TKTV........EPA......E.......E.G.ELEGTVKVMGGEDWMDWIDALKAADVLEKDAVTVAYSYIGPELT..YPIYYDGTIGQAKRHLTKTAGEINEK..Y.E-.-DVK...AYISVNKALVTQASAAIPIVPLYFAILYKVMKEQGTHEGCIQQIARLFKDKL-l.................................
#=GR A0A1Y3YI53_9FIRM/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H9E634_9SPIO/91-336              ................................KGGTPGWYNNLAFDRAAKAE..GLFTETFSADAFSHETRKMIIDEAKKAG..K......KFDLIVYSLA.......S..P..VRS..DP.....DkidpnseT......GahV....LYKSVIK....PIG..K.T......Y.A...G...LGI......DI.........L...T...D...TLK.ESAA........EPA......N.......D.E.EIANTVKVMGGEDWQLWIDQLAAAGVLAEGCRTVAYSYIGPELS..HAIYRDGTIGQAKKHLEATAHALNEK..L.SKeLGGA...AYVSVNKGLVTRSSAVIPIISLYLSILFKVMKEKGTHEGCIEQMERLFAERLY..................................
#=GR A0A1H9E634_9SPIO/91-336   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y5G010_9GAMM/82-317              ................................RTGSAGYYNSAAMQAAARAE..GLYAESINGDAFSDEIKAEVIATLKRDM..G......PVDLVVYSLA.......S..P..RRT..DP.....R.......T......G..T....TYTSSLK....PIG..G.A......F.T...M...KGV......NT.........D...T...L...AVD.EVTV........EEA......T.......Q.E.EIDNTIKVMGGEDWEWWIDALSDAGLLAEGCKTTAYTYIGKALT..WPLYGHATIGMAKKDLDRASTAINEK..L.AP.LGGE...SRVSVLKALVTQASSAIPIMPLYISTLYKVMKEEGTHEGCIEQIQGLFDRQIY..................................
#=GR A0A1Y5G010_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2DC21_9DELT/100-341             ................................KIGSPGYHRTLAIERRLRAR..GLAARTVLGDAFDPAVLAAAIQEVREHF.gG......KLHGLVWALA.......A..P..RAT..DP.....R.......T......G..K....PVQSALK....PLG..K.P......A.T...V...RTFsgrgetPE.........D...A...P...KLV.ELEL........PPG......S.......P.E.EAVATQFVMGGRIVEQWVDALLQHDLLAPGFTLATISYRGNPLN..AAVYRNGLIGLAKADLEFYTRAIDAV..L.RGrVGGR...AVAVEGPAVVTEASGGIPGVPYYMALVRDVLGDR--FEDPLASMLRLFRDKL-p.................................
#=GR A0A1I2DC21_9DELT/100-341  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1W1XQ11_9CLOT/81-314              ................................KTGTAGWYNTAAFEKSAIKD..KHYAKTINGDAFSNKIKEKTIELIKKDL..K......KVDLVIYSIA.......S..P..RRK..HP.....I.......T......G..E....VSYSVLK....PIG..E.P......F.K...N...KSV......DF.........H...T...F...EVF.DTEI........GPA......T.......K.D.EIQQTINVMGGEDWSIWIDQLLKADVLEQGACTIAYSYIGPEIT..YPIYRSGTIGVAKEDLENSSLDINLK..L.KQ.IGGN...AYISVNKALVTQSSSAIPVVPLYISLLDKVMKEKGLDEDATKQIHRLFSQ---f.................................
#=GR A0A1W1XQ11_9CLOT/81-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R0C6W3_9GAMM/82-316              ................................KPGTAGWYNTAAFEKYAHQA..GLYARSVNGDAFSDEVKQKVIEIIKADL..G......QVDQVVYSLA.......A..P..RRK..HP.....K.......T......G..E....IISSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VLT.ETTL........QPA......T.......A.E.EIAGTVQVMGGEDWQMWIDALLEAGVLAPGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDNKVLAIRDK..L.QS.LGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKEQGIHEGCIEQLDTLYD----ily...............................
#=GR A0A0R0C6W3_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090INR5_9GAMM/82-317              ................................KPGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...AII.EASV........EPA......T.......E.E.EIQDTVTVMGGEDWELWMSALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.SA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCQEQILRMFSQRLY..................................
#=GR A0A090INR5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F0F824_9PSED/83-321              ................................KAGTAGWYNAAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......QVDLVIYSLA.......S..P..VRK..LPasageR.......A......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...TII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWELWIDALNAAGVLAPQARTVAFSYIGTEIT..WPIYWHGALGKAKQDLDETALRLSKK..V.--.-GGS...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMFRDRMY..................................
#=GR A0A0F0F824_9PSED/83-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A023Y4U1_9GAMM/82-316              ................................KPGTAGWYNTAAFHKYAEQA..GLYAKSVNGDAFSDEVKAKVIELIKQDL..G......QVDQVVYSLA.......A..P..RRK..HP.....K.......T......G..E....IISSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VIT.QTTI........EPA......T.......P.E.EVAGTVAVMGGEDWQMWIDALLEAGVLADGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDNKVLGLREK..L.QA.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKAKGTHEGCIEQLDTLYD----ivy...............................
#=GR A0A023Y4U1_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I0GG31_9BACL/81-316              ................................RTASAGWYNSAALERAAEEQ..GLKSHSIVGDAFSDEIKSKTIELIKAEY..G......QVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PVG..E.A......Y.S...N...KTV......NF.........H...T...G...EVT.QTTI........EPA......T.......D.D.EVRQTIAVMGGEDWGMWIDQLSAAGVLADGAITVAYSYIGPEVT..HPIYKEGTIGQAKIDLEKTAIALNEK..L.QA.SGGH...AYVSVNKALVTQSSSAIPVVPLYISALYRVMKDKDLHENTIEQMYRLFSEHLY..................................
#=GR A0A1I0GG31_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H8CQS1_9FIRM/81-313              ................................RTASAGWYNTAAFEEFAQQD..GIYAKTINGDAFSQEIKDKTIALIKKDL..G......KVDLIVYSLA.......S..P..RRT..DT.....D.......-......G..T....VYSSVLK....TTG..A.P......Y.T...N...KTI......DL.........R...T...N...MIS.EITI........PSA......T.......E.E.EIAATVKVMGGEDWKDWITALKAADVIEDGAMTVAYSYIGPALT..HPMYLNGSIGMAKKHLYKTADGINSQ..I.--.AGVK...AYVSVNKALVTQSSSAIPVVPLYISILYKVMKAKGTHEGCIEQMYRLLHERLY..................................
#=GR A0A1H8CQS1_9FIRM/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S2GC74_9GAMM/82-318              ................................KPGTAGWYNSAAFDKFAKAQ..GLYSKSINGDAFSDEARAQVIDLIKNEM.gG......QVDLIVYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....TIG..E.P......Y.T...S...TAI......DT.........N...K...D...TVI.QATV........EPA......T.......E.Q.EIEDTVTVMGGQDWELWIDALERADALAPGACTVAFSYIGTEIT..WPIYWHGALGKAKVDLDQTAQRLNTR..L.SK.IGGG...ANVAVLKSVVTQASSAIPVLPLYIALVFKIMKEKGLHEGPIEQLNRMFRDRMY..................................
#=GR A0A0S2GC74_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A126T7E9_9GAMM/82-317              ................................KPGTPGWYNSAAFHKFAEAE..GLYAKSINGDAFSDEIKQKTIDAIKQDL..G......KVDLVIYSLA.......A..P..RRT..NP.....K.......T......G..I....THNSTLK....PIG..K.D......L.V...Q...NGI......DT.........D...K...E...VIK.SFTL........PAA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALAEAGVLAEGAKTTAYTYLGEKIT..WDIYWDGTIGAAKKDLDKRVIDIRSK..L.VA.LGGD...ARVSVLKAVVTQASAAIPVMPLYLALLFKTMKAEGTHEGCIEQVNGLFRDSLY..................................
#=GR A0A126T7E9_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R1RMF2_9LACO/87-324              ..............................ml--GTAGWWNNIYFKQEAEKA..GLIAKNFNGDCFTEKMKEQVSEYIKDEF.gG......KIDLLVYSVA.......A..P..KRA..NP.....E......nT......D..E....VWRSQMK....PIG..K.D......V.T...G...YNV......NL.........E...Q...D...ALV.EQTI........EAA......T.......P.E.EVADTVHVMGGEDWELWVKFLKDQGLLADGFKTILYSYIGSPVT..YDFYHEGTLGKAKDAAEESSHRIGKI..I.ED.INGE...SLISVSKAVTTKASSVIPIFPVYCIALYKVMQEKGTHETPIMHKDRLFRDMVY..................................
#=GR A0A0R1RMF2_9LACO/87-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I7I8Y3_9GAMM/88-323              ................................KPGTAGWYNSAAFDKFAKAE..GRYSKSINGDAFSHAARDKAIELIQQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSALK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......E.Q.EIEDTKAVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDKR..L.SS.SGGS...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEKGLHEGTIDQLNRLFGECLY..................................
#=GR A0A1I7I8Y3_9GAMM/88-323   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A269VWJ0_9BACL/81-316              ................................RTASAGWYNSAAFEKAAAEA..GLKSFSVTGDAFSAETKAKTIELIRQEL..G......QVDLVVYSVA.......S..A..RRT..LP.....E.......T......G..E....TVNSVLK....PIG..E.P......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVKHTVDVMGGEDWDLWMEALSEAGALADQAVTIAFSYIGSEIT..RAIYRDGSIGQAKDHLEDTALKLSDK..L.SP.IGGR...AYVAVSKALVTQSSSAIPVVPLYVSALYKVMKEKGIHEGTIEQIHRLFADKLY..................................
#=GR A0A269VWJ0_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2C6MSU9_9VIBR/83-319              ...............................g-VGSAGWYNNIYFKEEAIHH..GRTAINIVGDAFSDSVRNQVIEAIETYF.eG......EVDLVIYSLA.......T..G..VRP..KP.....N.......S......D..T....FWRSVIK....PIG..E.S......I.S...G...ASI......IL.........E...N...D...QWV.ESTL........EPA......T.......E.E.EAEATVKVMGGDDWESWIDTLINSESIAQGCKTIAFSYMGPEVT..HPIYLDGTLGRAKVDLHQTSHALNLK..L.AN.FDGG...AYATVCKALVTKASVFIPALSPYLLALYRVMKKKGTHEGCIEQMQRLFSTKLY..................................
#=GR A0A2C6MSU9_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A125JSE7_9BURK/82-317              ................................KPGTAGWYNSAAFEKFAAAK..GLYARSINGDAFSDAVKQVTIDTIKRDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PIG..K.S......V.S...F...RGL......DT.........D...K...E...VIR.ETVL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALHDAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDKKVLAIRDT..L.SP.TGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVYGLLKDSLY..................................
#=GR A0A125JSE7_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I0QLF0_9GAMM/81-316                  ...............................g-VGTAGWYNNIHFKQAAERK..GLIAKNFIGDAFSDSMREQVIDFVRAEF.gG......KIDMIVYSLA.......A..G..VRT..AP.....D.......-......G..V....KYCSTLG....VKG..D.E......F.S...G...QSF......NL.........E...T...Q...SLC.TQTL........SPV......S.......D.Q.QLQDTVKVMGGEDWKLWIDTLTQADVLAEGFKTVAYSYIGPEST..YPLYKDGSLGAAKEHLHATADQLNTQ..L.TK.INGE...AYVAVCKALVTKASAYIPVFPLYITLLYQVMKEKRLHETCIEQMHRLMFTRLY..................................
#=GR I0QLF0_9GAMM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D2Q3D1_KRIFD/83-313                  ................................RTATAGWYRTAATAAYAERA..GRSFHCVNADAFADTTKADVLDLVEREF..G......GVDYLVYSVA.......A..P..RRV..DP.....R.......T......G..T....TYQSALK....AIG..E.P......A.R...T...KSLg....yDD.........G...R...P...VLQ.EVGI........EVA......T.......D.E.EIAETVQVMGGEDWERWIDALTDRKLVNDGFATVALTYIGSELT..GPIYRQGSIGAAKAHLEQTARDLTAR..-.--.-GVR...AYTSVNGAAVTQASSAIPGIGLYVSLLHKVLGEA--MQTPIQQSVALWDQ---lt................................
#=GR D2Q3D1_KRIFD/83-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A7MYD8_VIBCB/82-317                  ................................KPGTAGFYNAAAFEKLAREE..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QVDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LIRSALK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALSDAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRASAALNEK..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIFRMFSQRLY..................................
#=GR A7MYD8_VIBCB/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R2A6V4_9LACO/87-324              ..............................ml--GTAGWWNNIYFKQEAEKA..GLIAKNFNGDCFTKDMKQQVTDYIKSEF.gG......KIDLLVYSVA.......A..P..KRT..NP.....E.......N.....pN..E....VWRSQIK....PVG..K.T......V.T...G...YNV......NL.........E...K...N...ELF.EQSI........EGA......T.......Q.D.EIDATIHVMGGEDWELWVQFLKDAGVLADGFKTILYSYIGSPVT..YEFYHEGTLGKAKDAAEASSHKIQKM..I.DD.IHGK...SLISVSKAVTTKASVVIPIFPVYCIALYKVMLEKGTHETPIMHKDRLFRDMVY..................................
#=GR A0A0R2A6V4_9LACO/87-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E8CM61_9GAMM/82-318              ................................KPGTAGWYNSWAFEEEAKQA..GRYAKSINGDAFSNEVREQAVALIKEDL..G......EVDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSVLK....PIG..E.V......Y.Q...S...TAI......DT.........N...K...D...QII.HAEV........EPA......T.......E.Q.EIADTITVMGGEDWELWMQALDDAGVLAKGVKTVAFSYIGTEMT..WPIYWHGALGKAKEDLDRAAAQLDAS..L.GKkYGGS...ANVAVLKSVVTQASAAIPVMPLYIALVYKVMKEKGLHEGTIEQLNRLFREQLY..................................
#=GR A0A1E8CM61_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q3H4D9_9BACT/81-316              ................................KTASAGWYNTAAFEQQAHAA..GLYAKSINGDAFSHEIKQQTVDLIKADL..G......QVDLVIYSLA.......S..P..VRL..HP.....D.......T......G..I....KHRSVLK....PVE..N.S......F.Q...D...KTV......DF.........H...T...G...VVS.NISI........EPC......S.......E.E.DIENTIAVMGGEDWSMWIDVLQKENLLATGAKTIAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFTIAEK..L.KA.IEGQ...AYVSVNKALVTQASAAIPVIPLYISLLYKVMKELQIHEGCIEQIHRLFNDRLY..................................
#=GR A0A1Q3H4D9_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1D9PDU5_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKRETLDLIKADL..G......QVDLIIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..A.T......F.S...N...KTV......DF.........H...T...G...KVS.EVSI........EPC......S.......G.D.DIENTIAVMGGEDWAMWIDALKAENLLAPGAATVAYSYIGPSVT..EAVYRKGTIGRAKDHLEATAFTISDS..L.AD.INGR...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGVHEGCIEQIQRLYQQRLF..................................
#=GR A0A1D9PDU5_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A160N0S2_9GAMM/82-318              ................................KTGTAGWYNSAAFDQAAKAA..GLYSKSINGDAFSNETRERAIELIKAEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSALK....TIG..E.P......F.S...A...TSV......DT.........N...R...D...TVI.TATV........EPA......T.......E.Q.EIADTVAVMGGEDWALWIEALNQAGVLAKDATTIAYSYVGTSIT..WPIYWHGTLGRAKQHLDNTANAMRER..Y.AA.NGLK...AYVGVMKSVVTQASAAIPVIPLYVSMVFKIMKAKGIHEGTIEQANRLFRDFLY..................................
#=GR A0A160N0S2_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_PSEF5/82-317                    ................................KLGTAGWYNTAAFHKFAEEK..GLYAKSINGDAFSDAVKAETIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VLSSTLK....PLG..K.S......V.T...L...RGV......DT.........D...K...E...IVK.ETTL........QPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALHEAGVLAEGAKTTAFTYLGEKLT..HDIYWNGSIGEAKKDLDQKVIGMRQQ..L.AG.LGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGSHEGCIEQVYGLYKDSLY..................................
#=GR FABV_PSEF5/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W1FXH8_ECOLX/59-294                  ................................KPGSAGWYNSAAFDEAAKRE..GLYAKSINGDAFSDECRDEVIKLIKEDL..G......QIDLVVYSLA.......S..P..VRK..MP.....K.......T......G..E....IVRSALK....PIG..E.V......Y.T...S...KAI......DT.........N...K...D...QII.TASI........EPA......T.......E.E.EVQNTVTVMGGEDWELWMGALSEAGVLADGVKTVAYSYIGTDLT..WPIYWHGALGKAKEDLDRAAGELRNQ..L.AP.LHGS...ANVAVLKSVITQASSAIPVMPLYISMVFKLMKAQGIHEGCIEQINRLMTTSLY..................................
#=GR W1FXH8_ECOLX/59-294       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A2MH44_9FLAO/81-316              ................................KTASPGWYNSAAFEVEAHKA..GLYAKSINGDAFSNEVKQQTIDMIKADL..G......QVDLVIYSLA.......S..P..VRL..HP.....T.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...T...G...NVS.QVSI........EPA......T.......E.E.DIANTVVVMGGEDWTMWMDALKGAGVLAEGATTVAYSYIGPEVT..EAVYRKGTIGRAKDHLEATAFEITDK..L.KD.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLFQQRLY..................................
#=GR A0A0A2MH44_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F3LGH2_9GAMM/87-322                  ................................KTGSAGYYNSAAFEAAAHEA..GLYAKSFNGDAFSTACKEQVIEQIKADM..G......KIDLVVYSLA.......S..P..RRQ..DP.....V.......T......G..E....VYSSTLK....PIG..E.S......Y.T...A...KNL......NT.........D...S...K...VVG.EVTV........QPA......S.......E.E.EIATTVKVMGGEDWQLWIDALAEADVLNSGAKTVAYTYLGEKLT..WPIYGHATIGKAKEDLDRAAGELRNQ..L.TG.INGA...AHVSVLKAVVTQASSAIPVMPLYLAILFKVMQEEGSHEGCIEQLQRLFTECLY..................................
#=GR F3LGH2_9GAMM/87-322       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H8ZCU8_9RHIZ/82-315              ................................KTGSAGWYNNRAFEKRAEAA..GRIAVTVEGDAFSDAIKADTIAQIREHL..G......QVDLIVYSLA.......S..P..VRT..DP.....K.......T......G..E....VYRSAIK....PMN..N.A......V.T...S...KTL......NT.........G...T...G...EVS.EVEI........QPA......T.......D.E.EAAATVKVMGGEDWELWIAALSEAGVLADGFVTLNYTYLGSELT..WPIYHKGTLGRAKGDLDRAAAAIRKQ..H.GA.--DS...AYVVALKAVVTQASSAIPVVPLYGTMLIKVMDEMGLGEGTIEQIDRLFRVKL-q.................................
#=GR A0A1H8ZCU8_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R3MIX5_9BRAD/82-314              ................................RTGSAGWYNNRAFEIEAERI..GRSPLTLEGDAFSDELKKTFIERVREKF..G......QLDMLVYSMA.......A..P..VRT..DP.....V.......T......G..K....TWRSAIK....PLG..A.P......V.E...I...KTL......NT.........E...T...G...EVY.ETTI........APA......S.......E.D.EATATVAVMGGDDWKRWIDQLADAGVLAPGFRTLNYTYIGSELT..WPIYWNGTLGRAKVDLDRKAEAIRGR..L.GQ.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR A0A0R3MIX5_9BRAD/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G8LSH4_CLOCD/81-316                  ................................RTATAGWYNMAAFEEEAKKA..GLYSKSINGDAFSDEIKEKTIELIKKDW..G......KVDLIIYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSVIK....PIG..K.P......Y.T...N...KTV......NF.........H...N...G...EVS.EITV........DPA......T.......E.D.EIRQTVAVMGGEDWEMWIEALKTAGVLADGVITVAFSYIGPELT..HAVYKNGTIGKAKEHLEASAKNITNF..L.KD.INGK...AYISVNKALVTQSSSAIPVVPLYISLLFKIMKEKGIHEGCIEQLYRLFAERLY..................................
#=GR G8LSH4_CLOCD/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0U2PE98_9ALTE/82-317              ................................KTATAGWYNTAAFHQQAEAA..GLYAKTINGDAFSNEIKAEVIEAIKADM..G......KVDLVVYSLA.......S..P..RRT..DP.....N.......T......G..E....TFKSVLK....PVG..Q.G......Y.K...T...KTY......DT.........D...K...D...LVH.EIEL........EPA......T.......Q.E.EIDHTIKVMGGEDWEMWLDALDAADLLAEGCRTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAAAAINSS..K.AD.KQIK...AYVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIQGLFAEKLF..................................
#=GR A0A0U2PE98_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8PJ22_9VIBR/86-183              ...............................g-VGTAGWYNNIYFKELAEQQ..GRIATNIVGDAFSPEIRAKVLQAIKEQF.dG......KVDLIIYSLA.......T..G..VRP..KP.....N.......-......G..D....LWRSAIK....PIG..E.S......L.K...G...ASI......EF.........E...T...D...TCR.----........---......-.......-.-.--------------------------------------------..--------------------------..-.--.----...-----------------------------------------------------th................................
A0A1V3I4S4_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKQE..GLYSKSLNGDAFSHEAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...EII.EASV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALNDAGVLAEGCKTVAYSYIGTELT..WPIYWEGALGKAKMDLDRAAKALNNT..L.SA.KGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRQEGVHEGCMEQIHRMFTQRLY..................................
#=GR A0A1V3I4S4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J8V7Z8_PSEPU/35-272                  ................................KAGTAGWYNAAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLVIYSLA.......S..P..VRK..LP.....Q.......T......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...TII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALAGANVLAEGARTVAFSYIGSDIT..WPIYWHGALGQAKQDLDETALRLDKK..L.ADeVKGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMYRDRMY..................................
#=GR J8V7Z8_PSEPU/35-272       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5LP52_9SPIR/82-319                  ................................RTATPGWYNNEAFSEFAKKD..GIEEKTLILDAFLNASKEEVIKEAKSFF.dG......KIDLFIYSLA.......A..P..VRM..DE.....K.......T......G..I....LYRSTLK....PIG..K.T......Y.N...G...MGI......DF.........M...T...E...ELL.NVSI........EPA......N.......E.E.DIKNTIKVMGGEDWQLWTDALINADMLSKNAINIAYSYIGPEMT..KAVYRDGTIGKAKDDLEKTAHDLDKK..M.QEkIKGH...AYVSVNKAVVTRASAVIPTVPLYIGILFRIMKKRGLHEGCIEQMYRLLSEKLF..................................
#=GR R5LP52_9SPIR/82-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A143HND5_9GAMM/82-314              ................................RTASAGYYNAAAFEQEAHKA..GLYAKSINGDAFSDEVKAQAIEMIKADM..G......QVDLVIYSLA.......S..P..RRK..DP.....K.......T......G..E....LYSSVLK....PIG..K.P......Y.T...A...KNL......NT.........D...K...L...EIS.DITL........EPA......S.......E.E.ETEATVKVMGGEDWELWMNALSEAGVLADGCKTVAYTYIGEKLT..WPIYGHATIGKAKEDLDRAAGAITAS..G.--.-VAD...AHVAVLKALVTQSSSAIPVMPLYISLVYKVMKEEGTHEGCIEQLYRLYTEGLY..................................
#=GR A0A143HND5_9GAMM/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A267TG48_9BACT/81-316              ................................KLATPGWYNTAAFEKHAQEA..GLYAKSINGDAFSNEVKEKTLALIKEDL..G......QVDLVVYSLA.......S..P..VRT..DP.....T.......T......G..I....THRSVLK....PIG..A.P......F.K...N...KTV......DF.........H...S...G...KVT.EISI........DPC......T.......E.E.DIQNTIKVMGGEDWEMWIDSLKAANLLAPNALTIAYSYIGPELT..EPVYRKGTIGRAKDHLEATAFTIADK..L.SD.IGGN...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGIHEGCIEQIQRLYSERLY..................................
#=GR A0A267TG48_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6MWP5_9GAMM/219-453             ................................KPGTAGWYNSAAFDKLAKQA..GLYSRSINGDAFSNETRARAIEMIKQDM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..E.T......F.T...A...SSV......DT.........N...R...D...MVV.QATV........EPA......T.......E.Q.EIKDTVIVMGGEDWALWIDALSKAGVLAEHAKTVAYSYVGTEIT..WPIYWHGTLGQAKQHLDNTATQLRVR..H.--.PGLE...AYVGVMKSVVTQASAAIPVIPLYVSMVFRIMKEKGVHEGTIEQINRLFHSALY..................................
#=GR A0A1I6MWP5_9GAMM/219-453  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F2TE62_STRR3/86-322              ................................RTGTAGWYRTAATADLARAA..GRDLVFLNGDAFSDAMKDEVADLIEQRF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..V....TYSSVLK....PIG..A.A......N.R...T...RTLv...fdDQ.........G...A...P...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAGRGLLNEGFATAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLDDR..L.DKtVGGR...AVTSVNGAAVTQSSTAIPGIALYLGLLRAVLGDR--LVPPVHQLASLW-----dql...............................
#=GR A0A0F2TE62_STRR3/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I1VGT8_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEIKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...KVS.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWIDALKNENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTIGDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A1I1VGT8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085ZJ24_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GIYAKSINGDAFSNEIKRETLDLIKADL..G......QIDLVIYSLA.......S..P..VRV..NP.....T.......T......G..V....THRSVLK....PIG..Q.T......Y.T...N...KTV......DF.........H...T...G...KVS.EVSI........APA......D.......G.D.DIENTVAVMGGEDWAMWIDALKSENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGVHEGCIEQIQRLFNDRLY..................................
#=GR A0A085ZJ24_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1D8YE49_9GAMM/82-316              ................................KPGTAGWYNTAAFHKYAEQA..GLYAKSVNGDAFSDEVKAKVIELIKQDL..G......QVDQVVYSLA.......A..P..RRK..HP.....G.......T......G..E....VISSTLK....PIG..A.P......I.T...L...RGL......DT.........D...K...E...VIT.ETTI........EPA......T.......P.E.EIAGTVAVMGGEDWQMWIDALLEAGVLAEGATTTAFTYVGEEIT..QAIYWNGSIGAAKKDLDEKVVGLRQK..L.AP.IGGD...ARVSVLKAVVTQASSAIPTMPLYLSLLFKVMKAKGTHEGCIEQLDTLYD----ily...............................
#=GR A0A1D8YE49_9GAMM/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I0T9E4_9SPHI/81-316              ................................KTASPGWYNTAAFEKEAHAA..GLYAKSINGDAFSKEIKDKTIELIKADL..G......QVDLVIYSLA.......S..P..VRK..HP.....D.......T......E..V....LHRSTLK....PIG..G.T......Y.T...N...KTV......DF.........H...T...G...KVS.EISI........EPA......T.......E.E.DIANTVAVMGGEDWAMWIDALKAENLLAEGATTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATAFKIADK..L.KD.IEGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKAEGVHEGTIEQIQRLYANRLY..................................
#=GR A0A1I0T9E4_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K0C4G8_CYCSP/86-321                  ................................KPGSAGWYNTAAFDAEAKKA..GLYAKHINGDAFSNEAKQKTIELIKEDL..G......EIDLVVYSLA.......S..P..VRK..VP.....G.......T......D..Q....LTRSCLK....PIG..E.T......Y.R...S...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......E.Q.EIKDTVTVMGGEDWELWMDALSQAGVLAKGCQSVAYSYIGTAIT..WPIYWDGALGKAKMDLDRAAKAIDAK..L.KQ.LNGS...AHVAVLKSVVTQASSAIPVMPLYISMVFKVMKEAGIHEGCIEQINRLFRTQLF..................................
#=GR K0C4G8_CYCSP/86-321       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C2F4M2_9PSED/82-313              ................................RTASAGWYNSAAFQCAADNA..GLYAKSINGDAFSDAVKEKTIEMIKADL..G......QIDLLVYSLA.......S..P..RRL..HP.....V.......T......G..T....LHSSVLK....PIG..K.T......V.T...Q...IGL......DT.........D...R...E...LIK.SFTL........QPA......V.......Q.Q.EIDDTVVVMGADDWERWVHQLSEAGVLAPGCKTTVYTYIGEKVT..RDIYWDGTIGAAKKDLDRAAAMLSS-..-.--.NGVE...ASVSVLKAVVTQSSAAIPVMPLYLALLFKLMKQDGSHEGCIEQIYRLFSECLY..................................
#=GR A0A0C2F4M2_9PSED/82-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7RUU7_9GAMM/82-317                  ................................KTGTAGWYNTAAFHNFAKTD..GLYCHTINGDAFSDEIKAQTIAQIKEDL..G......QIDLVIYSLA.......S..P..KRK..DP.....E.......T......G..E....VYSSTLK....PVG..G.S......Y.T...T...KTY......DT.........D...K...D...SVH.EISL........DPA......N.......D.D.EIAQTIKVMGGQDWERWIDQLHAAGVLAQDCQTTAYTYIGKKLT..WPIYGHATIGRAKEDLDRAAANLRSS..Y.SD.VNLS...AWVSSLKALVTQASSAIPVMPLYISLIYGVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR F7RUU7_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_BURPS/82-317                    ................................KPGTAGWYNSAAFHDEAAAR..GLQATSVNGDAFSDEIKHKTIDAIRRDL..G......QVDLVVYSVA.......A..P..RRA..HP.....K.......T......G..V....THQSTLK....PIG..H.A......V.R...L...RGI......DT.........D...N...E...AIK.ETLL........QPA......T.......P.D.EIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVT..HDIYWNGSIGEAKKDLDRTVLALRDK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGTHEGCIEQVDGLLRDSLY..................................
#=GR FABV_BURPS/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G2NR66_STREK/86-322                  ................................RTATAGWYRTAATARIARDA..GRDLVFLNGDAFSDAMKDQVADLVERRF.gG......RLDHLIYSVA.......A..P..RRT..DP.....D.......T......G..T....TYASVLK....PVG..R.A......N.R...T...KTLl...fdDQ.........G...V...A...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIGRLAGRNLLGEGFTTAALSYIGSPLT..AAIYRQGTIGAAKAHLEATARTLDER..L.GRtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLAEG--MVPPVRQLAALWD----ql................................
#=GR G2NR66_STREK/86-322       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5W6E0_9CLOT/81-315                  ................................RTASAGWYNTKAFEKLAKED..GYYAKSFNGDGFSAEMKQQVIEAIKEDW..G......KVDMVVYSLA.......A..P..RRT..MP.....D.......-......G..T....TVSSVLK....TVG..K.E......F.T...N...KTI......DL.........R...N...N...EVK.EVTV........PVA......T.......E.E.EIENTVKVMGGEDWELWIRALAEADVLAENAVTLAYSYIGPTVT..HAIYKDGSIGQAKKHLYETSKKLQEE..F.AD.KGLQ...AYISVNKALVTQSSAAIPIVPLYISLVYKIMKEKGLHEGCIEQMQRLFVDKL-p.................................
#=GR R5W6E0_9CLOT/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5ZVY1_9VIBR/84-320              ...............................q-CGNAGYYNNLYFRQYAEKS..GYEAINIQGDVFSQTTKDEVVEAIETYF.dG......EVDLIIYSIA.......S..G..KRK..QP.....D.......S......D..E....YWRAVLK....PTT..Q.A......V.T...C...PAI......DF.........A...T...D...ECH.ETRI........DPA......T.......E.A.EISATLKVMGGEVWESWVDTLINSESIAPGCQTIAFSYVGSPLT..YPVYLNGTLGLAKVDLHQTSHALNLK..L.AN.FDGG...AYAVVCKALMTRASVCIPGLLPYLMMLSKVLDQRGTNEDCNAQMQRLFTDKLY..................................
#=GR A0A1M5ZVY1_9VIBR/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I9B288_9FIRM/81-316                  ...............................n-TATAGWYNTAAFETAATEA..GYYAKSINGDAFSDQVKEKTIALIKEEL..G......QVDLVVYSIA.......A..P..RRT..HP.....V.......S......G..E....MFTSVIK....PIG..D.S......F.T...S...KTV......DM.........N...S...N...EIV.DVTL........EPA......S.......E.Q.EIRSTVAVMGGEDWERWMHHLKEAGVLASGATTISYSYIGPKIT..YPIYKEGTIGRAKDHLYAASKEINKQ..I.QD.INGR...AFVAVNKALVTQASAAIPVVPLYLMLLARVLGKKGLDENCIEQMYRLLASRLY..................................
#=GR I9B288_9FIRM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q7I8U0_9RHIZ/82-315              ................................KPASAGWYNNRAFENRARAA..GRKAVTIEGDAFSDAVKAEAIEAIKANL..G......QVDLIVYSVA.......S..P..VRT..DP.....S.......D......G..V....TYRSAIK....PYG..A.A......V.T...S...KTL......NT.........G...T...G...EVS.TISV........EPA......T.......E.E.EAAATVKVMGGEDWELWIKALSEAGVLADGFRSLNYTYLGSELT..WPIYHHGTLGRAKADLDRAAAAIRRQ..H.G-.-EQA...ANVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIQQIDRLFREKL-q.................................
#=GR A0A0Q7I8U0_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R1WAF1_9LACO/88-325              ..............................ml--GTAGWWNNIYFKQEAEKA..GLLAKNFNGDAFTEDMKKQVIDYIKGEF.gG......QIDLLVYSVA.......A..P..KRS..NP.....N.......N.....pD..E....VWRSQLK....PIG..K.E......V.T...G...YNI......NL.........Q...E...N...SLF.EQTI........EGA......T.......Q.E.EVDATVHVMGGEDWEIWVQELKDAGVLAEGFKTILYSYIGSPVT..YDFYHEGTLGKAKDAAEESSHKIQKM..I.DD.IDGK...SLISVSKAVTTKASVVIPIFPVYCIALYKVMQEKGTHETPIMHKDRLFRDMVY..................................
#=GR A0A0R1WAF1_9LACO/88-325   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q1ZX93_PHOAS/83-320                  ..............................gi--GSAGWYNNIFFKQAAEQQ..GYIARNIVGDAFSDEVRQHVAQTIRDEF.gG......HIDLVIYSLA.......T..G..IRP..DP.....E.......T......G..E....VWRSCLK....TVG..E.N......F.S...G...YSV......DL.........E...N...D...ALD.PAEL........SAA......N.......D.E.EIFATTKVMGGEDWQQWINFLLSENLLAPKAKTLAYSYIGPEST..YPIYHHGTLGIAKKHLHQTAIAINQQ..L.AQmINGQ...ANVVVCKALVTKASVFIPTFSPYILALFKVMKQMGNHEGCIEQMHRLFAQKIY..................................
#=GR Q1ZX93_PHOAS/83-320       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1L3JI91_9FLAO/81-316              ................................RPGSPGFYNTAAFEQEANKA..GLYAKSINGDAFSNEVKEQVVNLIKEDL..G......QIDLVIYSLA.......S..P..VRT..HP.....T.......S......G..K....RFKSVLK....PIG..E.V......F.T...N...KTV......DF.........H...T...G...KVS.EISI........NPA......E.......G.E.DVENTITVMGGEDWKMWMDALQAENLLAEGIKTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTITDD..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLFKVMKEKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A1L3JI91_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P7GXZ8_9XANT/82-318              ................................KAGTAGWYNAAAFDKYAKQA..GLYSRSINGDAFSDEARAQAIELIKNEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......T......G..E....VVRSALK....PIG..E.A......Y.T...S...TAI......DT.........N...K...D...QII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALREAGVLADGAKTVAFSYIGTEIT..WPIYWHGALGKAKADLDATARRLDAQ..L.AK.TGGS...ANVAVLKSVVTQASAAIPVLPLYIAIAFKVMKQAGLHEGTLDQLDRLFRERLY..................................
#=GR A0A0P7GXZ8_9XANT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R4B1Z3_9VIBR/82-317              ................................KPGTAGYYNSAAFDKFAKEE..GLYSKSLNGDAFSNEAKQKAIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......S......G..E....VVRSCLK....PIG..E.T......Y.T...S...TAV......DT.........N...R...D...VII.EASV........EPA......T.......E.Q.EIADTVTVMGGEDWELWINALDEAGVLADGCKTVAYSYIGTELT..WPIYWHGALGRAKMDLDRAAAELNDK..L.SA.KNGT...ANVAVLKSVITQASSAIPVMPLYIAMVFKKMREEGVHEGCMDQILRMFNERLF..................................
#=GR A0A1R4B1Z3_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E5DZ61_9VIBR/83-319              ...............................g-VGTAGWYNNVFFKQEAEKE..GRIAVNIIGDAFAQETRDQVIEAIETYF.eG......EVDLIIYSLA.......T..G..IRP..NP.....N.......T......G..E....NWVSSIK....PIG..N.S......V.T...G...ATV......LL.........D...N...D...LWV.ETTV........EAA......T.......D.D.EIESTIKVMGGSDWESWVDTLINSESIAQGCQTIAFSYIGSEAN..YPIYRDGTLGWAKVDLHQASHSLNLK..L.AN.FNGS...AYATVCKALVTKASVYIPAFTPYIIALYQAMKEEGNHEGCIEQMQRLFSSK--fn................................
#=GR A0A1E5DZ61_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A9MY60_9BURK/82-317              ................................KAGTAGWYNTAAFEKFATEK..GLYATSINGDAFSDEVKARTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......S......G..V....VFSSTLK....PVG..Q.S......V.N...L...RGI......DT.........D...K...E...IIK.ETVL........EPA......T.......Q.E.EIDHTVAVMGGEDWQMWIDALLEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVAVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A1A9MY60_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E3GA56_9GAMM/81-317              ................................RTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNDIKEQTIELIKKDW.qG......DVDLVVYSLA.......S..P..RRI..DP.....V.......T......G..E....DYRSVLK....TVG..Q.P......F.T...D...KTV......DV.........L...A...G...TVG.EVTI........DPA......N.......A.D.EIANTEKVMGGEDWQLWMDALLEAGVLAKGVKTVAYSYVGPELT..FPIYREGTIGLAKKHLEATVTNLNEK..L.TG.LSGS...AYISVNKCLVTQAAAAIPVVPLYASLLYKVMKDKNLHEGCIEQIVRLFSERLY..................................
#=GR A0A1E3GA56_9GAMM/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F4IZR1_9ACTN/83-319              ................................RTAGAGWYRTAATAELVAEE..GHDFRFVNTDAFSDDARSRVADLLEEHY..G......PVDHLVYSLA.......A..P..RRT..DP.....G.......T......G..E....VHHSVIK....PLG..A.A......Y.E...A...PAL......DF.........S...A...At.pAVT.WTRL........EPG......T.......D.A.EARATVAVMGGDDWALWVRALASRGLLADGFTTAALTYVGSEVT..APVYRHGTIGAAKEHLERTARDLDGSalL.KE.KDGR...AFTVVAGAAVTQASTAIPSIALYTSFLRTVLGDGGFR-TTAEQAVDLWD----ql................................
#=GR A0A0F4IZR1_9ACTN/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q4X2A4_9ACTN/86-322              ................................RTATAGWYRTAATAGIARAA..GRDLVLLNGDAFSDAMKDQVADLLEQRF.gG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..T....VHASVLK....PIG..R.A......N.R...T...RTLv...fdDD.........G...A...P...EVR.EVET........GPA......E.......G.D.DVEQTVAVMGGADWERWIDHLAARGLLADGFATAALSYIGSSLT..AAIYRQGTIGAAKAHLEATARSLDER..L.RRtVGGR...AVTSVNGAAVTQSSTAIPGIALYTGLLRGVLGDG--LVPPIRQLAALW-----dql...............................
#=GR A0A1Q4X2A4_9ACTN/86-322   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8T686_9SPHI/82-318              ................................KPGTAGWYNSAAFEQEANQA..GLYAKSINGDAFSDEVKKQAIELIKQDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHSSVLK....PIN..Q.P......F.T...N...KTV......DF.........H...A...G...VIS.DISI........QPV......E......sD.D.DIENTIAVMGGEDWKFWIEELKAANVLADGLKTVAYSYIGPELT..YPIYRNGTIGKAKDDLEATVPVLNDL..L.AD.LNGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQIQRLFAERLY..................................
#=GR A0A0B8T686_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5LDE5_9RHIZ/82-315              ................................KPASAGWYNNRAFENRARAA..GAKAVTIEGDAFSDAVKAETIEAIKSTL..G......QVDLIVYSLA.......S..P..VRT..DP.....K.......D......G..V....TYRSAIK....PYG..S.A......V.T...S...KTL......NT.........G...T...G...EVS.EISV........EPA......S.......E.E.EAQATVKVMGGEDWELWIKALSEAGVLADDFTTLNYTYLGSELT..WPIYHKGTLGKAKGDLDRAAAAIRAA..H.--.GDNS...AHVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLSEGPIQQIDRLFRDKL-q.................................
#=GR A0A0F5LDE5_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B0HPM4_9BACL/1-50                ...............................m--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...-...---.----........---......-.......-.-.--------------------------------------------..--------------------------..-.--.----...----VSKGLVTQSSSAIPIVPLYISSLYKIMKEKGIHEGCIEQTYRLFKDRLY..................................
A0A1N6QRE9_9GAMM/82-317              ................................KPGTAGWYNSAAFDKAAKEA..GLYAKSINGDAFSDECRAKAIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....T.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......S.......E.E.EIQNTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAAAAIRGE..L.AT.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR A0A1N6QRE9_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G8PEI0_PEDCP/86-323                  ..............................ml--GSAGWYNNIYFRQFAEQH..GLIATNFIGDAFSDQMKDDVINYIKTSF.gG......KIDLLVYSLA.......S..P..KRI..DP.....A.......N......P..E...kIYTSVIK....PID..K.A......V.T...G...YNL......NL.........E...K...N...EMV.EQTI........EPA......N.......Q.S.EIDQTIKVMGGEDWERWIDFLKKADVLVDGFKTVIFSYIGSPLT..YSFYHEGTLGVAKDDDDIHAKAIQSK..L.ES.LNGK...ATVIVNKAVTTKASLVIPIFPVYCIALYKVMTAKGTHETPIMHQDRTFRTMLY..................................
#=GR G8PEI0_PEDCP/86-323       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7NRI3_9GAMM/82-317                  ................................KTASAGWYNTVAFEQAAAAE..GLWNKHLNGDAFTDELKSQAIDLIRREM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......T......G..E....VYSSVLK....PIA..Q.A......Y.T...A...KTL......NT.........S...K...R...EIE.SVSV........EPA......S.......D.E.EIFNTVKVMGGEDWERWLDQLHAAGVLAEGCQTVAYTYIGKELT..WPIYGKATIGKAKEDLDRAATAITQK..L.DS.VAGH...AYVASLKALVTQASSAIPIMPLYISLLYRVMKAEGTHEGCIEQIYGLFQQALY..................................
#=GR F7NRI3_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C7R9D9_KANKD/84-320                  ................................KTGTAGWYNNRGFEIAADKA..GLWNKSINGDAFSNQAKEDAIKIIKEEM..G......KIDMVVYSLA.......S..P..RRQ..DP.....E.......T......G..E....VYKSVLK....PIG..E.A......V.T...E...KTL......NT.........D...K...G...IVH.DISI........DPA......T.......E.D.DIQNTIKVMGGEDWELWMKALDEAGVLADGVKTVAYTYIGKKLT..WPIYGHATIGKAKEDLDRASHAIHSK..L.QEkYNGT...ANVSVLKAVVTQASSAIPVMPLYISLLYKVMKENGVHEDPIHQIKGLIMDQMY..................................
#=GR C7R9D9_KANKD/84-320       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z8UFG1_9PROT/82-317              ................................KPGTAGWYNXAAFHRYAEDA..GLYAKSINGDAFSAXLKDSVIDLIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....V.......T......G..X....VHVSTLX....PXG..S.A......A.X...Q...XGI......XT.........X...K...G...TIQ.XFHL........XPA......S.......X.E.EIXXTVAVMGGEDWQMWIEALDDAGVLAEGAKTTAYTYIGEKIT..WDIYWHGTIGAAKXDLDKRVVAIRER..L.AA.KGGD...ARVSVLKAVVTQASAAIPAMPIYLAILFKVMKAKGTHEGCIEQIDRLFREALY..................................
#=GR A0A1Z8UFG1_9PROT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S7XET4_9FLAO/81-316                  ................................RPASPGWYNSAAFEAQAHKD..GLYAKSINGDAFSNEIKAQTLKLIQDDL..G......KIDMVIYSLA.......S..P..VRT..HP.....D.......T......G..E....RFKSVLK....PIG..E.T......F.T...N...NTV......DF.........H...T...G...VVK.EISI........EPC......S.......G.D.DIDNTIAVMGGEDWKMWIDLLKSADVLSEDFKTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFEITDS..L.KD.INGK...GYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIERLFNERLY..................................
#=GR S7XET4_9FLAO/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T1CBA8_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKQQALDLIKKDL..G......QVDLVVYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSTLK....PIG..G.V......Y.S...N...KTV......DF.........H...T...G...NVS.EISI........QPC......E.......G.D.DIENTVAVMGGEDWSMWIEALKAENLLADGAMTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTIADS..L.KE.INGQ...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGIHEGCIEQIQRLYSERLF..................................
#=GR A0A1T1CBA8_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A290QA68_9BACT/82-318              ................................RPATPGWYNTIAFTNAARAA..GRYAKNINGDAFSDDIKKQAIEAIKADL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....VHKSCLK....PVG..Q.T......Y.T...N...KTV......DT.........D...K...G...VVS.EITI........EPA......N.......E.A.EIADTTAVMGGEDWEMWIDALLEANVLAPGATTVSYSYIGPEVT..WAIYKNGTIGLAKNDLERAAKSLDAK..L.KAhGYGR...AFISVNKALVTQASSAIPVVPLYISILYKLMKARGTHEGCIQQIQRLFATEMY..................................
#=GR A0A290QA68_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R2W4T8_9GAMM/81-316              ................................KPGTAGWYNSAAFHKFAEQD..GLYAKSINGDAFSDEVKAKTIATIKEDL..G......QIDLVIYSLA.......A..P..RRQ..HP.....K.......T......G..E....VFNSTLK....PVG..K.N......I.T...M...RGI......NT.........D...K...E...TIQ.EFSL........EAA......N.......E.Q.EIADTVAVMGGEDWQMWIDDLSAAGVLAEGAKTTAFTYIGEKMT..WDLYWDGTIGQAKKDLDKRVLSIREK..L.AA.QGGD...ARVSVLKAVVTQASSAIPIMPLYLAMLFKEMKRDGSHEGCIEQLYRLFTECLY..................................
#=GR A0A0R2W4T8_9GAMM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F5Z979_ALTNA/82-317                  ................................KTGTAGWYNTAAFHQQAAKK..GLYAETINGDAFSDEIKAQTIDKIKANM..G......KVDLVIYSLA.......S..P..RRT..DP.....D.......T......G..V....VYKSTLK....PVG..R.E......Y.T...T...KTY......DT.........D...K...D...KVH.DVTL........EAA......N.......D.D.EILNTIKVMGGEDWERWMDHLAEAGVLAEGCKTTAYTYIGKALT..WPIYGQATIGKAKEDLDRAAAAIIGK..N.TE.LLVE...ANVSSLKALVTQASSAIPVMPLYISLMQEVMKRDGTHEGCIEQIHGLFSTCLF..................................
#=GR F5Z979_ALTNA/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A229UID4_9BACL/82-317              ................................RPASAGWYNSAAFEKAAQAA..GLQSYSVTGDAFSDETKQKTIELIRKEL..G......QVDLVIYSVA.......S..A..RRT..NP.....R.......T......G..E....TANSVLK....PIG..K.P......Y.T...N...KTV......NF.........H...D...G...VVS.PITI........EPA......T.......E.D.EIRETVEVMGGDDWQLWIDALRAGGVLADDATTISYSYIGSQIT..QAIYREGSIGRAKDHLEATARQLNEQ..L.GA.TGGR...AYVTVSKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQTYRLFAERLY..................................
#=GR A0A229UID4_9BACL/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X7J2P2_9BURK/82-317              ................................KSGTAGWYNTAAFEKFATAE..GLYASSINGDAFSDEVKARTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRQ..HP.....K.......T......G..E....VFSSVLK....PIG..K.S......V.N...L...RGI......DT.........D...K...E...VIK.ETVL........EPA......T.......P.E.EIAHTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIRAK..L.AA.KGGD...ARVAVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A1X7J2P2_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A098M4B2_9BACL/81-316              ................................RTASAGWYNSAAFEKLAEEA..GLQSFSVTGDAFSNETKQRTIELIQQEL..G......QVDLVVYSVA.......S..G..RRI..HP.....V.......T......G..E....TFSSVLK....PLD..S.T......Y.T...N...KTV......NF.........H...T...G...EVS.MVSI........DPA......T.......E.E.EIAGTVTVMGGEDWQMWIDELQQAGVLADHAVTIAYSYMGSEIT..QPVYREGTIGRAKDHLEETAHHINKQ..L.AS.RGGR...AYVAVTKALVTQSSSAIPVVPLYISALYKVMKQKDLHEGCIEQAYRLFSEHLY..................................
#=GR A0A098M4B2_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W4AL42_9BACL/81-316                  ................................RTASAGWYNSAAFEKAADAA..GLKSFSVTGDAYTQETKAKTVELIRKEL..G......QIDLVVYSVA.......S..A..RRT..LP.....E.......T......G..E....TVNSVLK....PIG..P.A......Y.T...N...KTV......NF.........H...T...G...EVT.EVTI........EPA......T.......E.E.EVKNTVEVMGGDDWELWMNELAEGGVLAEKVTTIAFSYIGSEIT..KAIYRDGSIGQAKDHLEATALKLNER..L.AD.GGGR...AYVTVSKALVTQSSSAIPVVPLYVSALYKVMKEKGLHEGCIEQIYRLFADRLY..................................
#=GR W4AL42_9BACL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T4RQR1_9GAMM/82-317              ................................KTGTAGWYNAAAFEKFAHEA..GLYAKSINGDAFSNEARDKVIELIKADL..G......TIDMVVYSLA.......S..P..VRK..LP.....T.......T......G..E....VVRSSLK....PIG..E.P......Y.R...S...TAI......DT.........N...K...D...VII.EASI........EPA......T.......E.Q.EVADTITVMGGEDWELWINALNDAGVLTPNCKTVAYSYIGTDIT..WPIYWHGALGKAKEDLDRAAQALNAK..L.QA.GGGS...ANVAVLKSVVTQASSAIPVMPLYLAMVFKIMRAQGLHEGCMQQIDRMFRTQLF..................................
#=GR A0A1T4RQR1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A154QWL3_9GAMM/83-317              ................................KTGTAGWYNSAAFDKAAKQA..GLYSKSINGDAFANETRARAIEIIKNEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....TIG..Q.P......F.T...N...TSV......DT.........N...K...D...TVI.EATV........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSKAGVLAEHAKTVAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKQLRSR..H.--.PGLD...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHEGPIEQANRLFHDRLY..................................
#=GR A0A154QWL3_9GAMM/83-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V3R455_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRL..NP.....N.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...T...G...KVS.EISI........EPC......N.......E.D.DITNTVAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.AD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGIHEGCIEQIQRLYQERLY..................................
#=GR A0A1V3R455_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D4XDT0_9BURK/101-336                 ................................KAGTPGWYNTAAFHKAADAH..GLFAQSINGDAFSDEIKQKTIAAIKAGM..G......QVDQVVYSLA.......A..P..RRT..HP.....R.......T......G..Q....VFNSTLK....PIG..H.A......V.N...L...RGL......DT.........D...R...E...VVK.ESVL........EPA......T.......Q.A.EIDATVAVMGGEDWQMWIDALMDAGVLAEGATTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDEKVLDIRSK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKIMKEQGTHEGCIEQVYGLYRDSL-c.................................
#=GR D4XDT0_9BURK/101-336      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0H4UUM6_9COXI/82-319              ................................RTASPGWYNTATFEKAAHET..GLYAKSIKGDAFSDEIKQKTIELIQQDW.qS......EVDLIIYSIA.......S..P..RRI..HP.....K.......T......G..E....IFNSVLK....PIG..Q.S......Y.R...N...KTV......DV.........M...T...G...EVS.EVII........EPA......T.......E.K.EIQDTEAVMGGDDWALWISALLENNCLAKGIKTAAFTYIGPEIT..HAIYRNGTIGRAKFHLEETAKKLDFL..L.KSkLEGQ...AIISVNKALVTQASAAIPVLPLYISLLYKVMKEKNLHEGCIQQMWRLFSERLY..................................
#=GR A0A0H4UUM6_9COXI/82-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B9E9N6_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSDAVKKQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRL..DP.....K.......T......E..V....LHRSVLK....PIG..D.K......F.T...N...KTV......DF.........H...S...G...KVS.EITI........EPA......A.......G.E.DIENTVKVMGGEDWAMWIEALKAANLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.TS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLYADRLF..................................
#=GR A0A1B9E9N6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G0GBE1_SPITZ/82-317                  ................................RTGTPGWYAARHFLKRAEAA..GLKVHDINGDAFSFEVKAQVVDLIKKEY..G......TIDLFVYSLA.......S..G..VRT..DP.....V.......S......G..V....TYRSALK....PIG..R.T......Y.T...S...KAL......DP.........L...K...R...EVV.QAAI........EPA......S.......E.E.EIEATVKVMGGEDWQLWVEALKEGGVLAEGAVTVAYSYIGPELT..RPIYREGTIGKAKEHLEATAKTLDEA..L.AS.VGGK...AYVSVNKAVVTRASAVIPAVPLYLSILFTVMKAKGIHEGCIEQMYRMLAERLY..................................
#=GR G0GBE1_SPITZ/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_BURVG/82-317                    ................................KPGTAGWYNSAAFEKFAAEK..GLYARSINGDAFSDKVKQITIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PVG..K.S......V.T...F...RGL......DT.........D...K...E...TIR.EVTL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKKVVSIREK..L.AV.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLLKDSMY..................................
#=GR FABV_BURVG/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q03TR0_LACBA/85-322                  ...............................s-LGSAGWWNQVYFKQAAEQA..GHIARNLNADVFSPATKRAVIEEIQTHF.gG......AIDLLVYSIA.......A..P..KRV..NP.....V.......N......P..T...eVWRSVIK....PLG..R.A......V.T...D...ATL......DL.........E...H...E...KLV.STTV........PPA......T.......A.T.ELAATIHVMGGEDWELWVHALQAAGVLAPQFKTVLYSYEGPTAT..APIYHDGTLGQAKRAAEASAQRLQTL..L.AP.SGGE...ALISVNRSVTTKASMVIPGFSRYCMALYQVEQATGGHEVPVQQIDRLMRQMIY..................................
#=GR Q03TR0_LACBA/85-322       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H7QTZ5_9GAMM/83-318              ................................KPGTAGWYNSAAFDRFAKAE..GLYSKSINGDAFSHEARDKAIELIQQDM..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSVLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......E.Q.EIEDTKAVMGGEDWELWIEALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDDR..L.AE.RHGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYKVMKEKGLHEGTIDQLNRLFGERLY..................................
#=GR A0A1H7QTZ5_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H2G171_OCESG/82-317                  ................................KPGTAGWYNAAAFDKAAKEE..GLYAKSINGDAFSNECREKVIELIKQDL..G......DIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VVRSALK....PIG..E.P......Y.K...S...TAL......DT.........N...K...D...VLV.EAVV........EPA......N.......E.Q.EIADTIQVMGGQDWELWMNALEEAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGKAKEDLDRAAHAIDSK..L.KA.RGGN...AHVAVLKSVVTQASAAIPVMPLYISMAFKVMKEQGIHEGCIEQIQRLFHDRLY..................................
#=GR H2G171_OCESG/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I4YRH5_9FLAO/82-318              ................................KPGTAGWYNSAAFEKEAQNA..GLYAKSINGDAFSDEIKQQTIDLIKKDL..G......TVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..Q.T......F.S...N...KTV......DF.........H...T...G...VVS.DITI........NPI......E......sQ.E.DIDNTIAVMGGEDWRFWMEDLQKAGVLANGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATASTINTI..L.KD.LNGE...AYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMYRLFNDRLY..................................
#=GR A0A1I4YRH5_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R4K4G8_CLOPA/81-314                  ................................RTGTAGWYNTAAFEQEALNK..GYYSKTINGDAFSKEIKDKTIELIKKDF..G......KVDIVIYSIA.......S..P..KRK..DP.....L.......T......G..K....ISYSALK....PIE..K.A......Y.K...N...KTV......NF.........H...T...F...KVS.NVEI........EPA......S.......E.D.EIEQTVNVMGGQDWKLWIDALMNEKVLEQGATTIAYSYIGPEIT..YPIYRQGTIGKAKENLEATSLQLDQK..L.KA.INGK...AFISVNKALVTQSSSAIPVVPLYVSVLDKVMKEKNIQEGCIEQMCRLFSK---i.................................
#=GR R4K4G8_CLOPA/81-314       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q9H9R6_9VIBR/83-319              ...............................g-VGSAGYYNNLFFQKHAEAE..GRLALNIQADAFSPQTKEEVIEAIETYF.eG......EVDLIIYSVA.......S..G..IRP..NY.....Q.......T......G..E....MWRSAIK....PIG..N.S......V.K...G...ASL......SL.........E...H...D...QWL.ENEL........EPA......S.......N.E.EIEGTLKVMGGDDWEAWVDTLINSESIAEGCKTVAFSYIGPELT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.AN.FDGG...AYATVCKALVTKASVFIPGLTPYLMALYQVMKQKGTHEGCIEQMHRLFTTKLY..................................
#=GR A0A1Q9H9R6_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S4Y3R8_SORCE/91-319                  ...........................mqigp-------HHVKAITDAAAAE..GLTARFWNNDATRPQVIDEVVAALKERY..R......AVHLV-NGIA.......A..G.aMKR..YA.....E.......H......G..P....TKVKDLD....VAF..D.P......V.LqvpD...FSR......PE.........N...I...R...KLG.LVEV........DVA......N.......D.A.DIERTNKFMGTSS-LLWAEPLAAAGLLAKGESVVSFCDYDYPSD..DPVYAMGPLAGAKKLQRQTMAEIQGK..F.G-.--VK...TARICYPALATTALGAIPGGLLMYGLSTQILKERGQFRDVID-----------lardtme...........................
#=GR S4Y3R8_SORCE/91-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R4I195_9GAMM/82-317                  ................................KTGSAGWYNSAGFDKIAKKT..GLYAKSINGDAFSDKCRQSVIDLVKQDL..G......NIDLVIYSLA.......S..P..IRK..IP.....D.......T......G..E....VVRSVIK....TIG..E.P......Y.K...S...ITL......DT.........N...K...D...ILM.QVVV........EPA......N.......K.K.EIFDTIRVMGGEDWQLWINALDQAKVLADNIQTIAYSYIGTDLT..WPIYSHGTLGKAKENLYSAAQAINQK..L.KN.RGGA...AYVAVLKSVVTQSSSAIPVMPLYISILFKIMKEQGIHEGCIEQIQRLFATKLY..................................
#=GR R4I195_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H2M4U0_9PSED/82-316              ................................KLSSAGWYNSAAFHKFAAQK..GLYAKSINGDAFSDEIKRLTIETIKKDL..G......KIDLVVYSLA.......A..P..RRT..DP.....Q.......-......G..V....VHNSTLK....PIG..K.A......V.T...L...RGI......NT.........D...K...G...VVV.DTTL........EPA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALRDADVLAEGAKTTAFTYLGEKLT..QDIYWNGSIGEAKKDLDKKVLTLRDN..L.AA.LKGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A1H2M4U0_9PSED/82-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9ZYG7_METMM/82-317                  ................................KPGTPGWYNSAAFHKFAEAE..GLYAKSINGDAFSDDIKQKTIAAIKQDM..G......KVDLVIYSLA.......S..P..RRT..HP.....K.......T......G..V....THNSTLK....PIG..K.D......L.V...Q...NGI......DT.........D...K...E...VIK.EFTL........AAA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALAEADVLADGAKTTAFTYLGEKVT..WDIYWHGTIGAAKKDLDKRVIDIRAK..L.AA.LGGD...ARVSVLKAVVTQASAAIPVMPLYLALLFKVMKDQGTHEGCIEQVNGLFRDSLY..................................
#=GR F9ZYG7_METMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F5FER9_9RHIZ/82-315              ................................KPASAGWYNNRAFENRARAA..GRKAITIEGDAFSDAVKAETIAAIKDNL..G......QVDLVVYSLA.......S..P..VRT..DP.....K.......D......G..V....TYRSAIK....PYG..S.Q......V.T...S...KTL......NT.........G...T...G...EVS.EITV........EPA......T.......E.E.EAQATVKVMGGEDWELWIAALADAGVLADDFLTLNYTYLGSELT..WPIYHKGTLGKAKGDLDRAAAAIRAA..H.--.GEAA...ANVVALKAVVTQASSAIPVVPLYGTVLIKVEDEMGLSEGPIHQIDRLFREKL-r.................................
#=GR A0A0F5FER9_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H2IA80_VIBSJ/82-317                  ................................KPGTAGFYNAAAFEKLAREE..GLYAKSLNGDAFSNEAKEKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.AQ.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR H2IA80_VIBSJ/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9RCC8_VIBSN/83-319                  ...............................g-VGTAGWYNNIYFRQEAEKQ..GLIAKNFVGDAFSAHTRQDVLDYIQNEF.gG......SVDLVVYSLA.......T..G..VRP..NP.....E.......T......G..E....LWRSSIK....TVG..E.P......V.S...G...PTI......NI.........E...M...D...ALE.TMQV........ETA......S.......E.A.ELDATIKVMGGEDWQSWINMLSDAGVLAQGCKTVAYSYVGPEVT..YPIYHQGTLGRAKAHLHNTADTLNEQ..L.GA.IGGE...AYVSVCKALVTKASVFIPAFSPYILSLFKVMKEKGTHEGCIEQMQRLFAQRLY..................................
#=GR F9RCC8_VIBSN/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A5GHZ5_9GAMM/81-316              ................................KPGTAGWYNSAAFHKFADAE..SLYAKSINGDAFSDEIKQKVIETIKADL..G......QVDLVIYSLA.......S..P..RRQ..HP.....K.......T......G..E....VFKSTLK....PVG..K.N......I.T...L...KGI......NT.........D...K...E...EIQ.EFSM........EAA......S.......D.E.EIANTVTVMGGEDWKMWMDALGEADVLAEGAKTAAFTYVGEKVT..WDLYWDGTIGHAKRDLDKKVIGIREQ..L.AA.MGGD...ARVAVLKAVVTQASSAIPIMPLYLSLLFKVMKADGSHEGCIEQLYRLYTECIY..................................
#=GR A0A2A5GHZ5_9GAMM/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H2ETZ7_9BACT/82-315              ................................RTATAGWYNTVAFEREAAAA..GYDAKDIHGDAYSDETKQRVVEQIRKSW..G......QVDLVVYSLA.......S..P..KRN..NP.....R.......T......G..K....APNSCLK....PIG..A.P......Y.T...A...KTV......NT.........D...K...Q...EVH.DITL........PEA......S.......E.Q.DIADTVSVMGGEDWEWWIDALEQGGVLAPGATTLAFSYIGPKLT..FPIYRHGTIGRAKEDLEATALRLNER..L.AK.TNGG...ARVVISKALVTQASSAIPVVPLYISLLYKVMKEKGLHEGCIEQMYRLFST---t.................................
#=GR A0A1H2ETZ7_9BACT/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
X7E1U3_9GAMM/82-317                  ................................KTGTAGWYNSAAFDKVAKEE..GLYSKSINGDAFSNEARAQVIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSVLK....PIG..E.T......Y.K...S...TAI......DT.........N...K...D...VII.EAEI........EPA......T.......E.E.EITATTTVMGGQDWELWMSALQEAGVLADGVRTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRASAAIDGK..L.AS.LNGG...ANVAVLKSVVTQASSAIPVMPLYLAMVFKIMREKSLHEGCIDQIYRLFSERLY..................................
#=GR X7E1U3_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A239TJU4_9FIRM/81-311              ................................RTATAGWYNTAAFEEIAKAD..GLYAKTINGDAFSQEIKAKTIELIKKDF..G......QIDMIVYSLA.......A..P..RRT..TA.....D.......-......G..T....MYSSVLK....TVD..K.P......F.T...A...KTL......NL.........K...T...N...EVT.EATL........PPA......T.......P.E.EVEATIKVMGGEDWADWMHALKDADVLAPNALSIAYSYIGSKIT..YPIYYEGTIGAAKQDLYKTAENLRKE..-.--.-GFN...AVISVNKALVTQSSSAIPIVPLYVAVMYRVMKDKNVHEGTIQQMSRLWHEYL-s.................................
#=GR A0A239TJU4_9FIRM/81-311   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A231RHU1_9BACL/81-316              ................................RTASAGWYNSAAFETAAQEA..GLKSFSVTGDAFTDETKAKAVDLIRKEL..G......QVDLVIYSVA.......T..A..RRT..NP.....R.......T......G..E....TSTSVLK....PIG..Q.P......Y.T...N...KTV......NF.........H...D...G...EVS.LVTL........EPA......T.......E.E.EIQATVDVMGGDDWQMWIDALREGGVLAPDATTISYSYIGPELT..QAIYRQGSIGRAKDHLEATAKQLHEQ..L.SA.GGGR...AYVTVGKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQMYRLFADRLY..................................
#=GR A0A231RHU1_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H3NX80_9GAMM/82-317                  ................................KPGTAGWYNSAAFHRYADEA..GLYAKSINGDAFSAELKDRVIDLIKEDL..G......QVDLVVYSLA.......A..P..RRT..HP.....V.......T......G..D....VHVSTLK....PIG..S.P......A.V...Q...KGI......NT.........D...K...G...IIQ.EFHL........EPA......S.......Q.E.EIDNTVAVMGGEDWEMWIEALDNAGVLADGAKTTAYTYIGEKIT..WDIYWHGTIGAAKKDLDKRVVGIRER..L.AA.KGGD...ARVSVLKAVVTQASAAIPAMPIYLAILFKVMKARGTHEGCIEQIDRLFREAMY..................................
#=GR H3NX80_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I4VM36_9GAMM/82-316                  ................................KTGTAGWYNAAAFDKAAKAA..GLYSKSINGDAFAHETRAKAIEIIKNEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VVRSALK....TIG..E.K......F.T...N...TSV......DT.........N...K...D...TVI.EASI........EPA......T.......E.Q.EIKDTVTVMGGEDWALWIDALSNAGVLADHAKTIAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTAKQLRSR..H.--.PGLE...AYVGVMKSVVTQASAAIPVIPLYVSIAFKIMKEKGIHENPIEQANRLFHDRLY..................................
#=GR I4VM36_9GAMM/82-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2C6V800_NOSLI/81-316              ................................KTASPGWYNSAAFEEEAHKA..GLYAKSINGDAFSKEVKQQAIDLIKADL..G......QVDMVVYSLA.......S..P..VRQ..HP.....E.......T......G..V....LHRSVLK....PIG..D.A......Y.H...N...KTV......DF.........H...S...G...KVT.EVSI........QPA......Q.......E.G.DIENTVAVMGGEDWAMWIDALKAENLLAPGAVTMAYSYIGPALT..EPVYRKGTIGRAKDHLEATAFEITDK..L.KD.INGH...AYVSVNKALVTQASSAIPVIPLYISLLYKTMKEKGIHEGTIEQMYRLYKERLY..................................
#=GR A0A2C6V800_NOSLI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A248VJY8_9BURK/82-317              ................................KAGTAGWYNTAAFEKFATEQ..GLYATSINGDAFSDEVKQRTIEIIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......S......G..E....VFSSTLK....PVG..R.A......V.N...L...RGI......DT.........D...K...E...VIK.ETVL........EPA......T.......Q.E.EIDHTVAVMGGEDWQMWIDALLEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIRGK..L.AA.KGGD...ARVAVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A248VJY8_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0H1ATH3_9GAMM/82-318              ................................KPGTAGWYNAAAFDKAAKQA..GLYSRSINGDAFSDAAREQAIALIRDEM.gG......QVDLVIYSLA.......S..P..VRK..LP.....G.......T......G..E....LKRSALK....PIG..Q.A......Y.T...S...TAI......DT.........N...K...D...QVI.EATV........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALREAGVLADGAKTVAFSYIGTEIT..WPIYWHGALGRAKADLDATARRLDAQ..L.RP.TGGS...ANVAVLKSVVTQASAAIPVLPLYIAIVFKVMKELGLHEGTLDQLDRLLRERMY..................................
#=GR A0A0H1ATH3_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q8F988_9GAMM/82-318              ................................KPGTAGWYNSAAFDKFAKDA..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....S.......T......G..E....VKRSALK....PIG..A.P......Y.T...S...TAI......DT.........N...K...D...QIT.QATI........EPA......T.......E.Q.EIADTVTVMGGQDWELWIDALDQAGVLADGARTVAFSYIGTDIT..WPIYWHGALGRAKVDLDQTAQRLDAR..L.KK.TGGT...ANVAVLKSVVTQASSAIPVMPLYISIVFKVMKELGLHEGTIEQLDRLYRERMY..................................
#=GR A0A0Q8F988_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A120FPV4_9BRAD/82-314              ................................RTGSAGWYNNRAFEIEAERI..GRSPLTLEGDAFSDEMKKNFIERVREKF..G......QLDLLVYSMA.......A..P..ART..DP.....V.......T......G..K....TYRSVIK....PLG..A.P......V.E...I...KTL......DT.........E...T...G...EVF.QTTL........EPA......S.......E.D.QTTATVAVMGGDDWKRWIDQLADAGVLAPGFRTLNYTYIGSELT..WPIYWHGTLGRAKVDLDSKAEEIRGR..L.GE.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR A0A120FPV4_9BRAD/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A4GC18_9FLAO/81-316              ................................KTSSPGWYNSAAFENEAHAA..GLYAKSINGDAFSKEIKEKTLNTIKEDL..G......QVDLVVYSLA.......A..P..MRV..HP.....E.......T......G..V....RHKSVLK....PIG..G.V......Y.E...N...KTV......DF.........H...T...G...VVS.DIKI........EPC......G.......E.G.DIENTVAVMGGEDWELWIDALMEADLLAPGAQTVAYSYIGPALT..EPIYRKGTIGRAKDHLEATAGKLMQK..M.ES.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLFKIMKEKGIHEGCIEQMQRLFYDRMY..................................
#=GR A0A2A4GC18_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
K0D1M0_ALTMS/82-317                  ................................KTGTAGWYNTAAFHEKAKAK..GLYAETINGDAFSDEIKNEAIDKIKAEM..G......KVDLVIYSLA.......S..P..RRT..DP.....E.......T......G..V....TYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...KVH.EVSL........EPA......N.......D.E.EILNTIKVMGGEDWERWMDFLREADVLAEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAIIGK..N.SD.LYVQ...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIYGLFTQCLF..................................
#=GR K0D1M0_ALTMS/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0P0G8I4_9BACT/82-315              ................................KLASAGWYNSAAFEAAAIKE..GLYAKSFNGDAFSEEMKKRVTSIIRRDL..G......QIDLIVYSVA.......S..P..RRL..DP.....A.......R......G..K....IYKSTLK....PIG..S.S......L.V...T...KSI......CT.........D...K...K...EIE.SVTL........EAA......T.......W.E.EVFHTIKVMGGEDWKIWISSMADAGALSEGFRTVAYSYLGPGLT..RAIYAQGTIGRAKIDLERTARELNKQ..F.G-.-DRT...AFISINKAVVTQASSAIPAVPLYISILFKVMKERGIHEGCIEQMYRLFRDHL-c.................................
#=GR A0A0P0G8I4_9BACT/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1J0VEG0_9GAMM/83-318              ................................KPGTAGWYNSAAFDRFAKAE..GLYSKSINGDAFSHEAREKAIELIQQDL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...TII.EAEV........EPA......T.......E.Q.EIEDTKAVMGGEDWELWIDALDRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDKR..L.AA.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRVMKEKGLHEGTIDQLNRLFGERLY..................................
#=GR A0A1J0VEG0_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R6DTG9_9CLOT/81-313                  ................................RTASAGWYNTAAFETFATKD..GYYAKSINGDAYSQEIKDETIELIKKDL..G......KVDMVIYSVA.......A..P..RRK..AP.....D.......-......G..V....TYRSTLK....TVG..E.E......Y.T...N...QTI......DL.........L...T...N...EIT.EVTI........PAA......T.......E.Q.EVHDTIKVMGGEDWKLWIEQLKAADVLADQAITVAYSYIGPEIT..YPIYKEGSIGQAKKHLYQTADELNEE..V.--.DGLL...AYVSVNKAVVTQSSAAIPIVPLYLSLLFKVMKEKGLHEDCIKQMYRLVHDRL-c.................................
#=GR R6DTG9_9CLOT/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A094J048_9GAMM/82-317              ................................RTGTAGWYNTAAFHEAAEKE..GLYAHTINGDAFSDEIKEATIERIKEDL..G......KVDLVIYSLA.......S..P..KRK..DP.....V.......T......G..E....VYSSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...R...D...EVK.EISL........EPA......T.......D.D.EIQNTVKVMGGEDWELWIAALHDAGVLAENCKTTAYTYIGKQLT..WPIYGHATIGRAKEDLDRAAAALRAR..Y.SD.LNLE...AYVSSLKALVTQASSAIPVMPLYISLIYGVMKEEGTHEGCIEQIYRLFTEGLY..................................
#=GR A0A094J048_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q9YN56_9COXI/82-318              ................................RTASAGWYNSAGFENAAKQK..GLYAKSINGDAFSDEIKAKTIELIQQDW.qG......GVDLVVYSLA.......S..P..RRK..HP.....K.......T......G..E....LFNSTLK....PIG..Q.S......Y.T...S...KTI......DV.........M...S...G...QIS.DITL........PPA......S.......E.Q.DIDQTVTVMGGEDWQMWIDALLEADVLAAGVKTIAYSYIGPQLT..YPIYREGTIGKAKNHLEATAHHLNKT..L.SA.IDGQ...AFVSVNKALVTQASAAIPVVPLYISLLYKVMKEKQLHEGCIEQIVRLFQDRLY..................................
#=GR A0A0Q9YN56_9COXI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1E8FK06_9ALTE/82-317              ................................KTATAGWYNTAAFHTQAKDA..GLYAETLNGDAFSNELKEQVIDKIKADL..G......QVDLVIYSLA.......S..P..RRT..DP.....A.......T......G..E....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...KIH.DVSL........EPA......S.......E.E.EIANTVKVMGGEDWELWLNALSAAGVLAEGCKTTAYTYIGKELT..WPIYGSATIGKAKEDLDRAATAINTD..H.AD.LEVD...AHVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIAGLYTQCLY..................................
#=GR A0A1E8FK06_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N0E1S7_9PSED/82-317              ................................KLGTAGWYNSAAFHKFAEAE..GLYAKSINGDAFSDEVKRLTIETIKRDL..G......KIDLVVYSLA.......A..P..RRT..DP.....K.......T......G..E....VYSSTLK....PIG..K.S......I.T...Q...RGL......NT.........D...K...E...VVA.ETTL........EQA......T.......E.E.EIAGTVKVMGGEDWQLWIDALDEAGVLAEGAKTTAFTYLGEKVT..HDIYWNGSIGAAKKDLDQKVLKIRER..L.AA.KGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGVHEGCIEQVYGLYKDSLY..................................
#=GR A0A0N0E1S7_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A8E8Y4_9COXI/83-320              ................................RTASPGWYNVAAFEKAACAL..GLYVKSINGDAFSNEVKRKTIELIRKDW.kN......GVDLVVYSIA.......A..P..RRV..HP.....K.......T......G..E....VFNSVLK....PIR..Q.F......Y.R...S...KTV......DI.........M...T...G...KVS.EIIV........GPA......T.......E.K.EIQDTKLVMGGDDWALWITALLESNCLSRGIITVAFTYIGPELT..YAIYRNGTIGKAKQSLEATAKKLDAL..L.KEkREGR...AVISVNKALVTQASVVIPAVPLYVSLLYKVMKRKSLHEGCIEQMLRLFSRYLY..................................
#=GR A0A0A8E8Y4_9COXI/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B5RZW4_9FLAO/82-318              ................................RPGTAGWYNSAAFEEQAKNA..GIYAKSINGDAFSDEIKKETIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..E.P......F.T...N...KTV......DF.........H...T...G...VVS.NISI........DPV......K.......EqS.DIDNTIAVMGGEDWKFWIEDLKAAGVLADGAKTVAYSYIGPELT..YPIYRNGTIGMAKNDLEATVPVINDL..L.KD.LNGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKNIHEGCVEQMQRLFADRLY..................................
#=GR A0A0B5RZW4_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A8TE12_9GAMM/82-317              ................................KTGTAGWYNAAAFDKAAKEE..GLYAKSINGDAFSNEARDKVIELIKQDL..G......EVDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSVLK....PIG..Q.P......Y.R...S...TAI......DT.........N...K...D...VII.EAEI........EPA......T.......E.E.EVAATTTVMGGQDWELWMSALKEAGVLAEGVRTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRAAHAINGQ..L.AE.FKGG...ANVAVLKSVVTQASSAIPVMPLYLAMVFKVMREKGLHEGCMDQIYRMFAERLY..................................
#=GR A0A1A8TE12_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6YBU0_9BURK/82-317              ................................KPGTAGWYNTAAFEKFAHAQ..GLYATSINGDAFSDAVKARTIEIIKRDL..G......QVDLVVYSLA.......A..P..KRT..HP.....K.......T......G..E....VFSSTLK....PVG..K.A......I.A...L...RGI......DT.........D...K...E...VVK.ETVL........EPA......T.......Q.A.EIDNTVAVMGGEDWQMWIDALLEAGVLADGAQTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.SGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKSTHEGCIEQVYGLYRDSMY..................................
#=GR A0A1M6YBU0_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A071LRZ7_9ENTR/82-317              ................................KTGTAGWYNTAAFEKYAHEQ..GLYARTINGDAFSDEIKAQTIETIKNDL..G......QVDLVIYSLA.......A..P..RRT..HP.....K.......T......G..E....VYTSVLK....PQG..A.D......I.T...L...PGI......DT.........D...K...K...EVT.QFSL........TAA......T.......D.E.EIDNTIAVMGGEDWQMWIDALSEAGVLADNAKTTAFTYLGPEVT..HQIYWNGSIGAAKKDLDKKVLAIRES..M.KA.TGGE...AYVSVLKAVVTQSSSAIPVMPLYLSLLFKVMKEQGSHEGCIEQIAGLLHDSLY..................................
#=GR A0A071LRZ7_9ENTR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8VZW0_9ACTN/86-321              ................................RTASAGWYRTRAMARCAERT..GTAMSWLNADCFTDETKDRVCDLLAERY..G......PVDYLVYSVA.......A..P..RRR..DP.....D.......T......G..D....THSSVIK....PIG..A.E......Y.A...T...KTL......EF.........D...D...DgatAVR.TVGV........PSA......T.......D.E.EIASTVKVMGGEDWQRWVRALADRELLANGVRTVALTYIGSELT..APIYRSGTIGRAKSHLETTARQLDDW..L.ESyCGGG...AATSVNGAAVTQSSSAIPGIGLYISLLRGALGAA--VHSPLHQLVRLWD----hl................................
#=GR A0A1G8VZW0_9ACTN/86-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6FDK7_9RHIZ/82-315              ................................KPASAGWYNNRAFENRARAA..GSKAVTIEGDAFSNEVKAQTIDAIKETL..G......QVDLIVYSLA.......S..P..VRT..DP.....A.......D......G..V....TYRSAIK....PYG..Q.Q......V.T...S...KTL......NT.........G...T...G...EVS.TISV........EPA......T.......E.E.EAAATVKVMGGEDWELWIAALSDAGVLAEGFSSLNYTYLGSELT..WPIYHKGTLGKAKGDLDRAAAAIRAK..H.--.GDNA...AHVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIQQIDRLFRDKL-q.................................
#=GR A0A1Y6FDK7_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A178K8M0_9GAMM/82-317              ................................KPGTAGWYNSAAFDKLAKEE..GLYSKSLNGDAFSHEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......S......G..E....VVRSSLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EVADTVTVMGGQDWELWINALSEAGVLAEGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAAKSLNEQ..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLY..................................
#=GR A0A178K8M0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G2Z1W7_FLABF/81-316                  ................................KTASPGWYNAAAFEKEAQKE..GLYAKSINGDAFSNDIKQQTINLIKADL..G......QIDLIIYSLA.......S..P..VRM..HP.....N.......T......G..V....LHRSVLK....PIG..N.T......Y.T...N...KTV......DF.........H...T...G...KIT.SVSI........NPS......E.......P.A.DIENTIAVMGGEDWAMWIDALKAQDLLAPGATTIAYSYIGPAVT..EPVYRKGTIGKAKDHLEATAFEITEK..L.KD.INGK...GYVSVNKALVTQASSAIPVIPLYISLLYKTMKAKGLHEGCIEQIQRLYAERLY..................................
#=GR G2Z1W7_FLABF/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A2LQN6_9FLAO/81-316              ................................KPGSPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEIKKQTIDLIKKDL..G......QVDLIIYSLA.......S..P..VRT..HP.....D.......T......G..V....THRSVLK....PIG..G.V......F.S...N...KTV......DF.........H...T...G...KVS.EISI........EPC......K.......D.D.DIENTVTVMGGEDWAMWMKALKEAGALAEGALTVAYSYIGPALT..EPVYRKGTIGRAKDHLEATAFEISDA..L.KD.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYKTMKEAGLHEGTVEQMQRLYAERLY..................................
#=GR A0A0A2LQN6_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A212T339_9ACTN/85-320              ................................RTATAGWYRTAAIAELARRH..GQEMVFLNGDAFSDEMKEQVADLLRQRF..G......RLDHLIYSVA.......A..P..RRT..DP.....E.......T......G..A....TYASVLK....PIG..E.P......Y.R...T...KTL......VF.........DgdgT...P...EVK.EVET........PPA......E.......A.D.DIEQTVAVMGGADWERWVGHLADRGLLADGFTTAALSYIGSPLT..DGIYRQGTIGAAKSHLEATARALDER..L.DKlVGGR...AVTSVNGAAVTQSSTAIPGIALYVGLLRGALGEA--MVPPIAQLADLWD----ql................................
#=GR A0A212T339_9ACTN/85-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T1HCG6_OCELI/82-317              ................................KPGTAGWYNAAAFDKAAHEA..GLYAKSINGDAFSHEARAKVIELIKEDL..G......DIDMVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSSLK....PIG..Q.P......Y.R...S...TAI......DT.........N...K...D...MIT.ETEI........GPA......T.......E.Q.EVADTVTVMGGEDWELWINALNDAGVLAEGCKTVAYSYIGTDIT..WPIYWHGALGKAKEDLDRAATELNSK..L.GE.KGGS...ANVAVLKSVVTQASSAIPVMPLYLAMVFRIMREQGLHEGCMQQIHRMFSTQLF..................................
#=GR A0A1T1HCG6_OCELI/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0N1MV51_9GAMM/82-317              ................................KTGSAGWYNTAAFQAAADAE..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDLIIYSLA.......S..P..RRT..DP.....N.......T......G..E....VYSSTLK....PIG..N.A......V.T...T...KNL......NT.........S...K...R...EID.DITV........EAA......N.......Q.D.DIDNTIKVMGGEDWEMWIEALKEADVLADNFKTSAYTYIGKELT..WPIYGHATIGKAKEDLDRATVAIKES..T.KA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHALFTENLY..................................
#=GR A0A0N1MV51_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G7M8L6_9CLOT/81-316                  ................................RTATAGWYNTASFEEQAGEN..GYYSATINGDAFSKEIKEETIKLIKKDL..G......KVDLVIYSIA.......S..A..KRI..HP.....V.......T......G..E....VFSSVLK....PIG..K.T......F.K...E...KTV......NF.........H...S...Y...QVS.DMEI........NPA......D.......E.D.EVRETVAVMGGEDWKMWIDSLIAADVLAEGAITTAYSYIGPEIT..YPVYRNGSIGKAKKDLEKTAEIINKD..L.EK.INGK...AVISVNKALVTQSSLALPVVPLYISILSKVMKEKGIDEGCIEQIYRLFSEELY..................................
#=GR G7M8L6_9CLOT/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A146G5F5_9BACT/82-314              ................................KTASAGWYNSAAFEEAALKE..GLYAKSFNGDAFSNEMKQKVIETIKTDL..G......QIDMIVYSLA.......S..P..RRT..DP.....V.......T......G..E....VFKSVLK....PTG..E.T......F.T...N...KNL......NT.........D...K...K...EIE.TVSI........DPA......S.......P.E.EIAHTVKVMGGEDWQLWIDALENAGALAEGFKTVAYSYIGPELT..WAIYTDGTIGRAKLDLEKTARDINGK..F.G-.-AGT...ALVSVNKALVTQASSAIPVVPLYISILYKVMKAKGLHEGCIEQIERLFADH--y.................................
#=GR A0A146G5F5_9BACT/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6EKQ6_9GAMM/82-317              ................................KTGTAGWYNTAAFHTEAKAA..GLYADTINGDAFSNECKAEVIERIKANM..G......SIDLVVYSLA.......S..P..KRK..DP.....E.......T......G..E....VYSSTLK....PVG..K.A......Y.T...T...KTY......DT.........D...K...D...LVH.DITL........EPA......N.......D.E.EIANTVKVMGGEDWELWLKALHEAGVLADNCQTTAYTYIGKKLT..WPIYGHATIGRAKEDLDRAATALREN..Y.QD.VNLK...AYVSSLKALVTQASSAIPVMPLYISLIYGVMKQEGTHEGCIEQAYRLFTEGLY..................................
#=GR A0A1Y6EKQ6_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_TERTT/82-317                    ................................KTGTAGFYNVAAFQQAAEKA..GLWSKNMNGDAFSHEAKSKAIDVIKAEM..G......KIDLVVYSLA.......S..P..RRQ..DP.....D.......S......G..E....VYSSVLK....PVG..Q.A......Y.T...S...KNL......NT.........D...T...L...KIT.ETTL........DAA......S.......D.E.EIAQTIKVMGGEDWELWMNALAEADVLAEGCKTVAYTYLGEKIT..WPIYGKATIGKAKEDLDRAATAIASA..H.SE.KNIS...ANVAVLKAVVTQASSAIPIMPLYLSALFKVMKANGTQEGCIEQLNRLFTECLY..................................
#=GR FABV_TERTT/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S4I6I5_9PSED/116-353             ................................KAGTAGWYNAAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNDM.gG......KVDLVIYSLA.......S..P..VRK..LP.....Q.......T......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...AII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALAGADVLAEGARTVAFSYIGTEIT..WPIYWHGALGKAKQDLDDTALRLDQK..L.AAdVKGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMFRDRMY..................................
#=GR A0A0S4I6I5_9PSED/116-353  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1U7EFE6_9LACT/82-318              ...............................s-LGSAGWYNNIYFKQAAEKE..GLIAKNFVQDAFSNQTKQDVIDYIKAEF.gG......KIDLVVYSLA.......S..G..IRI..NP.....E.......T......G..E....RINSVIK....SIG..Q.N......V.V...G...PNI......NI.........E...K...Q...EFY.EQAL........EPA......T.......E.E.EIADTVSVMGGEDWLFWMQALKEADVLAEGVQTTNYSYLGSDLN..KPYYGDGTLGRAKADCEEKAVHINDL..L.TD.IKGK...ATIIIATAVTTKASSVIPFFPVYCMGLYRVMADNGTHETPIMHIDRTFRDMVY..................................
#=GR A0A1U7EFE6_9LACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_CLOB8/82-318                    ................................RTGTAGWYNNIFFKEFAEKE..GLIAKNFIGDAFSDEVKENVIKYIKNEF..G......KIDLLIYSLA.......S..P..RRK..DP.....K.......T......G..N....IYDSTLK....TTS..G.E......F.Q...G...PTI......DM.........E...T...D...ELV.TTKV........NSA......T.......D.K.EIEATKKVMGGEDWSEWCKLLLENDCLSDKAITISYSYIGASRT..YKIYREGTIGEAKRHLENTAIQIDKE..W.QKkINGK...AFVSVNKAIVTKASAYIPSFSLYAAVLYKVMKEKNLHENCIMQMQRMFADKIY..................................
#=GR FABV_CLOB8/82-318         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q1N691_9GAMM/83-317                  ................................KFGSAGWYNNQALEYYARRS..NRTALSTNQDAFQEKAKDWVIQKLQQQG..K......KLEVLVYSLA.......A..P..RRS..IE.....G.......V......G..-....DYQSTIK....PIH..E.N......F.T...G...TTL......DI.........V...K...G...KLR.PLQL........DTA......T.......P.E.EVEATVKVMGGEDWQNWVIRLQKAGVLAENFKTIAYSYLGPEQT..QAIYGRGTLGAAKRHLHETAIALDQK..L.KG.IKGR...AHIGLFEALVTPSSSVIPSLPLYISALHQIQKQRGTYESTLDQVLRMYRD---gfm...............................
#=GR Q1N691_9GAMM/83-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A254SJ81_9BACT/93-329              ................................KTGTPGWYNNMAFDKFAKEA..GLDAVTFNGDAFSHEMRQNVIDTLKKMG..R......KVDLLVYSVA.......S..S..VRV..DP.....D.......N......G..T....IYRSVLK....PID..K.V......F.T...G...ATI......DC.........L...S...G...KIS.TISA........EPA......T.......A.E.EAANTVKVMGGEDWALWVRKLKEAGVLAEGVKTVAYSYIGPKLS..HAIYRDGTIGGAKKHLEATALELHKE..L.QNdLHGE...AYVSVNKGLVTRSSAVIPIIPMYISVLFKVMKEMGNHEGCIEQMERLMTERLY..................................
#=GR A0A254SJ81_9BACT/93-329   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R8ASD3_PLESH/83-316                  ...............................y-SGSAGWHLSAAFAELAAEQ..GLPGETLMLDAFAPASRQTVIETIRRDF..G......QVDLVVYSLA.......A..G..QRT..VD.....-.......-......G..R....KVRSAIK....PAG..A.P......Y.Q...G...YQL......DL.........A...I...D...KLQ.PVTL........EPA......S.......R.Q.EMADTVTVMGGEDWQQWMTALQEAGVLAPGARSVAFSYIGPAST..WPLYRDGTLGQAKADLHQRAQQINAQ..L.QT.LGGG...AWVVVAKALVTKASIFIPGMAPYLMALYAVMKEQGVHEDCLDQMQRLCHSQLF..................................
#=GR R8ASD3_PLESH/83-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D0F1K4_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QIDLVIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.D.DIENTIAVMGGEDWTMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A0D0F1K4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1X1QKE9_9GAMM/82-317              ................................KTGSAGWYNTAAFDAEAKKA..GLYAKHINGDAFSDAAKQKSIDLIKEDL..G......QVDLVIYSLA.......S..P..VRK..VP.....G.......T......D..E....LVRSCLK....PIG..E.T......Y.K...S...TAI......DT.........N...K...D...III.EAEV........EPA......T.......E.Q.EIKDTITVMGGEDWELWMSALADAGVLADGCQSVAYSYIGTAIT..WPIYWDGALGKAKMDLDRAASAIDSK..L.KE.NKGS...ANVAVLKSVVTQASSAIPVMPLYISMVFKVMKEEGIHEGCIEQINRLFRTQLF..................................
#=GR A0A1X1QKE9_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
I4MXJ3_9PSED/82-317                  ................................KPGTAGWYNTAAFHKFADAE..GLYAKSINGDAFSDEIKRQTIEAIKQDL..G......KIDLVVYSLA.......A..P..RRL..HP.....K.......T......G..E....LLSSTLK....PLG..K.S......V.T...Q...RGV......NT.........D...K...G...TVE.ETTL........EPA......S.......Q.A.EIDGTVAVMGGEDWQMWMDALQQAGVLADGAKTTAFTYLGEKLT..HDIYWNGSIGEAKKDLDKKVLTIRDN..L.AP.LGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLFKDSLY..................................
#=GR I4MXJ3_9PSED/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A261Q3K5_9BACT/81-316              ................................KPASAGWYNTAAFEVQAQEA..GLYAKSVNGDAFSNEIKEKVIGLIQADL..G......QVDLVIYSVA.......S..P..RRT..NP.....N.......T......G..V....THNSVLK....PIG..Q.S......F.T...N...KTV......NF.........H...N...G...VVS.EISI........EPA......T.......E.E.DIENTVAVMGGEDWKLWIEALKAADVLAPGARTVAYSYIGPALT..EPVYRKGTIGRAKDDLEATASSITDT..L.KD.LDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEQGIHEGCIEQMQRLFQQRLY..................................
#=GR A0A261Q3K5_9BACT/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H6ZYQ6_9BURK/82-317              ................................RPASPGWYNTAAFHRAAAAD..GRYAKSINGDGFSDAVKQQVIDTIRADL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VFNSVLK....PIG..K.P......V.N...L...RGL......DT.........D...N...E...TVK.ETVL........EAA......T.......Q.E.EIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDHKVLGIRAQ..L.AA.TGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKAQGTHEGCIEQVHGLYADSLY..................................
#=GR A0A1H6ZYQ6_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5GY12_9FIRM/84-317                  ................................KTGTSGWYNTKAFEKFAQAD..GLYAKTVNGDAYSDECKKEVIDLIKSDL..G......KVDAVIYSLA.......A..P..RRT..VG.....D.......-......-..V....TYSSVLK....TTG..E.A......Y.T...N...KTI......DL.........R...N...N...TVS.EVTI........EPA......T.......E.E.EITATVKVMGGEDWAAWIDALKAADAIEDNAVTVAYSYIGPELT..HPMYFEGSIGRAKAHLFQTSKEITEK..Y.SA.DGIK...AYISVNKALVTQSSAAIPIVPLYISILYKVMKEKGVHEGCIGQMYRLFAEKL-g.................................
#=GR R5GY12_9FIRM/84-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q8BRR2_9BURK/82-317              ................................KAGTPGWYNSAAFHKFAEAE..GLYARSINGDAFSDEIKQKTIAAIKADL..G......QVDQVIYSLA.......A..P..RRT..HP.....K.......T......G..Q....VYTSTLK....PIG..K.S......V.T...L...RGL......DT.........D...K...E...LIK.DGVL........EPA......S.......Q.D.EIDATVAVMGGEDWQMWIDALLEAGVLADGATTTAFTYLGEKIT..HDVYWNGSIGAAKKDLDQRVLDIRAK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEDGTHEGCIEQVYGLYRDSL-c.................................
#=GR A0A0Q8BRR2_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M4WJ08_9BACL/82-318              ................................RPATAGWYNSAAFEEAATAD..GYYAKSFNGDAFSNELKEQVIQQIKQDW..G......TVDLVVYSLA.......A..P..KRK..HP.....E.......T......G..E....VFSSVIK....PIG..K.R......F.T...S...KTV......DF.........Q...S...G...VVS.ETSI........EPA......S.......E.E.EIEQTIAVMGGEDWEMWLHALAEADVLAEGAKTVAYSYIGPELT..HDIYRTGTIGKAKDDLEQRGRALNHY..L.QQkCNGR...ALVSVNKAVVTQASAAIPVVPLYISLLYGEMKKQGVHEDCIEQMFRLYQDRLY..................................
#=GR A0A1M4WJ08_9BACL/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A8T2E0_9GAMM/82-317              ................................KPGTAGWYNAAAFDKAAHEA..GLYAKSINGDAFSNEARDKVIELIKEDL..G......EIDLVVYSLA.......S..P..VRK..MP.....E.......S......G..E....VIRSVLK....PIG..E.P......Y.R...S...TAI......DT.........N...R...D...VII.DAEI........EPA......T.......Q.E.EVDQTVTVMGGQDWELWMSALSEAGVLAEGARTVAYSYIGSDIT..WPIYWHGALGKAKEDLDRASQAINSE..L.AK.QGGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMREKGLHEGCMDQIYRMFAERLY..................................
#=GR A0A1A8T2E0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6UHK6_9GAMM/82-318              ................................KPGTAGWYNAAAFDKLAKEA..GLYSKSLNGDAFSHEAKQKTIDLIKEDL..G......QVDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....VVRSVLK....PIG..E.P......Y.R...S...TAI......DT.........N...K...N...VIT.EAEI........EPA......T.......E.E.EVANTVTVMGGEDWELWINALEDAGVLADNCKTVAYSYIGTDIT..WPIYWHGALGKAKQDLDRAADELNNK..L.SAaHNGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMREQGLHEGCMEQVHRLFQTGLY..................................
#=GR A0A1N6UHK6_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7YS95_VIBA7/1-198                   ...............................m--------------------..--------------------IEAIETYF.eG......EVDLVIYSIA.......S..G..MRP..KP.....N.......S......D..Q....YWRSAIK....PIG..E.A......V.S...G...ATI......LL.........E...N...D...TWV.ETTI........APA......N.......D.E.EIESTLKVMGGEDWENWIDTLINTESIAQGCKTIAFSYIGPQIT..HPIYLDGTLGRAKIDLHQTSHSLNLK..L.SN.YGGG...AYATVCKALVTKASVFIPNLSPYIVALYKVMKEKETHEGCIEQMQRLFSEKL-s.................................
#=GR F7YS95_VIBA7/1-198        pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A117RH10_9ACTN/90-325              ................................RSASAGWYRTIATHAIAREL..GADFSFRNADAFADTTKTETLDLLAERF..G......GVDYLIYSVA.......A..P..RRT..DP.....R.......S......G..I....TYQSVLK....PLG..A.P......H.T...T...RNL......EF.........A...DdgaA...YVR.EVTV........APA......T.......E.A.ETAATVRVMGGEDWSRWVTALADRGLLRRGFRTVALSYIGSPLT..SAIYRGGTIGAAKADLESTACALTER..L.AA.VDGR...AFTSVNGAVVSQALTAIPGVPLYVSLLRGVLGDR--FPSPVEQSLELWNQ---lt................................
#=GR A0A117RH10_9ACTN/90-325   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q1ZQS1_PHOAS/82-317                  ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSNEAKQKTIDLIKEDL..G......QVDMVIYSLA.......S..P..VRK..LP.....E.......T......G..E....VIRSCLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EVADTVTVMGGQDWELWIDALSDAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAATELNEK..L.AQ.HGGS...ANVAVLKSVVTQASAAIPVMPLYIAMVFKKMREEGVHEGCMQQILRMFNQRLF..................................
#=GR Q1ZQS1_PHOAS/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H1SUV6_9BACT/82-319              ................................RPATPGWYNSIAFTRAAQAA..GLYAGNINGDAFSDDIKQQAIATIARDM.gG......PIDLVVYSLA.......S..P..RRT..HP.....K.......T......G..A....VHKSVLK....PLG..A.P......Y.T...N...KTV......DP.........D...K...G...IVS.EVTI........EPA......N.......E.A.EAADTVAVMGGEDWEMWIQALADARLLAPGATAVAYSYIGPVHT..WPIYKDGTIGRAKVDLERAARAIDAK..L.KAhGNGR...AFISVNKALVTQASSAIPVVPLYISILYKVMKAAGTHEGCIEQMQRLFATQLY..................................
#=GR A0A1H1SUV6_9BACT/82-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090SP34_9VIBR/1-215               ...............................m--------------------..--YSKSINGDAFSNEAKQKVIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...S...D...KII.EASV........EPA......T.......E.E.EIADTVTVMGGQDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWEGALGKAKMDLDRAATELNAK..L.SE.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGIHEGCMEQIFRMFSQRLY..................................
#=GR A0A090SP34_9VIBR/1-215    pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_BRAHW/82-320                    ................................RTATPGWYNNEAFSAFAKKD..GIEDKNLILDAFLNASKEEVIKEAKTFF.nG.....eKIDLLIYSLA.......A..P..VRM..DE.....S.......T......G..T....LYRSSLK....PIG..K.K......Y.N...G...IGV......DF.........L...T...E...ELL.EVSI........DPA......N.......E.D.DIKSTVKVMGGEDWKLWTDALLNADLLAENAINVAYSYIGPEMT..KAVYREGTIGKAKDHLEATAHELDKE..M.QEkIKGH...AYVSVNKAVVTRSSAVIPTVPLYIGILFKVMKNKGLHEGCIEQMYRLLNEKLY..................................
#=GR FABV_BRAHW/82-320         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_TREDE/87-320                    ................................KYGTPGWYNNLAFDEAAKRE..GLYSVTIDGDAFSDEIKAQVIEEAKKKG..I......KFDLIVYSLA.......S..P..VRT..DP.....D.......T......G..I....MHKSVLK....PFG..K.T......F.T...G...KTV......DP.........F...T...G...ELK.EISA........EPA......N.......D.E.EAAATVKVMGGEDWERWIKQLSKEGLLEEGCITLAYSYIGPEAT..QALYRKGTIGKAKEHLEATAHRLNKE..N.--.PSIR...AFVSVNKGLVTRASAVIPVIPLYLASLFKVMKEKGNHEGCIEQITRLYAERLY..................................
#=GR FABV_TREDE/87-320         SS    ................................S---HHHHHHHHHHHHHHHT..T--EEEEES-TTSHHHHHHHHHHHHHHT..-......-EEEEEE---.......-..S..EEE..-T.....T.......T......S..-....EEE----....BSS..S.-......E.E...E...EEE......ET.........T...T...T...EEE.EEEE........---......-.......H.H.HHHHHHHHHSSHHHHHHHHHHHHTT-EEEEEEEEEEE----GGG..HHHHTSSHHHHHHHHHHHHHHHHHHH..S.--.TTEE...EEEEE------TTGGGSTTHHHHHHHHHHHHHHHT----HHHHHHHHHHHTTS..................................
#=GR FABV_TREDE/87-320         AS    ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A089IMM8_9BACL/81-316              ................................RTASAGWYNSAAFEQQAAEL..GLKSHSIVGDAFSDAIKEKTIALIKAEY..G......TIDLVIYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PVG..T.A......Y.S...N...KTL......NF.........H...T...G...EVT.MTTI........EPA......N.......E.E.EVRQTIAVMGGEDWRMWIDQLQAADVLADGATTVAYSYIGPEIT..HPIYRDGTIGQAKHDLEQTAIQMNDL..L.SS.KGGR...AFVSVNKALVTQSSSAIPVVPLYISALYEVMKEKGLHENCIEQMYRLFSEHLY..................................
#=GR A0A089IMM8_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
S3DJ01_9GAMM/82-318                  ................................KTGTAGFYNAMALDKIANQA..GLYSKSLNGDAFSDSVKKKTIKLIKEDL..G......QIDMLVYSLA.......S..P..IRQ..LP.....E.......T......G..K....IIRSVLK....PIG..K.T......Y.T...S...IAV......DT.........N...K...D...LIV.KANI........QPA......T.......Q.A.EIKDTVTVMGGGDWELWINALLDANVLAKGCKTIAYSYIGTEIT..WPIYWNGTIGKAKKHLEYTASLLNKK..L.STiISGS...ANIVVLKSVITQASSAIPIMPLYISIVFKEMRKKGIHEGCIENIYRLFSQHL-h.................................
#=GR S3DJ01_9GAMM/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5PFN2_9GAMM/82-317              ................................RVGSAGWYNSAAFHQFAEAQ..GLYAKSINGDAFSDEIKQKTIDVIRQDL..G......QVDLVIYSLA.......S..P..RRK..HP.....R.......T......G..V....VYSSTLK....PIG..Q.P......L.T...Q...RAL......DT.........D...K...V...VIK.SVTL........EPA......T.......Q.Q.EIDDTVAVMGGEDWQMWIDALDEAGVLAPGAKTSAFTYVGEQVT..RAIYWNGTIGAAKQDLDKKVLDIRRK..L.AV.GGGD...ARVAVLKAVVTQASSAIPVMPLYLAMLFKVMKQRGTHEGCIEQILSLYRDNLY..................................
#=GR A0A1M5PFN2_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E1VQV7_9GAMM/82-313                  ................................RTATAGWYNAAAFQTAAEAA..GLYSKNINGDAFSHAIKAMAIETIKADL..G......QVDLVVYSLA.......S..P..RRQ..HP.....D.......T......G..T....VYSSTLK....PLG..K.P......F.T...Q...TGL......DT.........D...R...E...LIK.TFTI........EPG......T.......Q.E.DIDNTVAVMGGEDWEMWIKALSEAGVLAKGCKTTAYTYVGEQLT..RDIYWDGTIGAAKKDLDRAAHSLNQK..-.--.-GVD...AAVSVLKAVVTQSSSAIPVMPLYLSLLFRVMKQDGSHEGCIEQIYRLFRECLY..................................
#=GR E1VQV7_9GAMM/82-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q5H6Y9_XANOR/138-374                 ................................KAGTAGWYNSAAFDKHAKAA..GLYSKSINGDAFSDAARAQVIELIKTEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....G.......S......G..E....VKRSALK....PIG..Q.T......Y.T...A...TAI......DT.........N...K...D...TII.QASI........EPA......S.......A.Q.EIEDTITVMGGQDWELWIDALEGAGVLADGARSVAFSYIGTEIT..WPIYWHGALGKAKVDLDRTAQRLNAR..L.AK.HGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLY..................................
#=GR Q5H6Y9_XANOR/138-374      pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F6AHV2_PSEF1/82-319                  ................................KAGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLIVYSLA.......S..P..VRK..LP.....Q.......T......G..E....VVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...VII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALAGANVLAEGARTVAFSYIGTEIT..WPIYWHGALGKAKQDLDETALRLDKK..L.SGeVKGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMFRDRLY..................................
#=GR F6AHV2_PSEF1/82-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U5S9R8_9LACT/83-319                  ...............................n-LGTAGWYNNIAFREAAEKE..GLIAKNFVQDAFSHESKQEVIDYIKNEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....T.......T......G..E....TYTSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...N...Q...SYY.TETL........DPA......T.......D.Q.EIASTVKVMGGEDWELWMKALKEADVLTDGVLTTNYSYLGTELN..HDYYGGGTLGLAKADCDEKTNNINEL..L.AD.INGK...AQIVVATAVTTKASSVIPFFPVYCIGLYKVMADKGTHETPIMHQDRIYREMIY..................................
#=GR U5S9R8_9LACT/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A1ZZQ0_9BACT/81-316                  ................................KTASAGWYNSAAFEKQAQAA..GLYAKSINGDAFSKEIKQQTLDLIKADL..G......QVDLVVYSLA.......S..P..VRT..HP.....E.......T......G..V....KHRSSLK....PIG..Q.S......F.A...D...KTV......DF.........H...T...G...VVS.EVAI........EPA......N.......E.D.DIANTVAVMGGEDWEMWMDALQKENLLASGATAVAYSYIGPKLT..EPVYRKGTIGRAKDHLEATAFTIADK..L.KA.IDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAENIHEGCIEQMHRLFKDRLY..................................
#=GR A1ZZQ0_9BACT/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q7TEX5_9CAUL/81-313              ................................RTASAGWYNNRSFEVLARGR..GLVAATLEGDAFSDEVKAQTVDLIVRDF..G......QVDLLVYSLA.......A..P..SRR..DP.....R.......T......G..L....THYSSIL....PLR..P.C......S.D...L...KAL......DV.........D...T...G...AIT.VASL........PAA......T.......Q.V.QLDDTVAVMGGGDWSRWVETLAAHDLLSPGCRTLHYTYVGSPPT..APIYADGTIGRAKADTALAARRMNDV..L.G-.-EGF...ARLVALKAIVTQASSAIPLMPLYWSLLAPVMTRLGLQEGALEQILRLFEQV--i.................................
#=GR A0A0Q7TEX5_9CAUL/81-313   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A8UAA6_9LACT/83-319                  ...............................n-LGTAGWYNNIAFREAAEDE..GLIAKNFVQDAFSHESKQEVIDYIKNEF.gG......KVDLVVYSLA.......S..G..RRT..DP.....D.......T......G..E....TYTSSIK....AIG..E.P......V.V...G...PNI......NM.........Q...N...Q...SYY.TETL........DPA......T.......D.Q.EIVNTVKVMGGEDWELWLKALKEADVLTDGVLTTNYSYLGTELN..HDYYGGGTLGLAKADCDEKTENINAL..L.AD.INGK...AQIVVATAVTTKASSVIPFFPVYCIGLYKVMAEKGTHETPIMHQDRIYREMIY..................................
#=GR A8UAA6_9LACT/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q4MTJ6_9GAMM/82-318              ................................KPATAGWYNSAAFEEFATEK..GLYAKSINGDAYSDAVKQKTIELIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....V.......T......G..E....VFNSTLK....PIG..K.P......L.V...T...RGL......NT.........D...K...E...TIT.EVAL........EPA......N.......A.E.EIAGTVAVMGGEDWQMWIDALLEAGVLAEGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKRVLTIRDT..L.AAhGNGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKDSLY..................................
#=GR A0A0Q4MTJ6_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0R1GK96_9LACO/91-281              ................................KLGSAGWYNNIYFRQEAEKK..GLIAKNFIGDAFSNAMKEQVIDYIKTEF.gG......KIDLLVYSLA.......S..P..KRI..DP.....N.......E......P..E...kVYTSVIK....PIG..Q.S......V.S...G...KNI......NL.........E...T...E...TLD.DVTI........EPA......N.......D.Q.EIADTIKVMGGEDWEFWIDALKAADVLANGFKTTLYSYIGTDVT..DAFYHSGTLGQAKTDAEKHAHAIQNK..I.NR.----...-----------------------------------------------------afynqvsqil........................
#=GR A0A0R1GK96_9LACO/91-281   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E1SQ23_FERBD/82-317                  ................................KPGTAGWYNAAAFDKAAHEA..GLYAKSINGDAFSHDAKRKAIELIKADL..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LVRSSLK....PMG..Q.T......Y.T...A...TAV......DT.........N...K...D...TLF.EASI........EPA......T.......E.Q.EVQDTVTVMGGQDWELWVQALSEAGVLAEGCRTVAYSYIGTEIT..WPIYWDGALGEAKKDLDRAAAALNAQ..L.SA.IGGG...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCIEQIYRMFNERLY..................................
#=GR E1SQ23_FERBD/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A125XZB7_AERCA/82-317              ................................KTGSAGWYNSAAFDKAAKEA..GLYAKSINGDAFSHECRAKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...S...TAI......DT.........N...K...D...QII.TATV........EPA......N.......E.E.EIQSTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVDRMMRTRLY..................................
#=GR A0A125XZB7_AERCA/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R0WWH7_9BACL/81-316              ................................RTASAGWYNSAAFEQQAAQL..GLKSHSIVGDAFSDAIKEKTIELIKAEY..G......SVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....TFSSVIK....PVG..T.A......Y.T...N...KTL......NF.........H...T...G...EVS.MTTI........EPA......S.......E.E.EVRQTIAVMGGEDWRMWIDQLQAAGVLADGATTVAYSYIGPEIT..HPIYRDGTIGQAKHDLEQTAIQLNDR..L.ST.QGGR...AFVSVNKALVTQSSSAIPVVPLYISALYEVMKEKGLHENCIEQMYRLFSEHLY..................................
#=GR A0A1R0WWH7_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F9R803_VIBSN/82-317                  ................................KPGTAGFYNSAAFEKLAREA..GLYAKSLNGDAFSNEAKQKTIDLIKEDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....VIRSALK....PIG..Q.T......Y.T...S...TAV......DT.........N...K...D...MII.EASV........EPA......T.......E.Q.EIQDTVTVMGGEDWELWINALSDAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAAAELNTK..L.AA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREQGVHEGCMEQIYRMFSQRLY..................................
#=GR F9R803_VIBSN/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A235E099_9SPHI/82-318              ................................KLGTAGWYNSAAFEKEAHSA..GLYAKSINGDAFSDEIKAQTIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....QHSSVLK....PIE..Q.P......F.T...N...KTV......DF.........H...T...G...VVS.DISI........QPV......D......sA.D.DINNTVAVMGGEDWKFWIEDLKEAGVLAEGVKTVAYSYIGPELT..YPIYRNGTIGRAKDDLEATVPAINEL..L.KD.LHGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFAERLY..................................
#=GR A0A235E099_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M6PP81_9BACT/82-318              ................................RTGSAGWYNSAAFEKAATAE..GLFAKSLNGDAFSHEMKAQAVDIIKNEM.gG......KIDLVVYSLA.......S..P..RRT..DP.....D.......T......G..E....VYKSVLK....TTG..G.D......Y.T...N...KTL......NT.........D...K...G...EVE.EVTI........GAA......T.......P.E.EIEHTIKVMGGEDWELWMNALSDAGVLADGVKTVAYSYIGPELT..WPIYTDGTIGQAKKDLEKSCAQLNEK..L.SS.LNGE...AYVSVNKALVTQASSAIPVVPLYISILYKEMKEKGLHEGCIEQIERLFADRLY..................................
#=GR A0A1M6PP81_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A261SGW7_9BORD/82-317              ................................KPGTAGWYNTAAFHDVAEAE..GLYARSINGDAFSDEIKAQTIDAIKADL..G......KVDLVIYSLA.......A..P..RRT..HP.....K.......T......G..V....VYNSTLK....PIG..K.E......L.K...M...RGL......DT.........D...K...E...VIK.ETVL........PPA......T.......Q.Q.EIDDTVAVMGGEDWQMWIDALADAGVLAPGAKTTAFTYLGDTIT..QDIYWNGTIGAAKKDLDKKVLDIRAK..L.AA.TGGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKIMKEKGTHEGCIEQLYHLFQDGLY..................................
#=GR A0A261SGW7_9BORD/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R7IT06_9FIRM/81-315                  ................................RTATPGYYNTKAFEEFAEKE..GLYAHSINGDAFSKEIKDQVIETIRNDL..G......TVDLVVYSLA.......A..P..RRT..MA.....D.......-......G..T....VYQSVLK....TTG..E.I......Y.K...Q...KSL......NL.........R...D...N...TIT.EAVI........EPA......T.......P.E.EIFATEKVMGGEDWYDWMNALENAGVLSKDAVTVAYSYIGPELT..YPIYYNGTIGAAKKNLHGYAEKINEE..L.GQ.KGVK...AFISVNKGLVTQASSAIPVVPLYFTILYKVMKKKGIHEGCIEQMGRLFKDKLF..................................
#=GR R7IT06_9FIRM/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A285IYK0_9GAMM/82-317              ................................KTGSAGWYNTAAFEQAAGAE..GLWNKHLNGDAFTDELKAEAINLIRSEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......S......G..E....VYSSVLK....PIG..Q.A......Y.T...A...KNL......NT.........T...K...R...EIE.EVSV........EPA......N.......D.D.EIFNTVKVMGGEDWERWLDQLHAAGVLAENCQTVAYTYIGKKLT..WPIYGKATIGRAKEDLDRAAGAIRSK..L.SD.VKAK...AYVASLKALVTQASSAIPIMPLYISLLYRVMKEQGSHEGCIEQINGLFRQGLY..................................
#=GR A0A285IYK0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q5MSR7_9ACTN/84-320              ................................RTGTAGWYRTAVTARLAREH..GRDMVFVNGDAFGDAVKEQVADLLTERF.gG......RLDFLVYSVA.......A..P..RRT..DP.....D.......T......G..E....VYASVLR....PIG..S.P......H.T...T...KTLl...fdEH.........G...A...P...EVK.EVTT........APA......E.......G.D.DIEQTVAVMGGTDWERWITFLAGRSLLADGFTTAALSYIGSPLT..AAIYRQGTIGVAKSHLEATARTLDER..L.GKtLGGR...ALTSVNAAAVTQSSTAIPGIALYAGLLRGVLG--GAMVAPIGQLVDLW-----drl...............................
#=GR A0A1Q5MSR7_9ACTN/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I2QU01_9GAMM/82-317              ................................KTGTAGWYNAAAFQQQAHEA..GLYAKSINGDAFSHEAKQKAIELIKADL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....VVRSVLK....PIG..Q.P......Y.H...S...TAI......DT.........N...K...D...VII.NAEI........EPA......N.......D.E.EIANTVTVMGGEDWELWIHALNDAGVLAEGCKTVAYSYIGTEIT..WPIYWDGALGKAKQDLDRAAGELNAL..L.AV.NGGQ...ANVGVLKSVVTQASSAIPVMPLYLSMVFKIMKAKGIHEGCMEQIDRLFRTGLY..................................
#=GR A0A1I2QU01_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F7HGF2_SERFO/82-317              ................................KTATAGWYNSAAFDKAAKEA..GLYAKSVNGDAFSNECRAKVIELIKADL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QII.TATV........EPA......S.......E.E.EIQNTITVMGGQDWELWMSALEEAGVLAEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVSRLMHTRLY..................................
#=GR A0A0F7HGF2_SERFO/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W6TS21_9SPHI/96-332                  ................................KTASPGWYNTAAFEEQAQKA..GLYAKSVNGDAFSTEIKQKVIDLIKADL..G......QIDLVVYSLA.......S..P..KRI..HP.....V.......T......G..V....VHNSVLK....PIG.gT.T......F.T...N...KTV......DF.........H...T...G...IVS.EVSI........APA......N.......E.E.EIENTVAVMGGEDWGMWIDELKAANLLAPEAITVAYSYIGPAVT..EAVYRKGTIGRAKDHLEATAFAISDK..L.KD.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKENGTHEGCIEQMQRLFAERLY..................................
#=GR W6TS21_9SPHI/96-332       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_OPITP/82-317                    ................................RLATPGWYNSIGFTRAARAA..GLYARNFNGDAFSDDIKKQVLDAIKADL..G......QVDLVIYSLA.......S..P..RRT..HP.....R.......T......G..T....VHKSVLK....PVG..A.P......Y.T...N...KTV......DT.........D...T...G...IVS.EITI........EPA......T.......E.T.EIADTIAVMGGEDWELWMHALRDANLLAPNAQTVAYSYIGPEVT..WPVYKNGTIGLAKNDLERAAQALDAL..L.KP.TGGR...AFIAVNKALVTQASSAIPVVPLYISILYKIMKARGTHERCIEQMQRLFATHMY..................................
#=GR FABV_OPITP/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q9E469_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEIKKETLDLIKADL..G......QVDLIIYSLA.......S..P..VRT..NP.....T.......T......G..V....THRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...KVS.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWIDALKNENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTIGDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A0Q9E469_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D4YHU2_9LACT/84-320                  ..............................nl--GKPGWYNNIFFRQAAEAE..GLIAKNIMADAFSNEAKDQVIDFIKNEF.gG......KVDFVVYSLA.......S..G..RRT..DP.....N.......T......G..E....TYNSVIK....SIG..Q.E......V.V...G...PNV......NL.........Q...K...E...TFF.EQVL........EPA......T.......E.A.EIEDTVKVMGGEDWRMWMNALQEADVLAEGVETVVYSYLGAELN..ESYYNKGTLGRAKADCDKAAALINED..L.KD.INGK...ATVVVATAVTTKASSVIPFFPVYCLGLFKVMEARGQHETPIMHIDRIFRDMLF..................................
#=GR D4YHU2_9LACT/84-320       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5JXN3_9FIRM/81-313                  ................................RTASAGFYNTRAFEEQAHKD..GLYAKSINGDAFSVEIKEQVINTIKEDL..G......KVDMIVYSLA.......A..P..RRT..MP.....D.......-......G..T....RYTSVLK....TVG..E.E......Y.S...N...KTL......VL.........K...D...N...TIT.EAHI........SSA......T.......E.E.EINATIKVMGGEDWIDWMKALNDAGVLADKVITVAYSYIGPKIT..FPIYAEGSIGQAKKDLYKSCDIINER..W.P-.-QIK...AKVAINKALVTQSSAAIPIVPLYITLLYKVMKDKGLHEGCIEQMQRLFMDKI-l.................................
#=GR R5JXN3_9FIRM/81-313       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y0FUK5_9GAMM/82-317              ................................KTATAGYYNTAAFHDAAEAA..GLYAKTINGDAFSDACKAQVIEELTHGI..G......KVDLVIYSLA.......A..P..RRT..DP.....K.......T......G..E....VYNSVLK....PIG..Q.T......Y.V...S...KGL......NT.........D...T...L...KIM.EMSI........EPA......S.......D.E.EIAQTVKVMGGEDWEMWIDALKSANLLAEGCQTVAYTYLGDKLT..WPIYGRATIGKAKEDLDRAAKALDSK..L.AD.LNGQ...ARVAVLKAVVTQASSAIPVMPLYLSILFKVMKEDGTHEGCIEQIQRLFKECLY..................................
#=GR A0A1Y0FUK5_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7T721_9BURK/82-317                  ................................KAGTPGWYNSAAFDKFASAE..GLYAKSINGDAFSDAIKAQTIAAIKQDL..G......QVDQVIYSLA.......A..P..RRT..HP.....V.......S......G..T....VFNSTLK....PVG..Q.A......V.T...L...RGL......DT.........D...K...E...VIK.ESVL........EPA......T.......Q.D.EIDATVAVMGGEDWQMWIDALLEAGVLAEGATTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLDIRAK..L.AA.RGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKQHGTHEGCIEQVYGLYRDSL-c.................................
#=GR F7T721_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H8MW82_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEVKQQTLDLIKADL..G......QVDLVIYSLA.......S..P..VRM..HP.....L.......T......G..V....LHRSVLK....PIG..S.T......F.T...N...KTV......DF.........H...S...G...KVS.EISI........EPC......S.......G.D.DIENTIAVMGGEDWAMWIDALKAQNLLAPSATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFAITDS..L.AA.INGK...AFVSVNKALVTQASSAIPVIPLYISLLYRIMKEEGIHEGCIEQIQRLYQERLY..................................
#=GR A0A1H8MW82_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1C3EM69_9GAMM/82-317              ................................KPGAAGWYNTAAFDKFAKEE..GLYSKSLNGDAFSNEAKQKTIDLIKADL..G......QIDLVVYSLA.......S..P..VRK..LP.....S.......T......G..E....LVRSCLK....PIG..E.T......Y.H...A...TAV......DT.........N...K...D...QII.EASV........EPA......T.......E.E.EIQNTVTVMGGEDWELWINALNDAGVLAEGAKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAQALNET..L.SA.KGGT...ANVAVLKSVITQASSAIPVMPLYIAMVFKKMREEGLHEGCIEQIYRMLSQRLY..................................
#=GR A0A1C3EM69_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A127QZZ8_9BURK/82-317              ................................KPGTPGWYNSAAFHQFAGAK..GLYAKSINGDGFSDAIKQQTIDAIKQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......S......G..E....VFNSTLK....PVG..K.A......I.S...F...RGL......DT.........D...K...E...VMK.ESTL........EPA......T.......Q.E.EIDNTVAVMGGEDWQMWIAALQAAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLDIRSS..L.AA.SGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQLYALYNDSLY..................................
#=GR A0A127QZZ8_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A066Z6B2_9ACTN/84-319              ................................RTGTAGWYRTAATAELAAGT..DTDFVFVNADAFSSNAKEQALDLIAERF..G......PVDHLIYSLA.......A..P..RRT..DP.....V.......T......G..E....VHHSVIK....PIG..E.P......Y.E...A...ASL......VF.........P...Dg.vA...TVG.TVQL........TPA......N.......E.A.EQRATMQVMGGADWQLWVEALAARGLLGDGFTTVALSYVGSDIT..APVYRQGTIGAAKEHLEATARTLADG..VlAD.GAGR...AFTVVAGAAVTQASTAIPSIALYTSLLHNVLGGEGWHTTA-DQAIDL------wsql..............................
#=GR A0A066Z6B2_9ACTN/84-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F6AHS4_9GAMM/82-317              ................................KTASAGWYNTAAFQNAADKA..GLWSKNINGDAFSTELKEKAIEAIKADM..G......KVDLIIYSLA.......S..P..RRT..DP.....K.......T......G..E....THSSVLK....PIG..E.A......I.T...T...KNL......NT.........S...K...R...VID.EVSV........EAA......N.......E.D.EIANTVKVMGGEDWELWLDALKQADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAAAAIKAS..T.AA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVTKEDGTYEGTIEQIHGLFNESLY..................................
#=GR A0A0F6AHS4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A163X6V9_9FLAO/82-318              ................................RPGTAGWYNSAAFEEQANAA..GIYAKSINGDAFSDEIKKETIELIKKDL..G......QIDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..Q.P......F.T...N...KTV......DF.........H...T...G...VVS.QISI........DPV......S......eQ.S.DIDNTIAVMGGEDWKFWIEDLKAAGVLADGAKTVAYSYIGPELT..YPIYRNGTIGMAKNDLEATVPVINDM..L.KD.INGV...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKNIHEGCIEQMQRLFADRLY..................................
#=GR A0A163X6V9_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5RSG6_9ALTE/82-317              ................................KTGTAGWYNTAAFHHKAKAA..DLYAETLNGDAFSAAMKQEVIDKIKADL..G......QVDLVIYSLA.......A..P..RRT..DP.....V.......T......G..E....VYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...LVH.DVSL........EPA......N.......D.D.EIFNTVKVMGGEDWELWLDALSEAGVLAEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAASAINDK..L.SA.LSVD...AHVSSLKALVTQASSAIPVMPLYISLLYRVMKNEGTHEGCIEQIAGLYKDCLY..................................
#=GR A0A1M5RSG6_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C5WSS4_9GAMM/82-317              ................................KPGTAGWYNSAAFDKFAKEE..GLYSKSLNGDAFSHEAKQKVIDLIKEDL..G......QVDMVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSTLK....PMG..E.T......Y.T...A...TAV......DT.........N...K...D...VLI.EASI........EPA......T.......E.Q.EVADTVTVMGGQDWELWINALSEAGVLADGCKTVAYSYIGTEIT..WPIYWHGALGQAKMDLDRAATELNEK..L.VA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIHRMFTQRLF..................................
#=GR A0A0C5WSS4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F2LQY7_BURGS/82-317                  ................................KPGTAGWYNSAAFEKFAKAE..GRYARTINGDAFSDEVKRITIDTIKADL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....VHNSTLK....PLG..K.S......V.A...F...RGL......DT.........D...K...E...VIK.DTVL........EPA......S.......Q.E.EIDNTVAVMGGEDWQMWIDALNQAGVLAPGAKTTAFTYLGEQIT..HDIYWNGSIGAAKKDLDKTVIGLRET..L.SA.TGGD...ARVAVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLLHDTMY..................................
#=GR F2LQY7_BURGS/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6GLG0_9BRAD/82-314              ................................RTGSAGWYNNRAFELEAEKI..GRSPLTLEGDAFSNDLKKTFIDRVREKF..G......QLDMLIYSMA.......A..P..VRT..DP.....D.......T......G..K....TYRSAIK....PLG..A.P......V.D...I...KTL......NT.........E...T...G...EVF.ETTI........APA......S.......E.D.EATATVAVMGGDDWKRWIDQLADAGVLAPGFRTLNYTYIGSELT..WPIYWKGTLGRAKVDLDRKAEEIRGR..L.GQ.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLQLHEGCIEQIDRLFRTRL-..................................
#=GR A0A1N6GLG0_9BRAD/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6Q4N0_9SPHI/82-318              ................................KPGTAGWYNSAAFEKEAQAA..GLYAKSINGDAFSDEVKQQTIDLIKQDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AHASVLK....PID..Q.P......F.T...D...KTV......DF.........H...S...G...VVS.DISI........QPV.....eN.......P.S.DIENTVAVMGGEDWKFWIEELKAAGVLAEGVKTVAYSYIGPELT..YPIYRNGTIGRAKDDLEGTVSVLNDL..L.KD.LNGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFADRLY..................................
#=GR A0A1I6Q4N0_9SPHI/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A6AVJ7_9ALTE/82-317              ................................KTATAGWYNTAAFHAQAKQN..NLYAETINGDAFSDEVKEEVIAKIKADL..G......KIDLVIYSLA.......S..P..RRT..DP.....V.......S......G..V....TYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...QVH.EIKL........EPA......N.......D.D.EIHNTIKVMGGEDWERWLDAMAAADVLAEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAINGK..H.SS.LLAD...AHVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIFGLFSDCLY..................................
#=GR A0A2A6AVJ7_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A2M272_9FLAO/81-316              ................................KTASPGWYNSAAFEEEAHKA..GLYAKSINGDAFSKEIKQQTLDLIKADL..G......QVDLVIYSLA.......S..P..VRQ..HP.....E.......T......G..V....LHRSVLK....PIG..G.V......F.T...N...KTV......DF.........H...T...G...KVS.DISI........QPA......V.......E.G.DIENTVAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFEITDS..L.KD.IDGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGVHEGTIEQIQRLYSERLY..................................
#=GR A0A0A2M272_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A0X4T1_9SPIO/86-321              ................................KWGTPGWYNNLTVDTAAKEA..GLVSVTIDGDAFSDTIKEQVIDEAKKRG..M......KFDLIVYSVA.......S..S..VRT..DP.....D.......T......G..V....TYRSALK....PFG..K.P......F.T...G...KTL......DP.........F...T...G...ALT.EITA........EPA......S.......D.E.EAFATVKVMGGEDWQRWIEKLGAADLLAQGCITVAYSYIGPEAT..QALYRKGTIGKAKEHLEATAHTLNTK..L.AA.LKGQ...AFVSVNKGLVTRASAVIPVIPLYLASLFKVMKEKGTHEGCIEQINRLFDSRLY..................................
#=GR A0A0A0X4T1_9SPIO/86-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0Q7GMU0_9FLAO/81-316              ................................KTASPGWYNSAAFEAEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QVDLIIYSLA.......S..P..VRT..NP.....N.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWAMWMDALKNENLLAEGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KS.IGGQ...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A0Q7GMU0_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
D4E644_SEROD/82-317                  ................................KPATAGWYNSAAFDKAAKEE..GLYAKSVNGDAFSNECRAKVIELIKQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....VVRSALK....PIG..E.V......Y.T...T...TAI......DT.........N...K...D...QIV.TATV........EPA......N.......E.E.EIQNTITVMGGQDWELWMSALEEANVLSEGAKSVAYSYIGTDLT..WPIYWHGTLGRAKEDLDRAATAIRGD..L.AA.KGGT...AHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGIHEGCMEQVYRMMRTRLY..................................
#=GR D4E644_SEROD/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A089K0J7_9BACL/81-316              ................................RTASAGWYNSAAFEEMAYTA..GLRSYSVCGDAFTAETKERTIELIRSEL..G......QVDLVIYSVA.......S..A..RRT..DP.....Q.......T......G..A....VHHSVLK....PIG..S.T......Y.I...N...TTV......NF.........H...T...G...ELS.TVQI........EPA......T.......E.A.EIDDTVHVMGGEDWQLWIEALRNSGALAADAVTFAFSYIGSELT..QAVYRDGTIGRAKDHLEATALELNAQ..L.SP.GGGR...AYIAVSKGLVTQSSSAIPVVPLYISVLYKVMKEQGLHEGCIEQAYRLYTGFLY..................................
#=GR A0A089K0J7_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C4YNE6_9BURK/82-317              ................................KPGTAGWYNTAAFHKAAAAE..GRYAMSINGDGFSDEIKQQTIDIIKRDL..G......QVDLVVYSLA.......A..P..RRK..HP.....K.......T......G..E....IFTSTLK....PIG..K.E......I.R...Q...RGL......DT.........D...K...E...VIK.EINL........QPA......T.......Q.E.EIDHTVAVMGGEDWQMWIDALLAAGVLADNAKTTAFTYLGEKVT..HDIYWNGSIGAAKKDLDQKVLDLRGK..L.AA.TGGD...ARVAVLKAVVTQASSAIPVMPLYLSLLFKVMKETGTHEGCIEQVYSLYQDCLY..................................
#=GR A0A0C4YNE6_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q2M7C0_9GAMM/82-314              ................................RTGSAGYYNSAAFEDEAHKA..GLYAKSINGDAFSDEIKAQAIDMIKQDL..G......KIDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....LYSSVLK....PIG..E.S......Y.T...A...KNL......NT.........D...K...L...EIS.DISV........DPA......N.......E.E.EIAATVKVMGGEDWELWMQALGEAGVLTDDCKTVAYTYIGEKLT..WPIYGHATIGKAKEDLDRAAKAISDS..G.--.-NAS...ANVAVLKALVTQSSSAIPVMPLYISLVYKVMKEEGTHEGCIEQLYRLYTEGLY..................................
#=GR A0A1Q2M7C0_9GAMM/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0S2JCL8_9GAMM/82-317              ................................KTASAGWYNTVAFQKAADAA..GIYSKNINGDAFSHEIKAKAIAAIKADM..G......KVDLVVYSLA.......S..P..RRT..DP.....D.......T......G..E....VYVSTLK....PIG..Q.S......V.T...T...KNL......NT.........S...K...R...TID.EISV........EAA......N.......E.A.EIQGTIDVMGGADWELWMNALADAGVLAEGVKTVAYTYIGKELT..WPIYGKATIGKAKEDLDRAATAINAA..T.AD.LNGK...ARVTSLNAVVTQASSAIPIMPLYISAMFKVMKADGTYEGCIEQISNLFKENIY..................................
#=GR A0A0S2JCL8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1C5CHF1_9ACTN/81-316              ................................RTGTAGWYNAAAVEEELTTA..GLPGRTVVGDAFDDGVKERTARLVAEEF..G......GVDLVVHSLA.......A..P..RRT..DP.....V.......T......G..R....THRSVIR....TIG..D.P......F.T...E...KAF......DA.........S...T...G...SVR.ELTT........PAA......T.......S.E.EAADTVRVMGGDDWARWIDVLDRHGALRQGVRTVAFSYIGTPWL..APTYRDGTLGRAKQHLEDTARSLDRR..L.AA.DGGR...AQAAVMRALVTPASQVMPVQALYTLLLTRVTREAGLAEDTGDQARRLLDH---lfh...............................
#=GR A0A1C5CHF1_9ACTN/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A059W1M0_STRA9/87-323              ................................RTATAGWYRTAATAELAREA..GRDMVFLNGDAFSDALKEQVADLVAERF.gG......KLDHLIYSVA.......A..P..RRT..DP.....E.......T......G..T....TYASVLQ....PIG..A.P......S.R...T...RTL......VF.........DgegA...P...EVK.EVET........VPA......T.......E.E.DIAQTVAVMGGADWERWIDHLAGRGLLAEGFSTAALSYIGSSLT..EAIYRKGTIGAAKAHLEGTARTLDKR..L.SDlVGGR...AVTSVNGAAVTQSSTAIPGIALYVGLLRGVLGEQVV--SPTAQLSELW-----dql...............................
#=GR A0A059W1M0_STRA9/87-323   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A166WIE8_9GAMM/82-317              ................................KAGTAGWHNSAAFDKLAHEA..GLYSKSLNGDAFSHEAKAKTIELIKDDL..G......QVDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VIRSALK....PMG..D.V......Y.K...A...TAV......DT.........N...K...D...TLF.EAEV........EPA......S.......E.Q.EIADTVTVMGGQDWELWMSALAEAGVLADGCKTVAYSYIGTEIT..WPIYWNGALGEAKKDLDRAAQAIDIE..M.KK.IGGS...SNVAVLKSVVTQASSAIPVMPLYIAMSFKKMRELDIHEGCIEQINRMFRERLF..................................
#=GR A0A166WIE8_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A7TAP6_NEMVE/81-261                  ................................RPASPGYYNTAAFEKHAHAA..GLYAKSINGDAFSNEIKEQVINLIKEDL..G......QVDLVIYSLA.......S..P..VRT..HP.....E.......T......G..K....RYKSVLK....PIG..E.V......F.S...N...KTV......DF.........H...T...G...NVS.EISI........NPA......E.......G.D.DIENTVTVMGGEDWKLWMDALKDADVLADGVTTVAYSYIGPEVT..KPVYRNGTIGAAKDHLEATAFTIADD..L.KS.----...-----------------------------------------------------mg................................
#=GR A7TAP6_NEMVE/81-261       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U1JY09_9GAMM/82-317                  ................................KTGSAGWYNTAAFQNAADEA..GLWSKNINGDAFSNEIKQKAIDTIKADL..G......KVDLVIYSLA.......S..P..RRT..DP.....N.......T......G..E....VYSSTLK....PIG..N.A......V.T...T...KNL......NT.........S...K...R...EID.EITV........EAA......T.......Q.D.DIDNTIKVMGGEDWEMWINALQDADVLADDFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRATVAIKES..T.KA.LNGQ...AYVSSLNAVVTQASSAIPIMPLYISALFKVMKADGTYEGTIEQIHGLFTENLY..................................
#=GR U1JY09_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1I6JY26_9FIRM/81-315              ................................RTATPGWYNTAALESMASAE..GLYARTINNDAFAPNVKQEAIDIIRKDL..G......QVDMVIYSIA.......A..P..RRT..AP.....D.......-......G..V....TYHSTLK....TTS..E.S......Y.T...N...KSW......NL.........V...D...D...TIY.QVTI........NPA......S.......E.E.EVLATQKVMGGEDWKDWITALSSAGVLAPGALTIAYSYIGPEVT..HPIYFNGTIGMAKRHLHKTAEEITKE..F.QE.TGIQ...AYVSVNKALVTQASSAIPIVPLYIALLYKVMKAKGLHEGCIEQMQRMFQEKIF..................................
#=GR A0A1I6JY26_9FIRM/81-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2FLX9_9BURK/82-317                  ................................KPGTAGWYNSAAFEKFAAEK..GVYARSINGDAFSDKVKQVTIDTIKQDL..G......KVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....TISSTLK....PIG..K.T......V.T...F...RGL......DT.........D...K...E...VIR.DVTL........EPA......T.......Q.E.EIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQIT..HDIYWNGSIGEAKKDLDKKVLSIRDK..L.AA.HGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKTMKETGTHEGCIEQVYGLFKDSLY..................................
#=GR U2FLX9_9BURK/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A081NH23_9GAMM/82-317              ................................KPGTAGWHNSAAFEKLAHEE..GLYAKSLNGDAFSHEAKAKTIELIKEDL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VIRSVLK....PMG..Q.H......Y.K...A...TAV......DT.........N...K...D...ELF.EASV........EPA......T.......E.E.EVSATVTVMGGEDWELWMNALSEAGVLAENCKTVAYSYIGTEIT..WPIYWEGALGQAKKDLDRAAHAIDEQ..V.KS.LNGS...ANIAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCIEQINRMFRERLY..................................
#=GR A0A081NH23_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2I9E332_9FLAO/81-316              ................................RPASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEIKKQTLDLIKADL..G......QIDMVIYSLA.......S..P..VRT..HP.....D.......T......G..V....KYKSVLK....PIG..A.K......F.Q...N...KTV......DF.........H...T...G...VIS.EVSI........EPA......Q.......G.D.DIENTVAVMGGEDWKMWIDDLKSEGLLSEGFTTIAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFTISDS..L.KP.LNGK...AYVSVNKALVTQASSAIPVIPLYISLLYKVMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A2I9E332_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R9PGA1_AGAAL/81-316                  ..............................gl--GSAGWYNNIFCKELAEKQ..GLLVKNFIGDAFDPAMRSQVIEYIKQEF.gG......KADLVIYSLA.......T..G..KRK..TE.....S.......-......-..G....QWHSVLK....TTD..A.P......L.H...G...LSI......NL.........E...T...E...QLE.PQTV........ELA......N.......A.A.EVEATTKVMGGDEWRNWIDALQQADVLAQGCNTIAYSYVGPERT..AAIYRDGTIGRAKQHLHVTAQELDKQ..L.QTqVGGH...AYACVCKALVTKASVYIPVMSPYISLLYKVMKEQGSHEECIEQAYRLFSQHLY..................................
#=GR R9PGA1_AGAAL/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A9EW60_9GAMM/82-317              ................................KTGTAGWYNSAAFEQEAHAA..GLYAKSLNGDAFSHDAKQKVVELIQQDL..G......QIDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....VVRSVLK....PIG..E.T......Y.R...S...TAI......DT.........N...R...D...CII.EAEV........EPA......T.......E.E.EVANTVTVMGGEDWELWLHALSDAGVLAEGCKSVAYSYIGTDIT..WPIYWDGALGKAKQDLDRAATALNGL..L.AA.KGGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFRIMKAHGVHEGCMEQVARLFTTGL-c.................................
#=GR A0A1A9EW60_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0J1GH90_9GAMM/88-324              ...............................g-VGTAGWYNNIYFRQEAEQA..GRVAKNIVGDAFSPAVREQVVQAIRDDL.gG......QVDLVVYSLA.......T..G..VRP..DP.....Q.......T......G..E....MWRSVIK....TTD..E.A......F.S...G...PTL......NL.........E...T...D...TLE.TMTV........EAA......T.......D.E.EIIATEKVMGGEDWAEWIATLHDAGVLATGCRTVAYSYIGPAIT..YPLYHHGTLGRAKQHLHVTADALNHQ..L.QA.LGGQ...AHVAVCKALVTKASAFIPAFSPYMLALFKVMKAQGTHEGCIEQMQRLFGERFF..................................
#=GR A0A0J1GH90_9GAMM/88-324   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1J0THF6_9ALTE/82-317              ................................KTGTAGWYNTAAFHRKAEAK..GLFADTINGDAFSDEIKQQTIEKIKAGM..G......KVDLVIYSLA.......S..P..RRT..DP.....D.......T......G..V....TYKSTLK....PVG..Q.A......Y.T...T...KTY......DT.........D...K...D...KVH.EVAL........EPA......N.......D.E.EILHTIKVMGGEDWERWMDFLRDADVLSEGCKTTAYTYIGKELT..WPIYGQATIGKAKEDLDRAAAAIIGK..N.SD.LFVQ...ANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGTHEGCIEQIHGLFTQCLF..................................
#=GR A0A1J0THF6_9ALTE/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
G2NJF4_STREK/90-325                  ................................RSASAGWYRTIATHAIARGL..GADFSFLNADAFADTTKAETLDLLAERF..G......GVDYLIYSVA.......A..P..RRT..DP.....R.......S......G..A....AYRSVLK....PLG..A.P......H.V...T...RNLe...faDD.........G...T...A...YVR.EVTV........ASA......T.......E.A.ETEATVKVMGGEDWSRWVTGLAERGLLRSGFRTVALSYIGSPLT..SAIYRGGTIGAAKADLESTAGVLTGR..L.AA.VDGR...AFTSVNGALVSQALTAIPGIPLYVGLLRGVLGDR--FPSPVEQSLELWRQ---lt................................
#=GR G2NJF4_STREK/90-325       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B9DW62_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKRQTLDLIKADL..G......QIDLIIYSLA.......S..P..VRQ..HP.....V.......T......G..V....LHRSVLK....PIG..Q.T......F.T...N...KTV......DF.........H...T...G...NVT.EVSI........APA......N.......E.E.DIENTVAVMGGEDWTMWIDALKAENLLADGATTVAYSYIGPSLT..EAVYRKGTIGRAKDDLEATAFSITDS..L.KS.IGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLFQDRLY..................................
#=GR A0A1B9DW62_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B1VE91_9VIBR/83-319              ...............................s-VGSAGYFNNAFFKKHAQKE..GRLAINIQCDAFSAQTKSEVVEAIETYF.eG......EVDLVIYSVA.......S..G..MRL..KP.....D.......C......Q..D....VWRSTIK....PIG..Q.S......V.S...G...ASI......SL.........E...H...D...QWI.ETTL........TSA......T.......E.E.EAESTRKVMGGEDWEMWIDTLINSESIAQGCKTIAFSYIGPKAT..HPIYLDGTLGRAKIDLHQTSHSLNLK..M.AN.FSGG...AYATVCKALVTKASVFIPGLTPYILALYQVMKRKGTHEGCVEQMQRLFSDKLY..................................
#=GR A0A1B1VE91_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A087M0R7_9RHIZ/82-315              ................................RPASAGWYNNRAFENRARAA..GRKAVTIEGDAFSDAIKAETIEAIKANL..G......QVDLIVYSLA.......S..P..VRT..DP.....K.......D......G..V....TYRSAIK....PYG..Q.Q......V.T...S...KTL......NT.........A...T...G...EVS.EITV........EPA......T.......E.E.EAQATIKVMGGEDWELWIKALSDAGVLADGFRTLNYTYLGSELT..WPIYHKGTLGKAKGDLDRAAKAIRAT..H.G-.-ENS...ANVVALKAVVTQASSAIPVVPLYGTLLIKVEDEMGLGEGPIHQIDRLFREKL-q.................................
#=GR A0A087M0R7_9RHIZ/82-315   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y5KGB3_9BACL/81-316              ................................RTASAGWYNSAAFEQAAAAA..GTKSYSIVGDAFSDEIKAKTIDLIRTEL..G......KIDLIVYSVA.......S..P..RRT..HP.....K.......T......G..E....TFSSVIK....PLG..E.T......Y.S...N...KTV......NF.........H...N...G...DVS.IATI........EPA......T.......D.D.ELRQTIAVMGGEDWQMWIDELSAAGVLENDVTTVAYSYIGPEIT..HAVYREGTIGAAKNDLETTAQRLNSQ..L.SA.TGGR...AFVSVNKALVTQSSSAIPVVPLYISALYKVMKEKGLHEGCIEQMYRLFSERLY..................................
#=GR A0A1Y5KGB3_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G8WCN7_9FLAO/81-316              ................................KTASPGWYNSAAFEKFAQEA..GLYAKSINGDAFSNEIKDETLALIKKDL..G......QVDLVIYSLA.......S..P..VRT..NP.....V.......T......G..I....THRSVLK....PIG..T.T......Y.T...N...KTV......DF.........H...S...G...KVS.EVSI........EPA......K.......D.E.DIENTVAVMGGEDWTMWMKALKDANLLADGALTIAYSYIGPAVT..EPVYRKGTIGRAKDDLEATAFSITDS..L.KD.IHGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGVHEGTIEQIQRLYSQRLY..................................
#=GR A0A1G8WCN7_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A177QIN0_9GAMM/81-317              ................................RTASAGWYNTAAFETIAHRE..HLYAKSINGDAFSHDIKKRTAELIRKDL..G......QVDLIIYSLA.......S..P..RRV..HP.....D.......S......G..Q....IFSSVLK....PIG..R.S......Y.T...N...KTV......DA.........F...R...G...EVK.DISI........EAA......N.......A.D.EIQQTIEVMGGEDWAMWIDYLSKEKLLAHGITTLAYSYIGPELT..HPIYKQGTIGKAKEHLFKTAQELNQK..L.KSsYQGQ...ALISVNKALVTQASAAIPVVPLYISLLYKLMKENHTHEGCIEQINRLFHQHLY..................................
#=GR A0A177QIN0_9GAMM/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A5HVJ1_9VIBR/82-317              ................................KPGTAGFYNSVAFEKLAREE..GLYAKSLNGDAFSNEAKEKTIELIKQDL..G......QIDMVVYSLA.......S..P..VRK..MP.....E.......T......G..E....LVRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...K...D...VII.EASV........EPA......T.......E.E.EIKDTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGKAKMDLDRAATALNEK..L.AA.TGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
#=GR A0A0A5HVJ1_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A023NRN2_9GAMM/82-318              ................................KTGTAGWYNSAAFDKFAKQA..GLYSRSINGDAFANETRERAIEVIKNEM.gG......KIDLIIYSLA.......S..P..VRK..LP.....D.......T......G..E....VVRSSLK....TIG..E.T......F.T...A...NSI......DT.........N...R...D...TVV.QASV........EPA......T.......E.Q.EIKDTVTVMGGEDWKLWIDALSKAGVLADHAKTIAYSYIGTEIT..WPMYWHGTLGQAKQHLDNTARQLVAE..H.KA.EHLD...AYVGVMKSVVTQASAAIPVLPLYIAISFRVMKEKGVHEGTIEQINRLFRDRMY..................................
#=GR A0A023NRN2_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
U2PU12_LEPWF/81-318                  ................................RTGSAGWWNTIAFDEAAEKE..GLKYKNFIGDAFSFEMKDDVIKFIKEEF.gG......KIDLLIYSLA.......S..G..VRT..DP.....I.......D......G..I....TYRSALK....STT..K.E......I.T...G...PTI......NF.........E...K...E...TME.ETTM........GVA......T.......P.E.EIKSTIKVMGGEDWKLWIEALDKGGVLSEGFKTVAYSYLGPKVT..YGIYKEGTIGAAKRDLEHTSDVLNDF..L.KEkYNGE...AYVSLSKALMTKASAVIPIFPLYAALLYKVMKEKGIHEGTIQQKHRLLTQMVY..................................
#=GR U2PU12_LEPWF/81-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N6JNT5_9FLAO/82-318              ................................KMGTAGWYNTAAFEKEAHEA..GLYAKSINGDAFSDEVKKETIELIKKDL..G......QVDLVVYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..Q.P......F.T...N...KTV......DF.........H...T...G...VVS.DITI........NPV.....eN.......D.E.DISNTVAVMGGEDWKFWIEDLKAAGVLAEGVQTVAYSYIGPELT..FPIYRNGTIGQAKNDLEATVTVLNDL..L.KD.LNGK...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKAKGTHEGTIEQIQRLFAERLY..................................
#=GR A0A1N6JNT5_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A089MCG4_9BACL/81-316              ................................RTASAGWYNSAALEKAAAEQ..GLKSFSIVGDAFSDSIKTKTIDLIKAEF..G......NVDLVVYSVA.......S..P..RRT..HP.....V.......T......G..E....VFSSVIK....PVG..N.A......Y.T...N...KTM......NF.........H...S...G...EVT.NVTI........EPA......T.......D.D.EVRQTIAVMGGEDWGMWIDQLQAAGALADGATTVAYSYIGPEVT..HPIYKDGTIGQAKNDLEKTAIALNGK..L.SA.SNGR...AFVSVNKALVTQSSSAIPVVPLYISALYRVMKDKELHENCIQQMYRLFAEHLY..................................
#=GR A0A089MCG4_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
E8LM44_SUCHY/82-317                  ................................RPGSAGWYNTAAFTKFAQEE..GLYVKNINGDAFSDACREKAIEIIKADL..G......QVDMVVYSLA.......A..P..VRK..MP.....D.......T......G..E....VVRSSLK....PIG..K.A......Y.T...S...TAI......DT.........N...R...D...TII.ESTV........EPA......T.......P.E.EIENTVKVMGGQDWELWIKALADAGVLAEGCKTVAYSYIGTEIT..WPIYWHGALGKAKEDLDRAAAANRQI..L.AK.VNGD...ARVAVLKSVVTQASSAIPVMPLYIAICFRVMRDAGTYELVIAHIYRMFSKSLY..................................
#=GR E8LM44_SUCHY/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A2A3XDX2_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKQE..GLYSNSINGDAFSHEAREKAIELIKQDM..G......EIDLVVYSLA.......S..P..VRK..MP.....D.......T......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........EPA......T.......Q.E.EIDDTITVMGGEDWELWMSALDKAGVLAKGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAATAIDSH..L.KA.SGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGEQLY..................................
#=GR A0A2A3XDX2_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Q1YTD6_9GAMM/81-316                  ................................KPGTAGWYNSAAFQKYAEQD..GLYAKSINGDAFSDEIKAKTIETIKQDL..G......QIDLVIYSLA.......A..P..RRQ..HP.....K.......T......G..E....IFNSTLK....PVG..K.D......I.S...M...RGI......NT.........D...K...E...TIQ.EFSL........SAA......N.......E.Q.EISDTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYIGEKMT..WDLYWDGTIGQAKKDLDKRVLSIRDK..L.AV.TGGD...ARVSVLKAVVTQASSAIPIMPLYLAMLFKEMKRDGSHEGCIEQLYRLYTECLY..................................
#=GR Q1YTD6_9GAMM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1V0KNS0_9GAMM/82-317              ................................KTASAGWYNTAAFQAAADEA..GLWSKNINGDAFSHEIKAKAIETIKAEL..G......EIDLIVYSLA.......S..P..RRT..DP.....D.......S......G..E....VYSSALK....PIG..K.S......V.T...T...KNL......NT.........S...K...R...IID.SVSV........EAA......T.......E.E.EIQGTIDVMGGADWELWIKALGEAGVLANGFKTVAYTYIGKELT..WPIYGHATIGRAKEDLDRASTAIKAT..T.AD.IKGE...AYVTSLNAVVTQASSAIPIMPLYISAMFKVMKADGTYEGCIEQIQGLFRENIY..................................
#=GR A0A1V0KNS0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z8XG79_9PROT/217-438             ..............................am--SSPGWYLTHALHEH----..DSAYETYLADAFSAATRDRLMADLQERG..I......EIDLVVYSVA.......A..P..RRS..HL.....-.......-......G..Q....EWNSSLL....VQG..D.P......L.E...V...VGL......DF.........K...S...G...QLG.PIRV........EAA......S.......E.M.QVEETRRVMGGDDLEMWVNALLYSGRAAEGMKVASLSYIGPELPplRRMYWDGALGEAKKHIDATTAELNTR..L.SSaVGGR...AFTVMNPAVVTSASVAIPAMLRYIS----------------------------dflgaadagygvyedpl.................
#=GR A0A1Z8XG79_9PROT/217-438  pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_METFK/81-316                    ................................KPGTAGWYNSAAFHKFAEAE..GLYASSVNGDAFSDAVKQQTIDIIKRDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..Q....VYNSTLK....PIG..K.T......L.R...Q...RGL......DT.........D...K...E...VIK.ENVI........EPA......T.......E.E.EIANTVAVMGGEDWQMWIEALDQAGVLADGAKTTAFTYLGEKIT..HDIYWNGTIGAAKKDLDQRVLKIREQ..L.AA.RGGD...ARVAVLKALVTQASSAIPMMPLYLSLLFKVMKKAGTHEGCIEQVDGLYRDSLY..................................
#=GR FABV_METFK/81-316         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1H7ZU01_9BACL/81-316              ................................RTASAGWYNSAAFEQAAQAA..GLKSFSVTGDAFTDETKQKAVELIRKEL..G......QVDLVVYSVA.......S..A..RRT..DP.....R.......T......G..E....TFNSVLK....PIG..D.T......Y.T...N...KTV......NF.........H...T...G...EVS.MVSI........DPA......S.......E.Q.EIADTVHVMGGDDWQMWIDALKQGGALAEGAVTVSYSYIGSQIT..QAIYREGSIGQAKDHLEATAKKLSEQ..L.SS.SGGH...AYVTVSKALVTQSSSAIPVVPLYISALYKVMKEKGIHEGCIEQTYRLFSERLY..................................
#=GR A0A1H7ZU01_9BACL/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0X8HBE3_9GAMM/83-318              ................................KPGTAGWYNSAAFDRFAKAE..GLYSKSINGDAFSHEARDKAIELIQQDM..G......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...VII.EAEV........EPA......T.......E.Q.EIEDTKAVMGGEDWELWMDALGRAGVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDSK..L.KA.AGGG...ANVAVLKSGVTQASAAIPVMPLYIAMVYKIMKEKGLHEGTIDQLNRLFGDRLY..................................
#=GR A0A0X8HBE3_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F6TRH7_9GAMM/84-320              ................................KTGTAGWYNNRGFELAADEA..GLWNKSINGDAFSHQAKEDAIKIIKEEM..G......KIDLVVYSLA.......S..P..RRQ..DP.....D.......S......G..E....VYKSVLK....PIG..E.A......V.T...E...KTL......NT.........D...K...G...LVH.DISI........EPA......S.......E.E.DIQNTIKVMGGEDWELWMKALDEAGVLADNVKTTAYTYIGKKLT..WPIYGHATIGKAKEDLDRASHAIHEK..L.QEkYNGS...ANVSVLKAVVTQASSAIPVMPLYISLLYKVMKENGVHEGPIEQIRELIVDQMY..................................
#=GR A0A0F6TRH7_9GAMM/84-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0C2EWY0_9PSED/82-317              ................................KLGTAGWYNSAAFHKFAEAK..GLYTKSINGDAFSDEVKRLTIETIKRDM..G......KIDLVVYSLA.......A..P..RRT..DP.....K.......T......G..E....VYSSTLK....PIG..K.S......V.T...Q...RGL......NT.........D...K...E...EVN.VTTL........AEA......T.......Q.E.EIDGTVKVMGGEDWQLWIDALDEAGVLADGAKTTAFTYLGEKVT..HDIYWNGSIGAAKKDLDQKVLKIRQR..L.AA.KGGD...ARVSVLKAVVTQASSAIPIMPLYLSLLFKVMKEQGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A0C2EWY0_9PSED/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B1B0L5_9ACTN/86-321              ................................RTATAGWYRTAATRDLAHAA..SRDMVFLNGDAFSDAIKDQVADLLQERF.qG......RLDYLIYSVA.......A..P..RRT..DP.....D.......T......G..A....TYASAIK....PIG..T.A......H.R...T...KTL......VF.........DadgN...P...DVR.EVET........EPA......L.......G.D.DIEQTVAVMGGIDWERWIDHLAERGLLAEGFTTAALSYIGSPLT..APIYREGTIGAAKAHLEATARALDAR..L.AQlVSGR...AVTSVNGAAVTQSSTAVPGIALYTGLLRGVLGD--------------------slipptvqladlwdq...................
#=GR A0A1B1B0L5_9ACTN/86-321   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A090P8C0_9VIBR/83-319              ...............................g-VGSAGFYNNLYFKQFAQAE..GRLAINIQADAFSPQTKEEVIEAVETYF.eG......EVDLVIYSVA.......S..G..LRP..NY.....A.......T......G..S....QWRSAIK....PIG..E.A......V.S...G...ASV......SF.........E...H...D...QWF.ESVL........EPA......T.......D.A.EIEGTLKVMGGDDWEAWVDALINAESIAKGCKTVAFSYIGPELT..HPIYLDGTLGRAKVDLHQTSHSLNLK..L.AN.FSGG...AYASVCKALVTKASVFIPGLTPYLMALYQVMKEKGTHEGCIEQMQRLFSTKLY..................................
#=GR A0A090P8C0_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5A2W9_9FLAO/81-316              ................................KTASPGWYNSAAFEQEAHAA..GLYAKSINGDAFSEDIKAQTIATIKADL..G......QVDLVIYSLA.......S..P..VRM..HP.....T.......T......G..V....LHRSALK....PIG..G.T......F.T...N...KTV......DF.........H...T...G...NVT.QVSI........EPA......T.......Q.E.DIDNTVVVMGGEDWSMWMDAMQKAGVLAEGAMTLAYSYIGPEVT..KAVYRNGTIGRAKDHLEATAATITEQ..L.QA.LGGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKREGIHEGCIEQMDRLYRARLY..................................
#=GR A0A1M5A2W9_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S1NSB3_9GAMM/82-318              ................................RPGTAGWYNSAAFDKYAKQA..GLYSRSINGDAFSHEVRDQAVEMIRNEM.gG......QVDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSALK....PIG..E.T......Y.R...A...TAV......DT.........N...R...D...QII.EAEV........EPA......T.......Q.E.EIDSTVTVMGGEDWELWIDALDQAGVLAEGAKSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAGEIDQR..L.RQ.KGGH...ANVAVLKSVVTQASAAIPVMPLYISMVYRIMKEQGLHEGTIDQLNRLYRERLY..................................
#=GR A0A1S1NSB3_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A259R0R0_9GAMM/82-318              ................................KTGTAGWYNSAAFDQAAKAA..GLTAKSINGDAFSDETRARTIELIKAEM.gG......PIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VKRSALK....TIG..E.T......F.S...A...TSI......DT.........N...R...D...TVI.TATV........EPA......T.......E.Q.EIADTVAVMGGEDWALWIEALSQAGVLAKDATTIAYSYVGTSIT..WPIYWHGTLGRAKQHLDNTAGAMRER..Y.AA.QGLK...AYVGVMKSVVTQASAAIPVIPLYVSMVFKIMKAKGIHEGTIEQANRLFRDFLY..................................
#=GR A0A259R0R0_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
B4CTR8_9BACT/82-317                  ................................RTGSAGWYNSVAFEKAAHAA..GLYAKSINGDAFSDAIKQQTIDLIKKDL..G......QVDGVIYSLA.......S..P..RRT..HP.....R.......T......G..V....THSSTLK....PIG..A.P......Y.T...A...KTV......NT.........D...K...G...VVH.DITL........ESA......S.......E.Q.EIADTVTVMGGEDWEMWIDALRAAGVLADNAFTVAYSYIGPDLT..WAIYRNGTIGRAKEDLEATAKRLQDK..L.GK.TGGH...AVVSVNKALVTQASSAIPVVPLYISLLYKVMKAEGLHEGCIEQIYRLFAERL-k.................................
#=GR B4CTR8_9BACT/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1M5HRX4_9FLAO/81-316              ................................KTASPGWYNSAAFETEAHKA..GLYAKSINGDAFSNEIKKQTLALISADL..G......QIDLVIYSLA.......S..P..VRM..NP.....E.......T......G..I....LHRSTLK....PIG..D.T......F.T...N...KTV......DF.........H...S...G...KVS.EISI........QPS......S.......G.D.DIENTVAVMGGEDWSMWIEALKAENLLAPGASTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFSITDS..L.KA.IDGK...AFVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIHEGCIEQIQRLYQERLF..................................
#=GR A0A1M5HRX4_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
R5DYY3_9CLOT/81-315                  ................................RTATPGYYNTQAFDEAAAQA..GIYTKSVNGDAFSVEVKQQVIDLIRKDL..G......KVDLVVYSLA.......S..P..RRT..TA.....D.......-......G..T....TYSSCLK....TVG..E.P......F.T...Q...KNW......NL.........R...D...N...TIG.EATI........SCA......N.......E.E.EIQSTIKVMGGEDWMDWIQALDEAGVLEEHAKTLAYSYIGPTLT..YPIYHDGTIGQAKNHLSKTAIEITKE..Y.KT.HDIE...AYVSVNKALVTQASAAIPVVPLYLSVLYKVMKEKNLHEGCIEQMYRLYNENVY..................................
#=GR R5DYY3_9CLOT/81-315       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A086D0M9_9GAMM/83-318              ................................KPGTAGWYNAAAFDKFAKAE..GLYSKAINGDAFSHEVREKAIELIREDM..G......QIDLVIYSLA.......S..P..VRK..MP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.T...A...TAI......DT.........N...K...D...TII.EASV........EPA......T.......E.Q.EVADTIDVMGGQDWELWIDALDKAGVLAPGAKSVAFSYIGTDIT..WPIYWHGALGKAKEDLDRAAGEIDAR..L.GQ.QGGS...ANVAVLKSVVTQASAAIPVMPLYISMVYKVMKAQGVHEGTIEQLNRLFGERLY..................................
#=GR A0A086D0M9_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1G1P9U2_9BACT/82-317              ................................RTASAGWYNSVAFEQKAQKT..GLYAKSLNIDAFSDEAKAAVIGFIKKDL..G......KVDLVVYSVA.......A..P..RRQ..HP.....K.......T......G..Q....VAKAVLK....PIG..A.S......Y.T...S...MSL......DV.........T...T...S...TLE.TVTL........PAA......A.......Q.E.EIDQTISVMGGEDWEYWMDALEREKLLEEGVVTVAYSYIGPEIT..KSIYRNGTIGRAKDHLEATAHELDKR..M.KK.IRGR...ALVSVNKALVTQSSSAIPVIPLYFVLLNKVMKEKGVYEDCIAQVYRLFSTRLY..................................
#=GR A0A1G1P9U2_9BACT/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A6QF85_9BURK/82-317              ................................RPATAGWYNTAAFEKFAAQK..GLYAKTINGDAFSNAVKREAIDIIKRDL..G......QVDLVVYSLA.......A..P..RRT..HP.....V.......T......G..A....VHTSTLK....PVG..K.T......L.R...M...RGI......DT.........D...K...E...IIK.ETVL........EAA......T.......Q.S.EIDATAAVMGGEDWQMWIDALLEAGVLADGAKTTAFTYLGAEIT..HDIYWNGSIGAAKKDLDQKVLGIRAK..L.AA.RGGD...ARVAVLKAVVTQASSAIPIMPLYLALLFKAMKEHGTHEGCIEQVYGLLRDSLY..................................
#=GR A0A0A6QF85_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
J2JU01_9ACTN/67-302                  ................................RTATAGWYRTAATAELARRH..GHEMVFLNGDAFSDGMKDQVAGLLRERF..G......RLDHLVYSVA.......A..P..RRT..DP.....D.......T......G..A....VHTSVLK....PIG..E.A......Y.R...T...KTL......VF.........DgegT...P...EVK.VVET........PPA......E.......G.D.DIAQTVAVMGGADWERWVDHLADRGLLADGFTTAALSYIGSPLT..DGIYRQGTIGAAKSHLEATARTLNER..L.DKlVGGR...AVTSVNGAAVTQSSTAIPGIALYVGLLRGALGEG--MVPPIAQLADLWD----ql................................
#=GR J2JU01_9ACTN/67-302       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W1NC11_9GAMM/83-319                  ................................KTGTAGWYNSAAFDRFAKAE..GLYSKSINGDAFSHEARARAIELIQQDM.gG......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LKRSSLK....PIG..E.T......Y.R...A...TAI......DT.........N...K...D...AII.EAEV........GPA......T.......E.Q.EIADTIEVMGGQDWELWMQALADADVLAPGARSVAFSYIGTEIT..WPIYWHGALGKAKEDLDRAAQAIDAQ..L.KT.TGGG...ANVAVLKSVVTQASAAIPVMPLYIAMVYRIMKEQGLHEGTIDQLNRLFGERLY..................................
#=GR W1NC11_9GAMM/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
H9UIZ3_SPIAZ/83-318                  ................................RPGSVGLYNTKAFEKQARAD..GKYAESIYGDAFSQEIKQQTARKIAADL..G......EVDLVLYSIA.......S..P..VRP..DP.....E.......T......G..E....LYRSVLK....PIG..S.T......Y.T...A...TSL......NL.........K...N...R...TLE.QVSI........EPA......D.......E.N.EIQDTVKVMGGEDWQDWMSVLRQAGVLAPGCVTLALSYIGPEIT..TAVYRDGTIGQAKKHLEKTAHSLSES..L.KD.IKGT...ALVSVNKALVTRSSAVIPVVPLYLGVLFKVMQQKGLHEGCVQQMYRLFNEKL-s.................................
#=GR H9UIZ3_SPIAZ/83-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D7PB72_9BRAD/82-314              ................................RTASAGWYNNRAFEIEARKI..GRSPLTLEGDAFSDEMKKTFIASVREKF..G......QLDLLVYSMA.......A..P..ART..DP.....D.......T......G..T....THRSVIK....PLG..A.P......V.E...I...KTL......DT.........E...T...G...EVF.QMTL........EPA......S.......E.D.QTAATVVVMGGDDWKRWIDQLADAGVLAPGFRTLNYTYIGSELT..WPIYWNGTLGRAKVDLDSKAEAIRGR..L.GP.--DA...ARVVALKAVVTQASSAIPVVPLYGTVLFKVMKQLGLHEGCIEQIDRLFRTRL-..................................
#=GR A0A0D7PB72_9BRAD/82-314   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0B8Q445_9VIBR/1-73                ...............................m--------------------..----------------------------..-......----------.......-..-..---..--.....-.......-......-..-....-------....---..-.-......-.-...-...---......--.........-...-...-...---.----........---......-.......-.-.--------------------------------------------..--------------DLDRASTELNEK..L.SA.IGGT...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMEQIYRMFSQRLY..................................
A0A077EMF1_9FLAO/82-318              ................................KLATAGWYNSAAFEKEANAA..GLYAKSINGDAFSDEVKQQTIELIKKDL..G......QVDLVIYSLA.......S..P..RRT..HP.....K.......T......G..V....AYASVLK....PIG..E.P......F.T...N...KTV......DF.........H...T...G...VVS.DISI........QPV......D......kD.E.DIQNTIAVMGGEDWKFWIEDLKNAGVLAEGVKTVAYSYIGPELT..FPIYRNGTIGQAKNDLEGSVTAINDM..L.KD.LNGI...SYVSVNKALVTQSSSAIPVVPLYISLLYKVMKEKGIHEGTIEQMQRLFADRLY..................................
#=GR A0A077EMF1_9FLAO/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_SHEWM/82-317                    ................................KPGTAGWYNSAAFDKFAKAD..GLYSKSINGDAFSHEAKQKAIDLIKADL..G......QIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...LII.ETSV........EPA......S.......E.Q.EIQDTVTVMGGEDWELWLAALSDAGVLADGCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAKALDEK..L.ST.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGLHEGCMEQINRMFAERLY..................................
#=GR FABV_SHEWM/82-317         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R4B6T9_9VIBR/83-319              ...............................h-TASAGFYNNVHFKKYAEQA..GRIAVNLNGDVFSQAMKDEVIEAIETYF.eG......EVDLIIYSIA.......S..G..KRR..KP.....G.......T......N..H....FWHSAIK....PIG..V.H......V.Q...G...NTI......NL.........E...T...A...QWN.EISL........PPA......T.......E.Q.EVTDTIKVMGGEDWENWVDTLINVDSIAPHCKTIALSYMGPEVT..HPLYLDGTLGQAKIDLHQTSHALNLK..L.SN.YGGG...AYAVVCKAIITKASMVIPGLVPYMLALYKIMSEQGQHEDAIEQMQRLLRDKLY..................................
#=GR A0A1R4B6T9_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1S2DIY5_9GAMM/83-318              ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSHEVRDKAIELIREDM..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......S......G..E....VKRSSLK....PIG..E.T......Y.T...A...TAI......DT.........N...K...D...TIT.EASV........EPA......T.......E.Q.EVADTIEVMGGQDWELWMDALDKAGVLAPGARSVAFSYIGTDIT..WPIYWHGALGKAKEDLDRAAGEIDQR..L.KA.TGGG...ANVAVLKSVVTQASAAIPVMPLYISMVYKVMKEQGVHEGTIDQLNRLFAERLY..................................
#=GR A0A1S2DIY5_9GAMM/83-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
C9RMX0_FIBSS/93-329                  ................................KTGTPGWYNNMAFDKFAKEA..GLDAVTFNGDAFSHEMRQNVIDTLKKMG..R......KVDLLVYSVA.......S..S..VRV..DP.....D.......N......G..T....IYRSVLK....PID..K.V......F.T...G...ATI......DC.........L...S...G...KIS.TISA........EPA......T.......A.E.EAANTVKVMGGEDWALWVRKLKEAGVLAEGVKTVAYSYIGPKLS..HAIYRDGTIGGAKKHLEATALELNKE..L.QNdLHGE...AYVSVNKGLVTRSSAVIPIIPMYISVLFKVMKEMGNHEGCIEQMERLMTERLY..................................
#=GR C9RMX0_FIBSS/93-329       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1T5KPM4_9GAMM/82-318              ................................KPGTAGWYNSAAFDKFAKAE..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......QVDLVIYSLA.......S..P..VRK..LP.....G.......T......G..E....VKRSALK....PLG..K.T......Y.T...S...TAI......DT.........N...K...D...TIV.QASI........EPA......T.......E.Q.EVEDTIAVMGGQDWELWINALDQAGVLAPGARTVAFSYIGTEIT..WPIYWHGALGKAKVDLDHTAQRLDKR..L.GE.SGGS...ANVAVLKSVVTQASSAIPVMPLYISMVFKIMKEKGLHEGTIEQLNRLFRERMY..................................
#=GR A0A1T5KPM4_9GAMM/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
Z9JJA4_9GAMM/82-318                  ................................KPGTAGWYNAAAFDKFAKKA..SLYSRSINGDAFSDEMRAKVIELITTEM.gG......QVDLVVYSLA.......S..P..LRK..LP.....S.......T......G..E....IKRSVLK....PIG..A.T......H.T...S...NAI......DT.........N...K...D...QII.QATV........EPA......T.......E.Q.EIADTVAVMGGQDWELWINALAEADVLAPHARTVAFSYIGTEIT..WPIYWHGALGKAKADLDATSRRLDAR..L.QV.RGGG...ANVAVLKSVVTQASAAIPALPLYIAIVFKVMKEKGLHEGTIEQADRLLRERLY..................................
#=GR Z9JJA4_9GAMM/82-318       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1B9DZ39_9FLAO/81-316              ................................KTASPGWYNSAAFEKEAHKA..GLYAKSINGDAFSNEVKRETLDLIKADL..G......QVDLVIYSLA.......S..P..VRT..NP.....N.......T......G..V....THRSVLK....PIG..A.T......F.S...N...KTV......DF.........H...T...G...KVS.EVSI........EPC......A.......G.D.DIENTIAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSVT..EAVYRKGTIGRAKDHLEATAFTISDS..L.AD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGIHEGCIEQIQRLYQQRLF..................................
#=GR A0A1B9DZ39_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A081KFA0_9GAMM/81-317              ................................RSGSAGWYNNLYFREIAEEH..GLYAKNLVGDAFSVSMREQVLSTIKADF.gG......KVDLVVYSLA.......T..G..VRP..DP.....E.......S......G..N....LIRSVIK....SVG..I.P......Y.T...G...LTL......NI.........E...K...E...QLE.AVTL........EPA......T.......L.Q.EIDNTIKVMGGEDWADWIELLNRHDMLADGFKTVAYSYIGPEST..QAIYHKGTLGHAKKDLQYHAEMMHEW..L.RP.LGGD...AWVTVCKALVTKASVFIPGLSPYVMALFKVTKAMGLHEGCIEQMYRLFFTHLY..................................
#=GR A0A081KFA0_9GAMM/81-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1A6KY66_9VIBR/82-317              ................................KPGTAGFYNAAAFDKLAHEE..GLYAKSLNGDAFSNEAKQKTIDLIKQDL..G......QIDMVVYSLA.......S..P..VRK..LP.....E.......T......G..E....LIRSALK....PLG..N.T......Y.T...S...TAV......DT.........N...K...D...QII.EASI........EPA......T.......E.Q.EIADTVTVMGGEDWELWINALSEAGVLADGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRASTALNAK..L.SV.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGVHEGCMQQIFRMFSERLY..................................
#=GR A0A1A6KY66_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0D8D565_9GAMM/82-317              ................................KTASAGWYNTAAFQKAADEV..ALWSKNINGDAFSNEIKEKTIDVIKEDL..G......QIDLVVYSLA.......S..P..RRT..DP.....V.......T......G..E....VYSSTLK....PIG..Q.D......V.T...T...KNL......NT.........S...K...R...IID.EVSV........EAA......S.......E.D.EIANTVKVMGGEDWELWINALKEAGVLADGFKTVAYTYIGKELT..WPIYGKATIGRAKDDLDRASSAIKTA..T.AD.IQGQ...AYVTSLNAVVTQASSAIPIMPLYISAMFKVMKGDGTYEGCIEQIQGLFRDNLY..................................
#=GR A0A0D8D565_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
W9UW00_9GAMM/81-316                  ................................KPGTAGWHNAAAFERLAHEA..GLYAKSINGDAFSNEARAKVIELIKADL..G......QIDLVVYSLA.......S..P..VRK..LP.....D.......T......G..E....VIRSVLK....PIG..E.P......Y.R...S...TAI......DT.........N...K...D...IIT.EAEI........GPA......T.......Q.E.EVDATVKVMGGEDWALWIDALSAAGVLAPECKTVAYSYIGTDIT..WPIYWHGALGKAKQHLDDTAKRLNAQ..L.SA.TGGQ...ANVAVLKSVVTQASSAIPVMPLYLSMVFKVMKEQGLHEGCMEQVYRLFSTGLY..................................
#=GR W9UW00_9GAMM/81-316       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Z8P9S9_9BACT/82-318              ................................KCATAGWYNSAAFHRAASAE..SLYARSFNGDAFSDEMKATVVEAIKEDL..G......QIDLVVYSLA.......S..P..RRQ..HP.....R.......T......G..E....VHKSVLK....PIG..E.H......Y.S...A...RTL......DT.........D...R...S...EVS.EVEI........EPA......T.......E.R.EVQDTVTVMGGEDWELWMEALNGAGLLAPNATSVAYDYIGPEVT..WPIYTNGTIGRAKVDLRAAGQRISAL..L.KDnAGGD...AFISVNKALVTQASSAIPVVPLYISILYRIMKEKGTHEGTIEQIQRLFATHLY..................................
#=GR A0A1Z8P9S9_9BACT/82-318   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1N7BLS6_9SPHI/81-316              ................................KPASAGWYNTAAFETQAHEA..GLYAKSINGDAFSDEIKQKTIDLIKADL..G......QVDLVIYSLA.......S..P..RRT..NP.....K.......T......G..I....THTSVLK....PIG..E.S......F.T...N...KTV......DF.........H...T...G...VVS.EISI........NQA......T.......D.E.EIANTVAVMGGEDWQFWINDLKAAGVLADGALTIAYSYIGPSVT..EKVYRKGTIGRAKDHLEATAKQISEQ..L.KD.INGK...ALVSVNKALVTQASSAIPVIPLYISLLYKIMKAEGTQEGCIEQIQRLFEQRL-l.................................
#=GR A0A1N7BLS6_9SPHI/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Y6IP86_9VIBR/82-317              ................................KPGTAGFYNAAAFDKCAHEA..GLYAKSINGDAFSHEAKQKAVELIQQDL..G......QVDLVVYSLA.......S..P..VRK..MP.....D.......S......G..E....LIRSSLK....PIG..E.T......Y.T...S...TAV......DT.........N...R...D...VII.EASL........EPA......T.......E.Q.EIEDTVTVMGGQDWELWMNALDEAGVLAEGCKTVAYSYIGTELT..WPIYWDGALGRAKMDLDRAATALNEK..L.GS.KQGS...ANVAVLKSVVTQASSAIPVMPLYISMVFKKMREEGVHEGCMEQIYRLFSERLY..................................
#=GR A0A1Y6IP86_9VIBR/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0F6A040_9GAMM/84-319              ..............................gi--GSAGWYNNIFFHQAAEQE..GLVSTNIVGDAFSSETREQVAKAIEQEL.gG......QVDLVVYSLA.......T..G..IRP..NP.....E.......T......G..E....FWRSAIR....PVG..E.T......V.E...G...YSV......NL.........E...K...N...SLD.KVSL........PPA......T.......E.Q.EIDETVKVMGGEDWLSWMQFLNERNLLAKGCETVAYSYIGPEHT..HAIYHKGTLGLAKTHLHHTRDDINTL..L.ES.IEGN...ANIAVCKALVTKASVFIPGLTPYLLALYRVMKAKGLHEGCIEQMNRLFYR---kw................................
#=GR A0A0F6A040_9GAMM/84-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A085EM81_9FLAO/81-316              ................................KTASPGWYNSAAFENEAKKA..GLYAKSINGDAFSNEVKRQTLELIKADL..G......QVDLIIYSLA.......S..P..VRL..NP.....N.......T......G..V....LHRSVLK....PIG..N.T......F.S...N...KTV......DF.........H...T...G...KVT.DVSI........EPC......N.......E.E.DIVNTVAVMGGEDWAMWIDALKAENLLAPGATTVAYSYIGPSLT..EAVYRKGTIGRAKDHLEATAFTITDS..L.AD.INGK...AYVSVNKALVTQASSAIPVIPLYISLLYKIMKEKGIHEGCIEQIQRLYQQRLY..................................
#=GR A0A085EM81_9FLAO/81-316   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1F1Q0F5_9PSED/83-320              ................................KAGTAGWYNAAAFDKFAKQA..GLYSKSINGDAFSDEARAKVIELIKNEM.gG......KVDLVVYSLA.......S..P..VRK..LP.....Q.......T......G..E....LVRSALK....PIG..Q.P......Y.K...S...TAI......DT.........N...K...D...TII.EASI........EPA......T.......E.Q.EIADTVTVMGGQDWQLWIDALSQADVLAEGARTVAFSYIGTEIT..WPIYWHGALGQAKQDLDETALRLDKK..L.ASeIKGG...ANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQEKGVHEGTQDQLDRMFRDRMY..................................
#=GR A0A1F1Q0F5_9PSED/83-320   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1D8RXX4_9GAMM/82-317              ................................KTASAGWYNTSAFQKAAEQE..GLWSKNINGDAFSHEIKAKAIETIKAEL..G......EIDLIVYSLA.......S..P..RRT..DP.....D.......T......G..E....VYSSTLK....PIG..Q.S......V.T...T...KNL......NT.........S...K...R...VID.EISV........EAA......N.......E.A.EIQGTIDVMGGADWELWIKALNEAGVLSEGFKSVAYTYIGKELT..WPIYGKATIGKAKEDLDRAASAINKA..T.AN.LKGE...AHVTSLNAVVTQASSAIPIMPLYISAMFKVMKADGTYEGCIEQIQNLFVENIY..................................
#=GR A0A1D8RXX4_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A167BRU1_9GAMM/82-317              ................................KTASAGWYNTAAFQNAADKA..GLWSKNINGDAFSNELKEKAVETIKAEM..G......KVDLVIYSLA.......S..P..RRT..DP.....K.......T......G..E....THSSVLK....PIG..E.A......I.T...T...KNL......NT.........S...K...R...VID.EVSV........EAA......N.......E.D.EIANTVKVMGGEDWELWLEALKEADVLADNFKTTAYTYIGKELT..WPIYGHATIGKAKEDLDRAAEAIKAS..T.AA.LNGE...AYVSSLNAVVTQASSAIPIMPLYISALFKVTKEDGTYEGTIEQIHGLFNENLY..................................
#=GR A0A167BRU1_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1Q8IX96_9BURK/82-317              ................................KSGTAGWYNTAAFEKFATAE..GRYATSINGDAFSDAVKARTIEVIKRDL..G......QVDLVVYSLA.......A..P..KRQ..HP.....K.......T......G..E....VFSSVLK....PIG..R.A......V.N...L...RGI......DT.........D...K...E...VIK.ETVL........EPA......T.......P.E.EIAHTVAVMGGEDWQMWIDALAEAGVLADGAKTTAFTYLGEKIT..HDIYWNGSIGAAKKDLDQKVLGIREK..L.AA.KGGD...ARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKETGTHEGCIEQVYGLYKDSLY..................................
#=GR A0A1Q8IX96_9BURK/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0X3Y8C0_9GAMM/82-317              ................................KTASAGWYNTAAFEQAAQLE..GLWNKHINGDAFTDELKAQAIDIIRSEM..G......KIDLVVYSLA.......A..P..RRK..DP.....V.......S......G..E....IFSSVLK....PIG..Q.S......Y.T...A...RTL......NT.........S...K...R...EIE.EVSV........EPA......N.......D.D.EIYQTVKVMGGEDWERWLNQLDAAGVLADNCQTVAYTYIGKELT..WPIYGKATIGKAKEDLDRAAAAITAQ..L.AS.KKGK...AYVASLKALVTQASSAIPIMPLYISLLYRVMKEEGTHEGCIEQINGLFRQGLY..................................
#=GR A0A0X3Y8C0_9GAMM/82-317   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A1R0XCW3_9BACL/81-227              ................................RTASAGWYNSAAFEQLAESA..GLQSYSVTGDAYSKETKERTIQLIRSEL..G......QVDLVIYSVA.......S..G..RRT..DP.....E.......T......G..E....VYNSVLK....PIG..D.I......F.T...N...KTV......NF.........H...T...G...EVT.QISI........EPA......T.......D.K.EVHDTIRVMGGDDWQLWIEALQQAGVLADHATTIAYSYIGS---..--------------------------..-.--.----...-----------------------------------------------------..................................
U3AJH4_9VIBR/83-319                  ...............................g-VGSAGWYNNIYFKQQAEAT..GATAVNIIGDAFSDAVRQQVLDAINTQF.nG......QVDLIIYSLA.......T..G..VRP..KP.....D.......S......D..E....MWRSSIK....PIG..E.P......L.T...G...ASI......RL.........E...D...D...SWQ.ETVL........CAA......T.......E.Q.EVSDTQKVMGGEDWQSWVDLLINHNAIAPSCQSIAFSYIGPECT..HPIYHQGTLGRAKVDLHQTSHALNLK..L.AP.FNGG...AYACVCKALVTKASVFIPTFAPYVLALYKTMKAQGLHETCIEQMQRLFNSKLY..................................
#=GR U3AJH4_9VIBR/83-319       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
FABV_ERWT9/82-318                    ................................KPATAGWYNSAAFEELATAK..GLYANSINGDAYSDAVKQKTIETIRQDL..G......QVDLVVYSLA.......A..P..RRT..HP.....K.......T......G..E....VFNSTLK....PIG..K.P......L.T...T...RGL......NT.........D...K...E...TIT.DVSL........EPA......S.......A.E.EIEGTVAVMGGEDWQMWIDALLEAGVLAEGAKTTAFTYLGEKIT..HDIYWNGSIGEAKKDLDKRVLTIRDT..L.AAhGNGD...ARVSVLKAVVTQASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLFKDSLY..................................
#=GR FABV_ERWT9/82-318         pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A193KHB2_9VIBR/83-319              ...............................g-VGSAGWYNNIFFKQQAEMV..GSKAVNIIGDAFSDKVRQQVIDTIRQEF.dG......KVDLIVYSLA.......T..G..VRP..KP.....N.......S......N..E....MWHSAIK....PIG..E.P......L.K...G...ASI......SF.........E...H...D...SWF.ESEL........PPA......T.......E.Q.EIIDTQKVMGGEDWESWVDFLINHDAIAPQCQTIAFSYIGPECT..HAIYHQGTLGRAKVDLHQTSHALNLK..L.SA.FDGG...AYASVCKALVTKASVFIPTFSPYVLALYKSMKDQGRHETCIEQMQRLFNSKLY..................................
#=GR A0A193KHB2_9VIBR/83-319   pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
F7RMF7_9GAMM/82-317                  ................................KPGTAGWYNSAAFDKFAKSA..GLYSKSINCDAFSHEAKQKVIELIKQDL..G......EIDMVVYSLA.......S..P..VRK..LP.....D.......S......G..E....LIRSALK....PIG..E.T......Y.T...A...TAV......DT.........N...K...D...CII.EATV........EPA......T.......E.Q.EIADTVTVMGGQDWELWIKALSEAGVLADNCKTVAYSYIGTELT..WPIYWHGALGKAKMDLDRAAKALNEQ..L.SA.TGGS...ANVAVLKSVVTQASSAIPVMPLYIAMVFKKMRQEGLHEGCMEQIYRMFSERLF..................................
#=GR F7RMF7_9GAMM/82-317       pAS   ..............................................................................................................................................................................................................................................................................................................*...........................................................................................................................
A0A0A2TSJ2_9BACL/81-316              ................................RTASAGWYNSAAFEKAAEEA..GLKSYSITGDAFANETREKTVELIRSEL..G......QVDLVVYSVA.......S..A..RRT..DP.....N.......T......G..E....VFNSVLK....PIG..Q.S......Y