GenomeNet

Database: Pfam
Entry: Flu_NS1
LinkDB: Flu_NS1
Original site: Flu_NS1 
#=GF ID   Flu_NS1
#=GF AC   PF00600.20
#=GF DE   Influenza non-structural protein (NS1)
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Bateman A
#=GF GA   25.00 25.00;
#=GF TC   26.00 330.60;
#=GF NC   20.10 19.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Influenza_non-structural_protein
#=GF RC   NMR structure of residues 1-73.
#=GF RN   [1]
#=GF RM   9360601
#=GF RT   A novel RNA-binding motif in influenza A virus non- structural
#=GF RT   protein 1. 
#=GF RA   Chien C, Tejero R, Huang Y, Zimmerman DE, Rios CB, Krug RM,
#=GF RA   Montelione GT; 
#=GF RL   Nat Struct Biol 1997;4:891-895.
#=GF DR   INTERPRO; IPR000256;
#=GF DR   SCOP; 1ns1; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   NS1 is a homodimeric RNA-binding protein that is required for
#=GF CC   viral replication. NS1 binds polyA tails of mRNA keeping them in
#=GF CC   the nucleus. NS1 inhibits pre-mRNA splicing by tightly binding
#=GF CC   to a specific stem-bulge of U6 snRNA.
#=GF SQ   26
#=GS E6XY48_9INFA/1-217      AC E6XY48.1
#=GS NS1_I34A1/1-217         AC P03496.1
#=GS NS1_I34A1/1-217         DR PDB; 3O9U C; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 5NT2 D; 4-203;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U A; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9S B; 82-202;
#=GS NS1_I34A1/1-217         DR PDB; 5NT2 C; 87-201;
#=GS NS1_I34A1/1-217         DR PDB; 3O9T B; 83-203;
#=GS NS1_I34A1/1-217         DR PDB; 5NT2 E; 3-203;
#=GS NS1_I34A1/1-217         DR PDB; 5NT1 B; 86-205;
#=GS NS1_I34A1/1-217         DR PDB; 5NT1 F; 86-205;
#=GS NS1_I34A1/1-217         DR PDB; 3O9S A; 85-206;
#=GS NS1_I34A1/1-217         DR PDB; 3RVC A; 86-203;
#=GS NS1_I34A1/1-217         DR PDB; 5NT2 F; 87-201;
#=GS NS1_I34A1/1-217         DR PDB; 3O9Q A; 85-205;
#=GS NS1_I34A1/1-217         DR PDB; 3O9R B; 86-203;
#=GS NS1_I34A1/1-217         DR PDB; 3O9Q B; 86-206;
#=GS NS1_I34A1/1-217         DR PDB; 3L4Q A; 83-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U D; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9T A; 87-203;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U G; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 2ZKO A; 1-70;
#=GS NS1_I34A1/1-217         DR PDB; 2ZKO B; 1-70;
#=GS NS1_I34A1/1-217         DR PDB; 3L4Q B; 84-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9R A; 86-203;
#=GS NS1_I34A1/1-217         DR PDB; 5NT1 J; 86-204;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U F; 89-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U B; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U H; 87-202;
#=GS NS1_I34A1/1-217         DR PDB; 3O9U E; 87-202;
#=GS X2LGF3_9INFA/1-217      AC X2LGF3.1
#=GS K9NXL1_9INFA/1-217      AC K9NXL1.1
#=GS NS1_I80A8/1-217         AC Q20NN7.1
#=GS Q20S64_9INFA/1-217      AC Q20S64.1
#=GS NS1_I96A0/1-217         AC Q9Q0L6.1
#=GS A0A024E371_9INFA/1-217  AC A0A024E371.1
#=GS X2LA44_9INFA/1-217      AC X2LA44.1
#=GS E8Z005_9INFA/1-217      AC E8Z005.1
#=GS NS1_I78A3/1-217         AC P69417.1
#=GS Q6VE54_9INFA/1-217      AC Q6VE54.1
#=GS Q6LDH3_I78A3/1-217      AC Q6LDH3.1
#=GS D2JIW8_9INFA/1-217      AC D2JIW8.1
#=GS L0KZM7_I78A3/1-217      AC L0KZM7.1
#=GS X2GLZ4_9INFA/1-217      AC X2GLZ4.1
#=GS G7WV35_9INFA/1-217      AC G7WV35.1
#=GS Q8B1Y7_9INFA/1-173      AC Q8B1Y7.1
#=GS E8Z093_9INFA/1-217      AC E8Z093.1
#=GS A0A2V5KZT5_9MICC/1-217  AC A0A2V5KZT5.1
#=GS A0A0G3XQJ2_9INFA/1-217  AC A0A0G3XQJ2.1
#=GS A0S738_9INFA/1-217      AC A0S738.1
#=GS D1LNU0_I63A3/1-217      AC D1LNU0.1
#=GS Q693C2_9INFA/1-217      AC Q693C2.1
#=GS M1SBM3_9INFA/1-217      AC M1SBM3.1
#=GS D8UUJ5_I49A1/1-217      AC D8UUJ5.1
E6XY48_9INFA/1-217                 .MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILKSETDENLKIAIASSPAPRYITDMSIEEISREWYMLMPRQKITGGLMVKMDQAIMDKRITLKANFSVLFDQLETLVSLRAFTDDGAIVAEISPIPSMPGHSTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGVRDENGGPPLPPK.
NS1_I34A1/1-217                    .MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLTPK.
#=GR NS1_I34A1/1-217         SS    .XXHHHHHHHHHHHHHHHHHHHHHHCTXXXHHHHHHHHHHHHHHHHHHHHHTXXHHHHHHHHHHHHHHCHSSSSSXXTTSSSSXSBSEEEEESS-HHHHH-----SSEEEEEETTEEEEEETT--S-EEEEEEEEEEETTEEEEEEEEEEEETTS-EEEEEEEBTTSS---HHHHHHHHHHHHHHHHTTT-EEEE-HHHHHHHCHTXXXXXXXXXXXX.
X2LGF3_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKMAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
K9NXL1_9INFA/1-217                 .MDSNTMSSFQVDCFLWHIRKRFADNGLGDAXXXXRLRRDQKSLKGRGNTXGLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPP-e
NS1_I80A8/1-217                    .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
Q20S64_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQGLGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRGSNEDGRPPLPPK.
NS1_I96A0/1-217                    .MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREWYMLMPRQKITGGLMVKMDQAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEIFPIPSVPGHFTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPK.
A0A024E371_9INFA/1-217             .MDSNTVSSFQVDCFLWHVRKRFADQEMGDAPFLDRLRRDQKSLRGRSSTLGLDIRTATREGKHIVERILEEESDEAFKMSIASVPAPRYLTDMTLEEMSRDWLMLIPKQKITGSLCIRMDQAIVDKNITLKANFSVIFNRLEALILLRAFTEEGAIVGEISPLPSLPGHTDKDVKNAIEILIGGFEWNDNTVRVSETLQRFAWRSSDEDGRSPLSTK.
X2LA44_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNITLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLPPK.
E8Z005_9INFA/1-217                 .MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILKSETDENLKIAIASSPAPRYITDMSIEEISREWYMLMPRQKITGGLMVKMDQAIMDKRIILKANFSVLFDQLETLVSLRAFTEDGAIVAEISPIPSMPGHSTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGVRDENGGPPLPPK.
NS1_I78A3/1-217                    .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
Q6VE54_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVLASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
Q6LDH3_I78A3/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
D2JIW8_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQEMGDAPFLDRLRRDQKSLKGRSSTLGMDIEAATCDGKRIIERILKEESNEALKMNIASTPASRYMTDMTPEEMSKEWFMLMPKQKFAGPLRIRMDQAIIDREITLKANFSVIFDRLETLVLLRAFTNDGAIVGEISPLPFLPGHTNEDVKNAIGVLIGGLEWNDNTVRISENLQRFAWGSSDEDGRSPLTSK.
L0KZM7_I78A3/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQATMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
X2GLZ4_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNITLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLPPK.
G7WV35_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRIADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSREWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSEALQRFAWRSSNEDGRPSLPPK.
Q8B1Y7_9INFA/1-173                 k--------------------------LGDAPFLDRLRRDQKSLRGRGSTLGLDIRTATHEGKHIVERILEEESDEALKMTIASVPAPLYITDMTIEEMSRDWLMLIPRQKVTGSLCIRMDQAVVDKTITLKANFSVIFNRLEALILLRAFTDEGAIVGEISPLPSLPGHTDEDVKNAIGILIGGFEWNDNTVRVSESL-------------------.
E8Z093_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSCNEDGRPPLPPK.
A0A2V5KZT5_9MICC/1-217             .MDSNTVSSFQVDCFLWHVRKRFADQEMGDAPFLDRLRRDQKSLRGRSSTLGLDIRAATREGKHIVERILEEESDEAFKMSIASVPAPRYLTDMTLEEMSRDWLMLIPKQKITGSLCIRMDQAIVDKNITLKANFSVIFNRLEALILLRAFTEEGAIVGEISPLPSLPGHTDKDVKNAIEILIGGFEWNDNTVRVSETLQRFAWRSSDEDGRSPLPTK.
A0A0G3XQJ2_9INFA/1-217             .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKKIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
A0S738_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATHAGKRIVERILEEEPDEALKMAVASVPASCYLADMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKNITLKANFSVIFNRLETLILLRAFTEEGVIVGEISPLPSLPGHTNEDVKNAIGALIGGLEWNDNTVRVSETLQRFTWRSSDENGGPSLPPK.
D1LNU0_I63A3/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPDSRYLTDMTLEEMSRDWFMLMPKQKMAGSLCIRMDQAIMDKDIILKANFSVIFNRLETLILLRAFTEDGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
Q693C2_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMNKNIILKANFSVIFDRLETLILLRAFTEEGAIIGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
M1SBM3_9INFA/1-217                 .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPVSRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNITLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
D8UUJ5_I49A1/1-217                 .MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILESETDENLKIAIASSPAPRYIMDMSIEEISREWYMLMPRQKVTGGLMVKMDQAIMGKRIILKANFSVLFDQLETLVSLRAFTEDGAIVAVISPIPSMPGHSTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGIRDEDGGPPLPPK.
#=GC SS_cons                       .XXHHHHHHHHHHHHHHHHHHHHHHCTXXXHHHHHHHHHHHHHHHHHHHHHTXXHHHHHHHHHHHHHHCHSSSSSXXTTSSSSXSBSEEEEESS-HHHHH-----SSEEEEEETTEEEEEETT--S-EEEEEEEEEEETTEEEEEEEEEEEETTS-EEEEEEEBTTSS---HHHHHHHHHHHHHHHHTTT-EEEE-HHHHHHHCHTXXXXXXXXXXXX.
#=GC seq_cons                      .MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSNEDGRPPLPPK.
//
DBGET integrated database retrieval system