GenomeNet

Database: Pfam
Entry: Flu_B_M2
LinkDB: Flu_B_M2
Original site: Flu_B_M2 
#=GF ID   Flu_B_M2
#=GF AC   PF04772.13
#=GF DE   Influenza B matrix protein 2 (BM2)
#=GF AU   Kerrison ND;0000-0002-1471-953X
#=GF SE   Pfam-B_2165 (release 7.6)
#=GF GA   25.00 25.00;
#=GF TC   216.90 216.80;
#=GF NC   23.40 19.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10573149
#=GF RT   The M2 protein of influenza B virus is synthesized in the late
#=GF RT   phase of infection and incorporated into virions as a subviral
#=GF RT   component. 
#=GF RA   Odagiri T, Hong J, Ohara Y; 
#=GF RL   J Gen Virol 1999;80:2573-2581.
#=GF DR   INTERPRO; IPR006859;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   M2 is synthesised in the late phase of infection and
#=GF CC   incorporated into the virion.  It may be phosphorylated in vivo.
#=GF CC    The function of BM2 is unknown [1].
#=GF SQ   3
#=GS A0A140EU58_9INFB/1-109  AC A0A140EU58.1
#=GS A0A140EUH9_9INFB/1-109  AC A0A140EUH9.1
#=GS BM2_INBLE/1-109         AC P03493.2
A0A140EU58_9INFB/1-109             MLEPFQILSICSFILSALHFMAWTIGHLNQIKRGVNMKIRIKGPNKETINREVSILRHNYQKEIQAKEAMKEVLSDNMEVLSDHIVIEGLSAEEIIKMGETVLEVEK--sh
A0A140EUH9_9INFB/1-109             MLEPFQILSICSFILSALHFMAWTIGHLNQIKRGVNMKIRIKGPNKETINREVSILRHNYQKEIQAKEAMKEVLSDNMEVLSDHIVIEGLSAEEIIKMGETVLEVEK--sh
BM2_INBLE/1-109                    MLEPLQILSICSFILSALHFMAWTIGHLNQIKRGVNLKIQIRNPNKEAINREVSILRHNYQKEIQAKETMKKILSDNMEVLGDHIVVEGLSTDEIIKMGETVLEVEELQ..
#=GC seq_cons                      MLEPFQILSICSFILSALHFMAWTIGHLNQIKRGVNMKIRIKGPNKETINREVSILRHNYQKEIQAKEAMKEVLSDNMEVLSDHIVIEGLSAEEIIKMGETVLEVEK..SH
//
DBGET integrated database retrieval system