GenomeNet

Database: Pfam
Entry: Folate_rec
LinkDB: Folate_rec
Original site: Folate_rec 
#=GF ID   Folate_rec
#=GF AC   PF03024.15
#=GF DE   Folate receptor family
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1966 (release 6.4)
#=GF GA   29.80 29.80;
#=GF TC   29.80 29.80;
#=GF NC   29.70 29.70;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Folate_receptor
#=GF RN   [1]
#=GF RM   3571203
#=GF RT   Positions of disulfide bonds in riboflavin-binding protein of
#=GF RT   hen egg white. 
#=GF RA   Hamazume Y, Mega T, Ikenaka T; 
#=GF RL   J Biochem (Tokyo) 1987;101:217-223.
#=GF DR   INTERPRO; IPR018143;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family includes the folate receptor which binds to folate
#=GF CC   and reduced folic acid derivatives and mediates delivery of
#=GF CC   5-methyltetrahydrofolate to the interior of cells. These
#=GF CC   proteins are attached to the membrane by a GPI-anchor. The
#=GF CC   proteins contain 16 conserved cysteines that form eight
#=GF CC   disulphide bridges.
#=GF SQ   1508
#=GS A0A0D9QVZ4_CHLSB/36-211   AC A0A0D9QVZ4.1
#=GS H2PEE7_PONAB/38-171       AC H2PEE7.1
#=GS A0A022RC25_ERYGU/30-193   AC A0A022RC25.1
#=GS G3R6P4_GORGO/30-205       AC G3R6P4.2
#=GS K7EM70_HUMAN/27-177       AC K7EM70.1
#=GS A0BRL9_PARTE/29-183       AC A0BRL9.1
#=GS A0A3Q7ENE1_SOLLC/41-192   AC A0A3Q7ENE1.1
#=GS A0A3Q2VYP3_HAPBU/23-198   AC A0A3Q2VYP3.1
#=GS A0A1L8F8R7_XENLA/54-213   AC A0A1L8F8R7.1
#=GS A0A2K5Y8K7_MANLE/20-194   AC A0A2K5Y8K7.1
#=GS A0A3P8TBX2_AMPPE/26-207   AC A0A3P8TBX2.1
#=GS A0A3Q7VCQ0_URSAR/27-177   AC A0A3Q7VCQ0.1
#=GS A0A2K5NSK3_CERAT/47-206   AC A0A2K5NSK3.1
#=GS A0A2K6GQH9_PROCO/3-164    AC A0A2K6GQH9.1
#=GS G3QYN5_GORGO/19-179       AC G3QYN5.2
#=GS U3ICJ7_ANAPP/29-190       AC U3ICJ7.2
#=GS A0A2G5DLG5_AQUCA/36-190   AC A0A2G5DLG5.1
#=GS A0A091IU12_EGRGA/31-206   AC A0A091IU12.1
#=GS W5MQI6_LEPOC/34-194       AC W5MQI6.1
#=GS A0A0R3UCR5_9CEST/37-165   AC A0A0R3UCR5.1
#=GS A0A093PLD3_9PASS/3-165    AC A0A093PLD3.1
#=GS A0A1P8BFS7_ARATH/14-174   AC A0A1P8BFS7.1
#=GS F4K5P6_ARATH/57-217       AC F4K5P6.1
#=GS A0A3P8TFB6_AMPPE/26-198   AC A0A3P8TFB6.1
#=GS A0A3P9BJ31_9CICH/23-198   AC A0A3P9BJ31.1
#=GS A0A2Y9RL39_TRIMA/30-205   AC A0A2Y9RL39.1
#=GS RTBDN_HUMAN/27-183        AC Q9BSG5.2
#=GS A0A3P8NBF4_ASTCA/57-219   AC A0A3P8NBF4.1
#=GS A0A2K5NUV5_CERAT/37-193   AC A0A2K5NUV5.1
#=GS A0A2T7PMZ4_POMCA/48-174   AC A0A2T7PMZ4.1
#=GS A0A1S3HEA3_LINUN/39-216   AC A0A1S3HEA3.1
#=GS A0A2R9BSE7_PANPA/1-108    AC A0A2R9BSE7.1
#=GS A0A3Q1MAD6_BOVIN/42-138   AC A0A3Q1MAD6.1
#=GS G3HSP0_CRIGR/26-186       AC G3HSP0.1
#=GS A0A1D5NYI4_CHICK/27-188   AC A0A1D5NYI4.1
#=GS A0A0P7YL54_SCLFO/38-212   AC A0A0P7YL54.1
#=GS A0A3P9C1U5_9CICH/57-219   AC A0A3P9C1U5.1
#=GS A0A151NL07_ALLMI/35-221   AC A0A151NL07.1
#=GS FOLR1_HUMAN/36-211        AC P15328.3
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH H; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ G; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ D; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ H; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ E; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM6 A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH F; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH B; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KMX A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH E; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH D; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH C; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM7 A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH A; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM7 B; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ C; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH G; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ A; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ F; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ B; 14-189;
#=GS A0A2I4B9B7_9TELE/28-206   AC A0A2I4B9B7.1
#=GS A0A226PHQ1_COLVI/21-188   AC A0A226PHQ1.1
#=GS A0A067EM12_CITSI/29-192   AC A0A067EM12.1
#=GS A0A0E0NH62_ORYRU/49-201   AC A0A0E0NH62.1
#=GS C3Z5S0_BRAFL/64-202       AC C3Z5S0.1
#=GS A0A3Q3WCH9_MOLML/42-208   AC A0A3Q3WCH9.1
#=GS A0A1U7SMZ8_ALLSI/53-228   AC A0A1U7SMZ8.1
#=GS A0A3Q2VVC9_HAPBU/33-194   AC A0A3Q2VVC9.1
#=GS A0A1V9Z6B1_9STRA/11-177   AC A0A1V9Z6B1.1
#=GS A0A2K6N9T1_RHIRO/36-211   AC A0A2K6N9T1.1
#=GS A0A314KWB8_NICAT/41-192   AC A0A314KWB8.1
#=GS A0A401SFU6_CHIPU/99-260   AC A0A401SFU6.1
#=GS A0A151P3F2_ALLMI/66-228   AC A0A151P3F2.1
#=GS Q94BQ5_ARATH/38-198       AC Q94BQ5.1
#=GS A0A060WNJ3_ONCMY/33-194   AC A0A060WNJ3.1
#=GS A0A3Q3ASB6_KRYMA/46-208   AC A0A3Q3ASB6.1
#=GS W5NI26_LEPOC/18-180       AC W5NI26.1
#=GS A0A401PDQ3_SCYTO/172-236  AC A0A401PDQ3.1
#=GS G1SCR2_RABIT/35-210       AC G1SCR2.1
#=GS H9GSY7_ANOCA/1-64         AC H9GSY7.1
#=GS A0A397Z2E1_BRACM/37-197   AC A0A397Z2E1.1
#=GS H0VJP2_CAVPO/12-187       AC H0VJP2.2
#=GS F7GMA9_CALJA/22-183       AC F7GMA9.2
#=GS F7BP69_MACMU/3-164        AC F7BP69.2
#=GS K8EAN2_9CHLO/37-209       AC K8EAN2.1
#=GS A0A3Q1MF97_BOVIN/26-167   AC A0A3Q1MF97.1
#=GS A0A2R9CB09_PANPA/44-206   AC A0A2R9CB09.1
#=GS A0A3B4DJ87_PYGNA/33-208   AC A0A3B4DJ87.1
#=GS U3FQI0_CALJA/38-220       AC U3FQI0.1
#=GS A0A2K6GLL1_PROCO/22-183   AC A0A2K6GLL1.1
#=GS A0A096MUT0_PAPAN/47-206   AC A0A096MUT0.1
#=GS A0A3P8X963_ESOLU/34-195   AC A0A3P8X963.1
#=GS A0A183TCR0_SCHSO/1-112    AC A0A183TCR0.1
#=GS A0A3R7MUC2_PENVA/16-201   AC A0A3R7MUC2.1
#=GS A0A3Q3BLK1_KRYMA/38-209   AC A0A3Q3BLK1.1
#=GS A0A3L6QEC6_PANMI/135-286  AC A0A3L6QEC6.1
#=GS H2TG96_TAKRU/121-296      AC H2TG96.2
#=GS A0A091J841_EGRGA/21-188   AC A0A091J841.1
#=GS A0A2K6RRY4_RHIRO/22-183   AC A0A2K6RRY4.1
#=GS A0A1U7QHH8_MESAU/31-206   AC A0A1U7QHH8.1
#=GS A0A3P8T9E3_AMPPE/37-209   AC A0A3P8T9E3.1
#=GS A0A2Y9DQ33_TRIMA/38-220   AC A0A2Y9DQ33.1
#=GS A0A210PDV1_MIZYE/48-187   AC A0A210PDV1.1
#=GS A0A091UZ53_NIPNI/1-110    AC A0A091UZ53.1
#=GS A0A3Q2EC14_CYPVA/37-198   AC A0A3Q2EC14.1
#=GS A0A3B5A5T3_9TELE/31-203   AC A0A3B5A5T3.1
#=GS A0A0D9RDG0_CHLSB/24-185   AC A0A0D9RDG0.1
#=GS A0A3Q2I7B9_HORSE/26-171   AC A0A3Q2I7B9.1
#=GS A0A060W5W4_ONCMY/34-195   AC A0A060W5W4.1
#=GS G1U5B1_RABIT/30-205       AC G1U5B1.1
#=GS I3IVA9_ORENI/27-189       AC I3IVA9.1
#=GS A0A024UI10_9STRA/18-172   AC A0A024UI10.1
#=GS A0A1S3AF88_ERIEU/21-196   AC A0A1S3AF88.1
#=GS A0A3Q1GNY2_9TELE/38-210   AC A0A3Q1GNY2.1
#=GS A0A3Q1F5K7_9TELE/38-210   AC A0A3Q1F5K7.1
#=GS A0A1V4JUL1_PATFA/1-154    AC A0A1V4JUL1.1
#=GS A0A2Y9L219_ENHLU/31-206   AC A0A2Y9L219.1
#=GS K7FXM7_PELSI/32-199       AC K7FXM7.1
#=GS A0A2K5MME5_CERAT/20-181   AC A0A2K5MME5.1
#=GS A0A3P8QUM8_ASTCA/36-208   AC A0A3P8QUM8.1
#=GS A0A1U8DXJ0_ALLSI/26-201   AC A0A1U8DXJ0.1
#=GS A0A2U4AE87_TURTR/7-166    AC A0A2U4AE87.1
#=GS A0A368UHK4_SOYBN/40-203   AC A0A368UHK4.1
#=GS H2QQ84_PANTR/38-220       AC H2QQ84.1
#=GS A0A2U4BPN7_TURTR/30-205   AC A0A2U4BPN7.1
#=GS A0A337S480_FELCA/38-220   AC A0A337S480.1
#=GS A0A3B3B8J1_ORYME/23-198   AC A0A3B3B8J1.1
#=GS M7BFF1_CHEMY/76-239       AC M7BFF1.1
#=GS A0A3Q1G199_9TELE/35-210   AC A0A3Q1G199.1
#=GS A0A1U7SYQ8_TARSY/30-205   AC A0A1U7SYQ8.1
#=GS A0A3B4AS81_9GOBI/26-199   AC A0A3B4AS81.1
#=GS A0A314YQ87_PRUYE/27-183   AC A0A314YQ87.1
#=GS C3Y1A9_BRAFL/437-606      AC C3Y1A9.1
#=GS W5KWD9_ASTMX/32-207       AC W5KWD9.2
#=GS F6ZR48_HORSE/72-247       AC F6ZR48.2
#=GS A0A3B3BS36_ORYME/28-206   AC A0A3B3BS36.1
#=GS M3W3V7_FELCA/48-199       AC M3W3V7.2
#=GS A0A2U3WNY1_ODORO/27-213   AC A0A2U3WNY1.1
#=GS A0A3P8NBB6_ASTCA/21-183   AC A0A3P8NBB6.1
#=GS A0A2U3V4B3_TURTR/38-220   AC A0A2U3V4B3.1
#=GS A0A2K5F404_AOTNA/37-193   AC A0A2K5F404.1
#=GS A0A0D2R9S0_GOSRA/43-205   AC A0A0D2R9S0.1
#=GS A0A2K5TT37_MACFA/37-193   AC A0A2K5TT37.1
#=GS A0A3B5Q412_XIPMA/39-210   AC A0A3B5Q412.1
#=GS A0A2C9VFH6_MANES/11-134   AC A0A2C9VFH6.1
#=GS W5NB87_LEPOC/15-167       AC W5NB87.1
#=GS H9GK27_ANOCA/32-193       AC H9GK27.2
#=GS A0A087XCB2_POEFO/40-210   AC A0A087XCB2.2
#=GS A0A2Y9KV80_ENHLU/31-206   AC A0A2Y9KV80.1
#=GS K1PIY6_CRAGI/27-189       AC K1PIY6.1
#=GS G3NU04_GASAC/28-209       AC G3NU04.1
#=GS I3M8E2_ICTTR/38-220       AC I3M8E2.2
#=GS A0A498K8T5_MALDO/26-188   AC A0A498K8T5.1
#=GS A0A3Q2W1W4_HAPBU/28-209   AC A0A3Q2W1W4.1
#=GS A0A4D9E2K4_9SAUR/40-206   AC A0A4D9E2K4.1
#=GS A0A2U4AZE6_TURTR/27-116   AC A0A2U4AZE6.1
#=GS A0A1L8G6J3_XENLA/51-210   AC A0A1L8G6J3.1
#=GS A0A2K5TT28_MACFA/59-215   AC A0A2K5TT28.1
#=GS A0A0Q3PC11_AMAAE/1-154    AC A0A0Q3PC11.1
#=GS A0A2U3YPX7_LEPWE/30-205   AC A0A2U3YPX7.1
#=GS A0A2R8MPG7_CALJA/36-211   AC A0A2R8MPG7.1
#=GS A0A3B3VVA9_9TELE/11-173   AC A0A3B3VVA9.1
#=GS A0A2K6PQ81_RHIRO/38-220   AC A0A2K6PQ81.1
#=GS A0A059B747_EUCGR/107-259  AC A0A059B747.1
#=GS W1NXD4_AMBTC/33-196       AC W1NXD4.1
#=GS G1P7A4_MYOLU/33-191       AC G1P7A4.1
#=GS Q0VCN9_BOVIN/30-205       AC Q0VCN9.1
#=GS C3YX09_BRAFL/253-382      AC C3YX09.1
#=GS F1M928_RAT/26-202         AC F1M928.2
#=GS A0A2K5DCI7_AOTNA/22-181   AC A0A2K5DCI7.1
#=GS H2NEZ7_PONAB/28-204       AC H2NEZ7.1
#=GS A0A0P7VT40_SCLFO/30-191   AC A0A0P7VT40.1
#=GS A0A3Q3AI29_KRYMA/26-204   AC A0A3Q3AI29.1
#=GS A0A3B3UPY6_9TELE/23-198   AC A0A3B3UPY6.1
#=GS I3JBR1_ORENI/17-188       AC I3JBR1.1
#=GS V4AWK8_LOTGI/5-94         AC V4AWK8.1
#=GS A0A2K5D9I4_AOTNA/3-164    AC A0A2K5D9I4.1
#=GS A0A3Q1JZL4_ANATE/35-196   AC A0A3Q1JZL4.1
#=GS G1NTC5_MYOLU/26-201       AC G1NTC5.1
#=GS A0A2B4SLT0_STYPI/10-111   AC A0A2B4SLT0.1
#=GS A0A3B4DGP3_PYGNA/22-183   AC A0A3B4DGP3.1
#=GS A0A2K6FMJ5_PROCO/39-221   AC A0A2K6FMJ5.1
#=GS A0A2K5MD48_CERAT/38-220   AC A0A2K5MD48.1
#=GS G3UM80_LOXAF/4-128        AC G3UM80.1
#=GS A0A3B3Y5H0_9TELE/26-235   AC A0A3B3Y5H0.1
#=GS A0A1U8CQ94_MESAU/24-199   AC A0A1U8CQ94.1
#=GS E9FW82_DAPPU/43-215       AC E9FW82.1
#=GS A0A402EUL2_9SAUR/62-224   AC A0A402EUL2.1
#=GS A0A340XNT4_LIPVE/30-205   AC A0A340XNT4.1
#=GS M5WJ83_PRUPE/27-188       AC M5WJ83.1
#=GS A0A3L8RTB7_CHLGU/28-203   AC A0A3L8RTB7.1
#=GS K7F2U2_PELSI/35-210       AC K7F2U2.1
#=GS A0A3Q2I2P9_HORSE/26-162   AC A0A3Q2I2P9.1
#=GS U3K4J0_FICAL/22-189       AC U3K4J0.1
#=GS A0A1S3SQX4_SALSA/34-195   AC A0A1S3SQX4.1
#=GS G3SMM0_LOXAF/11-186       AC G3SMM0.1
#=GS A0A3P9PH90_POERE/26-201   AC A0A3P9PH90.1
#=GS C5XWG6_SORBI/45-198       AC C5XWG6.1
#=GS A0A2K5LBK7_CERAT/36-211   AC A0A2K5LBK7.1
#=GS A0A443RRG9_9ACAR/58-231   AC A0A443RRG9.1
#=GS A0A1U8IUT8_GOSHI/17-179   AC A0A1U8IUT8.1
#=GS A0A2U9CLX5_SCOMX/34-196   AC A0A2U9CLX5.1
#=GS A0A2K6BUM3_MACNE/37-193   AC A0A2K6BUM3.1
#=GS M7AN26_CHEMY/4-129        AC M7AN26.1
#=GS K7ESG0_HUMAN/59-185       AC K7ESG0.1
#=GS A0A3Q7U7Q6_VULVU/38-220   AC A0A3Q7U7Q6.1
#=GS A0A0D9QVX7_CHLSB/30-205   AC A0A0D9QVX7.1
#=GS U3JSL4_FICAL/25-156       AC U3JSL4.1
#=GS A0A1D2NCW9_ORCCI/33-207   AC A0A1D2NCW9.1
#=GS M3WCE9_FELCA/40-199       AC M3WCE9.3
#=GS A0A2J8RY52_PONAB/27-183   AC A0A2J8RY52.1
#=GS A0A218UKV1_9PASE/45-220   AC A0A218UKV1.1
#=GS H2Q164_PANTR/44-206       AC H2Q164.1
#=GS E9PXB5_MOUSE/34-103       AC E9PXB5.8
#=GS G3QFT6_GORGO/44-206       AC G3QFT6.2
#=GS A0A3Q0RXJ0_AMPCI/37-199   AC A0A3Q0RXJ0.1
#=GS G3U4R3_LOXAF/45-206       AC G3U4R3.1
#=GS A0A087RHL9_APTFO/21-188   AC A0A087RHL9.1
#=GS A0A2K5Y8J7_MANLE/32-202   AC A0A2K5Y8J7.1
#=GS H2Y7U9_CIOSA/24-200       AC H2Y7U9.1
#=GS B3RPR5_TRIAD/37-169       AC B3RPR5.1
#=GS A0A022RAA7_ERYGU/30-193   AC A0A022RAA7.1
#=GS A0A3Q0E9K2_TARSY/1-120    AC A0A3Q0E9K2.1
#=GS A0A2B4SW98_STYPI/68-255   AC A0A2B4SW98.1
#=GS F7AWH6_CIOIN/27-202       AC F7AWH6.2
#=GS A0A091DMG9_FUKDA/34-209   AC A0A091DMG9.1
#=GS A0A091EID6_CORBR/1-107    AC A0A091EID6.1
#=GS F7D0L5_HORSE/27-200       AC F7D0L5.2
#=GS U3EWX7_CALJA/37-193       AC U3EWX7.1
#=GS I3KJ02_ORENI/23-198       AC I3KJ02.1
#=GS A0A493TRT2_ANAPP/96-213   AC A0A493TRT2.1
#=GS Q8BY83_MOUSE/26-162       AC Q8BY83.1
#=GS A0A087QV99_APTFO/3-165    AC A0A087QV99.1
#=GS A0A093PR50_9PASS/21-196   AC A0A093PR50.1
#=GS A0A0G4IP33_PLABS/18-159   AC A0A0G4IP33.1
#=GS H0WKX3_OTOGA/30-205       AC H0WKX3.1
#=GS M3X2M1_FELCA/27-188       AC M3X2M1.3
#=GS A0A3P8WSY5_CYNSE/23-198   AC A0A3P8WSY5.1
#=GS A0A3P9NQM6_POERE/68-230   AC A0A3P9NQM6.1
#=GS A0A2K5QP32_CEBCA/38-220   AC A0A2K5QP32.1
#=GS A0A2I2UXU2_FELCA/38-220   AC A0A2I2UXU2.1
#=GS A0A3B1IPY3_ASTMX/14-189   AC A0A3B1IPY3.1
#=GS A0A125YTP5_TOXGV/134-324  AC A0A125YTP5.1
#=GS A0A4D9E3P2_9SAUR/24-191   AC A0A4D9E3P2.1
#=GS A0A0E0K1U4_ORYPU/51-203   AC A0A0E0K1U4.1
#=GS A0A384DSE0_URSMA/27-177   AC A0A384DSE0.1
#=GS A0A2K6FVT6_PROCO/26-201   AC A0A2K6FVT6.1
#=GS A0A452CAM7_BALAS/30-203   AC A0A452CAM7.1
#=GS A0A3Q7XHC1_URSAR/31-206   AC A0A3Q7XHC1.1
#=GS JUNO_MOUSE/26-202         AC Q9EQF4.1
#=GS JUNO_MOUSE/26-202         DR PDB; 5JYJ A; 26-202;
#=GS JUNO_MOUSE/26-202         DR PDB; 5EJN B; 26-202;
#=GS JUNO_MOUSE/26-202         DR PDB; 5EJN A; 26-202;
#=GS A0A3B3S646_9TELE/34-194   AC A0A3B3S646.1
#=GS W5P2F1_SHEEP/30-207       AC W5P2F1.1
#=GS A0A2Y9T9A0_PHYMC/33-194   AC A0A2Y9T9A0.1
#=GS A0A3Q7W815_URSAR/27-213   AC A0A3Q7W815.1
#=GS G3WJX2_SARHA/110-235      AC G3WJX2.1
#=GS H9GUQ6_ANOCA/9-102        AC H9GUQ6.2
#=GS W5MF72_LEPOC/23-189       AC W5MF72.1
#=GS F5GXV3_HUMAN/30-167       AC F5GXV3.1
#=GS Q69GM1_XENLA/38-218       AC Q69GM1.1
#=GS A0A1U8DMF6_ALLSI/9-109    AC A0A1U8DMF6.1
#=GS A0A0D3CMJ5_BRAOL/39-190   AC A0A0D3CMJ5.1
#=GS A0A0D3AFH2_BRAOL/43-207   AC A0A0D3AFH2.1
#=GS A0A401S518_CHIPU/23-189   AC A0A401S518.1
#=GS A0A3B4BBS1_9GOBI/39-199   AC A0A3B4BBS1.1
#=GS A0A1A6FTX1_NEOLE/29-204   AC A0A1A6FTX1.1
#=GS G3HCX1_CRIGR/27-199       AC G3HCX1.1
#=GS A0A3M6UV93_9CNID/50-223   AC A0A3M6UV93.1
#=GS W5KD05_ASTMX/27-199       AC W5KD05.2
#=GS K7F2U9_PELSI/27-202       AC K7F2U9.1
#=GS A0A1S3A0V0_ERIEU/31-207   AC A0A1S3A0V0.1
#=GS M4FEA4_BRARP/39-188       AC M4FEA4.1
#=GS H2NM84_PONAB/22-183       AC H2NM84.1
#=GS A0A1U8ACQ3_NELNU/44-200   AC A0A1U8ACQ3.1
#=GS A0A2K6R535_RHIRO/47-206   AC A0A2K6R535.1
#=GS A0A0L8HUS0_OCTBM/23-187   AC A0A0L8HUS0.1
#=GS A0A340XRU3_LIPVE/38-220   AC A0A340XRU3.1
#=GS W4H1E2_9STRA/9-169        AC W4H1E2.1
#=GS F7BPH5_CIOIN/32-206       AC F7BPH5.2
#=GS A0A2Y9LC22_ENHLU/27-187   AC A0A2Y9LC22.1
#=GS A0A2R9B8B1_PANPA/3-164    AC A0A2R9B8B1.1
#=GS A0A3P8TBQ6_AMPPE/37-209   AC A0A3P8TBQ6.1
#=GS A0A3Q1AU19_AMPOC/35-196   AC A0A3Q1AU19.1
#=GS A0A3Q1M192_BOVIN/30-205   AC A0A3Q1M192.1
#=GS A0A3B3SHV7_9TELE/34-199   AC A0A3B3SHV7.1
#=GS A0A3Q3RZ90_9TELE/28-209   AC A0A3Q3RZ90.1
#=GS H0WGV9_OTOGA/36-211       AC H0WGV9.1
#=GS A0A1V4JW39_PATFA/1-154    AC A0A1V4JW39.1
#=GS A0A3Q1M4M1_BOVIN/26-208   AC A0A3Q1M4M1.1
#=GS A0A093GV59_STRCA/3-165    AC A0A093GV59.1
#=GS A0A3B4X6X7_SERLL/35-196   AC A0A3B4X6X7.1
#=GS A0A2K6RR39_RHIRO/47-110   AC A0A2K6RR39.1
#=GS A0A2K6A9I0_MANLE/4-146    AC A0A2K6A9I0.1
#=GS A0A1U7SET6_ALLSI/5-167    AC A0A1U7SET6.2
#=GS A0A3Q2H4A7_HORSE/36-211   AC A0A3Q2H4A7.1
#=GS A0A2Y9F958_PHYMC/38-220   AC A0A2Y9F958.1
#=GS A0A452STK5_URSAM/20-194   AC A0A452STK5.1
#=GS F7FPZ6_MONDO/33-194       AC F7FPZ6.2
#=GS A0A1U7T349_TARSY/38-220   AC A0A1U7T349.1
#=GS K7FXM9_PELSI/22-189       AC K7FXM9.1
#=GS A0A068Y5C3_ECHMU/36-215   AC A0A068Y5C3.1
#=GS G1NQU6_MELGA/30-211       AC G1NQU6.2
#=GS A0A151NL04_ALLMI/35-221   AC A0A151NL04.1
#=GS A0A2K6KH33_RHIBE/22-183   AC A0A2K6KH33.1
#=GS H2ZLB1_CIOSA/30-139       AC H2ZLB1.1
#=GS A0A2I3RAM3_PANTR/3-164    AC A0A2I3RAM3.1
#=GS A0A1S3JE41_LINUN/10-111   AC A0A1S3JE41.1
#=GS A0A452F775_CAPHI/27-177   AC A0A452F775.1
#=GS A0A250XD00_9CHLO/29-204   AC A0A250XD00.1
#=GS F7C8X8_HORSE/36-211       AC F7C8X8.2
#=GS U3IR18_ANAPP/35-217       AC U3IR18.2
#=GS A0A2Y9EKS1_PHYMC/54-204   AC A0A2Y9EKS1.1
#=GS A0A3Q1NCZ3_BOVIN/84-202   AC A0A3Q1NCZ3.1
#=GS A0A2K6AU51_MACNE/36-211   AC A0A2K6AU51.1
#=GS F7BP54_MACMU/27-197       AC F7BP54.2
#=GS F7DLZ1_XENTR/48-210       AC F7DLZ1.1
#=GS A0A2I3GPA3_NOMLE/47-113   AC A0A2I3GPA3.1
#=GS A0A091F5K7_CORBR/21-188   AC A0A091F5K7.1
#=GS A0A2K5Q8K8_CEBCA/37-193   AC A0A2K5Q8K8.1
#=GS A0A2U1MUM5_ARTAN/54-202   AC A0A2U1MUM5.1
#=GS A0A493T565_ANAPP/35-217   AC A0A493T565.1
#=GS M7BZS7_CHEMY/26-201       AC M7BZS7.1
#=GS A0A096NJQ0_PAPAN/20-181   AC A0A096NJQ0.2
#=GS L5K4Y9_PTEAL/31-165       AC L5K4Y9.1
#=GS F1PC15_CANLF/15-166       AC F1PC15.2
#=GS A0A1L8HLT8_XENLA/38-218   AC A0A1L8HLT8.1
#=GS A0A2G2XX60_CAPAN/38-189   AC A0A2G2XX60.1
#=GS A0A3B4GM11_9CICH/33-194   AC A0A3B4GM11.1
#=GS A0A2K6BLU8_MACNE/56-238   AC A0A2K6BLU8.1
#=GS A0A3Q7XHD9_URSAR/1-120    AC A0A3Q7XHD9.1
#=GS A0A2I2U806_FELCA/26-201   AC A0A2I2U806.2
#=GS H0XSY6_OTOGA/30-205       AC H0XSY6.1
#=GS A0A3Q2VNP5_HAPBU/23-175   AC A0A3Q2VNP5.1
#=GS F6WFD9_CIOIN/35-207       AC F6WFD9.1
#=GS D7U9Y5_VITVI/37-188       AC D7U9Y5.1
#=GS A0A383WEW0_TETOB/10-182   AC A0A383WEW0.1
#=GS A0A2K5Y2E9_MANLE/37-193   AC A0A2K5Y2E9.1
#=GS M3W6W1_FELCA/36-211       AC M3W6W1.3
#=GS A0A1W0A3G6_9STRA/3-151    AC A0A1W0A3G6.1
#=GS A0A2B4SL49_STYPI/31-197   AC A0A2B4SL49.1
#=GS C3Y1A9_BRAFL/1018-1187    AC C3Y1A9.1
#=GS A0A2K5VIZ1_MACFA/34-204   AC A0A2K5VIZ1.1
#=GS A0A091HRR1_CALAN/31-206   AC A0A091HRR1.1
#=GS A0A3Q7ST53_VULVU/31-206   AC A0A3Q7ST53.1
#=GS W5PV41_SHEEP/44-193       AC W5PV41.1
#=GS A0A452J254_9SAUR/5-158    AC A0A452J254.1
#=GS A0A3B4TGF8_SERDU/84-247   AC A0A3B4TGF8.1
#=GS A0A2K6M560_RHIBE/36-211   AC A0A2K6M560.1
#=GS G3H9G2_CRIGR/35-217       AC G3H9G2.1
#=GS A0A3M6UQR0_9CNID/23-165   AC A0A3M6UQR0.1
#=GS G5C7E9_HETGA/38-220       AC G5C7E9.1
#=GS F7GDT7_ORNAN/49-210       AC F7GDT7.1
#=GS A0A2K5U044_MACFA/47-110   AC A0A2K5U044.1
#=GS A7RFR7_NEMVE/32-212       AC A7RFR7.1
#=GS A0A0A0LIV4_CUCSA/61-218   AC A0A0A0LIV4.1
#=GS A0A2K6AU68_MACNE/42-105   AC A0A2K6AU68.1
#=GS A0A3B3BM95_ORYME/37-197   AC A0A3B3BM95.1
#=GS A0A1U7U5A7_TARSY/1-120    AC A0A1U7U5A7.2
#=GS A0A2K6FL00_PROCO/44-200   AC A0A2K6FL00.1
#=GS A0A4D8YN41_SALSN/47-195   AC A0A4D8YN41.1
#=GS A0A3P8SEP0_AMPPE/35-196   AC A0A3P8SEP0.1
#=GS A0A0R0EQG0_SOYBN/26-187   AC A0A0R0EQG0.1
#=GS A0A2R8ZNL9_PANPA/59-197   AC A0A2R8ZNL9.1
#=GS L8GFZ8_ACACA/30-205       AC L8GFZ8.1
#=GS A0A445D0E6_ARAHY/64-227   AC A0A445D0E6.1
#=GS FOLR3_HUMAN/36-211        AC P41439.2
#=GS G3WEP7_SARHA/38-221       AC G3WEP7.1
#=GS A0A2K5HJX9_COLAP/3-164    AC A0A2K5HJX9.1
#=GS A0A2R2MMB2_LINUN/30-196   AC A0A2R2MMB2.1
#=GS A0A1S4E7H0_DIACI/30-203   AC A0A1S4E7H0.1
#=GS A0A091VTR1_NIPNI/3-165    AC A0A091VTR1.1
#=GS A0A493TNU4_ANAPP/26-142   AC A0A493TNU4.1
#=GS A0A287BLX2_PIG/123-298    AC A0A287BLX2.1
#=GS A0A2Y9EA12_TRIMA/27-167   AC A0A2Y9EA12.1
#=GS A0A3N7FTV4_POPTR/97-260   AC A0A3N7FTV4.1
#=GS E9PXB4_MOUSE/3-172        AC E9PXB4.1
#=GS A0A3P9PHL6_POERE/26-201   AC A0A3P9PHL6.1
#=GS A0A1S4CM70_TOBAC/41-192   AC A0A1S4CM70.1
#=GS A0A2D0QV96_ICTPU/30-191   AC A0A2D0QV96.1
#=GS A0A0E0K1U5_ORYPU/51-203   AC A0A0E0K1U5.1
#=GS A0A096N631_PAPAN/38-220   AC A0A096N631.2
#=GS A0A067EYB3_CITSI/29-191   AC A0A067EYB3.1
#=GS A0A2K5JC57_COLAP/26-208   AC A0A2K5JC57.1
#=GS A0A087WXL1_HUMAN/36-211   AC A0A087WXL1.1
#=GS F1N9X0_CHICK/32-207       AC F1N9X0.1
#=GS S4RV82_PETMA/14-175       AC S4RV82.1
#=GS C3Y0S5_BRAFL/9-176        AC C3Y0S5.1
#=GS F7HEU3_MACMU/59-196       AC F7HEU3.2
#=GS A0A3Q1M7F5_BOVIN/1-167    AC A0A3Q1M7F5.1
#=GS A0A267FFW1_9PLAT/45-230   AC A0A267FFW1.1
#=GS A0A0R3VYB7_TAEAS/36-176   AC A0A0R3VYB7.1
#=GS A0A0E0DQT1_9ORYZ/69-169   AC A0A0E0DQT1.1
#=GS D3ZWD2_RAT/27-208         AC D3ZWD2.1
#=GS C3Z5S2_BRAFL/245-319      AC C3Z5S2.1
#=GS A0A2K5U025_MACFA/36-211   AC A0A2K5U025.1
#=GS A0A1I8HSL7_9PLAT/30-182   AC A0A1I8HSL7.1
#=GS A0A2K6BUN2_MACNE/59-198   AC A0A2K6BUN2.1
#=GS A0A2K5MD83_CERAT/38-220   AC A0A2K5MD83.1
#=GS A0A2Y9NAF4_DELLE/31-192   AC A0A2Y9NAF4.1
#=GS A0A2I3GFZ2_NOMLE/22-183   AC A0A2I3GFZ2.1
#=GS A0A3Q1AZX0_AMPOC/26-207   AC A0A3Q1AZX0.1
#=GS A0A3Q2X1N8_HAPBU/46-208   AC A0A3Q2X1N8.1
#=GS T1HFT3_RHOPR/43-223       AC T1HFT3.1
#=GS A0A2K5J707_COLAP/36-211   AC A0A2K5J707.1
#=GS I7MLY4_TETTS/44-200       AC I7MLY4.2
#=GS D4A700_RAT/43-205         AC D4A700.1
#=GS A0A369RYD5_9METZ/32-204   AC A0A369RYD5.1
#=GS M7B581_CHEMY/175-231      AC M7B581.1
#=GS A0A226P2F6_COLVI/61-236   AC A0A226P2F6.1
#=GS A0A151PFV0_ALLMI/250-413  AC A0A151PFV0.1
#=GS A0A433SXA2_ELYCH/50-186   AC A0A433SXA2.1
#=GS A0A1L8GMA4_XENLA/21-187   AC A0A1L8GMA4.1
#=GS A0A2K6V1S4_SAIBB/2-158    AC A0A2K6V1S4.1
#=GS A0A2I3G994_NOMLE/47-159   AC A0A2I3G994.1
#=GS A0A444SGI4_ARMVU/28-213   AC A0A444SGI4.1
#=GS A0A2I4B6U9_9TELE/23-198   AC A0A2I4B6U9.1
#=GS A0A2I0MGT7_COLLI/32-165   AC A0A2I0MGT7.1
#=GS F6TAH8_HORSE/47-209       AC F6TAH8.2
#=GS A0A093ICM0_DRYPU/34-213   AC A0A093ICM0.1
#=GS A0A087WYI3_HUMAN/36-178   AC A0A087WYI3.1
#=GS A0A3Q1HYP2_ANATE/38-208   AC A0A3Q1HYP2.1
#=GS A0A401PDQ3_SCYTO/118-173  AC A0A401PDQ3.1
#=GS F6U317_XENTR/38-218       AC F6U317.1
#=GS T1F9I2_HELRO/85-230       AC T1F9I2.1
#=GS L9JAA1_TUPCH/41-180       AC L9JAA1.1
#=GS A0A078G1F5_BRANA/41-174   AC A0A078G1F5.1
#=GS A0A287DAZ0_ICTTR/26-163   AC A0A287DAZ0.1
#=GS A0A402FJS7_9SAUR/51-226   AC A0A402FJS7.1
#=GS A0A3B3QLY5_9TELE/23-179   AC A0A3B3QLY5.1
#=GS G3GRC1_CRIGR/155-317      AC G3GRC1.1
#=GS A0A226NM25_CALSU/21-80    AC A0A226NM25.1
#=GS A0A2R6Q6Z9_ACTCH/41-189   AC A0A2R6Q6Z9.1
#=GS A0A0W8DQ05_PHYNI/33-184   AC A0A0W8DQ05.1
#=GS A0A2I3GJ26_NOMLE/36-182   AC A0A2I3GJ26.1
#=GS A0A3B3D819_ORYME/58-220   AC A0A3B3D819.1
#=GS A0A3Q7UL67_VULVU/38-220   AC A0A3Q7UL67.1
#=GS A0A433T103_ELYCH/56-152   AC A0A433T103.1
#=GS A0A0D9QVZ8_CHLSB/36-211   AC A0A0D9QVZ8.1
#=GS I3JZH8_ORENI/53-214       AC I3JZH8.1
#=GS A0A2Y9DWW6_TRIMA/35-210   AC A0A2Y9DWW6.1
#=GS A0A2G9IAB8_9LAMI/30-190   AC A0A2G9IAB8.1
#=GS H2Y7Z2_CIOSA/28-200       AC H2Y7Z2.1
#=GS K7F9U1_PELSI/34-216       AC K7F9U1.1
#=GS A0A452R4D9_URSAM/2-160    AC A0A452R4D9.1
#=GS A0A1S3JEC0_LINUN/32-206   AC A0A1S3JEC0.1
#=GS A0A3Q1IZL8_ANATE/4-165    AC A0A3Q1IZL8.1
#=GS A0A3B1ILS7_ASTMX/7-179    AC A0A3B1ILS7.1
#=GS A0A2K5NV62_CERAT/59-198   AC A0A2K5NV62.1
#=GS M3XXW1_MUSPF/44-206       AC M3XXW1.1
#=GS A0A452DRC1_CAPHI/39-221   AC A0A452DRC1.1
#=GS A0A2Y9KGJ5_ENHLU/38-220   AC A0A2Y9KGJ5.1
#=GS A0A3Q0GJ09_ALLSI/26-189   AC A0A3Q0GJ09.1
#=GS C0PIQ9_MAIZE/45-197       AC C0PIQ9.1
#=GS A0A2K5XL08_MANLE/3-164    AC A0A2K5XL08.1
#=GS C3XUF6_BRAFL/6-176        AC C3XUF6.1
#=GS I3JBR0_ORENI/37-208       AC I3JBR0.1
#=GS A0A3P8Y484_ESOLU/29-207   AC A0A3P8Y484.1
#=GS G3VZT1_SARHA/24-186       AC G3VZT1.1
#=GS P79388_PIG/30-205         AC P79388.1
#=GS A0A166I3N8_DAUCS/42-190   AC A0A166I3N8.1
#=GS F6VRR1_CALJA/3-164        AC F6VRR1.2
#=GS A0A091FGB2_9AVES/29-204   AC A0A091FGB2.1
#=GS A0A2U3WRC2_ODORO/38-220   AC A0A2U3WRC2.1
#=GS A0A2Y9MH67_DELLE/34-209   AC A0A2Y9MH67.1
#=GS C1EEA4_MICCC/25-217       AC C1EEA4.1
#=GS F1MI35_BOVIN/31-192       AC F1MI35.2
#=GS D3YZI1_MOUSE/26-143       AC D3YZI1.1
#=GS A0A287A7L0_PIG/29-204     AC A0A287A7L0.1
#=GS A0A452STC7_URSAM/31-206   AC A0A452STC7.1
#=GS A0A218VFA8_9PASE/21-188   AC A0A218VFA8.1
#=GS A0A2K6LAI1_RHIBE/38-220   AC A0A2K6LAI1.1
#=GS A0A1B0GSV4_MOUSE/29-177   AC A0A1B0GSV4.1
#=GS A0A091CNP1_FUKDA/38-220   AC A0A091CNP1.1
#=GS M7AZZ7_CHEMY/7-169        AC M7AZZ7.1
#=GS E2QXC4_CANLF/31-206       AC E2QXC4.2
#=GS G3V8M6_RAT/34-209         AC G3V8M6.1
#=GS A0A2K6BUN5_MACNE/27-183   AC A0A2K6BUN5.1
#=GS U3IEN3_ANAPP/21-188       AC U3IEN3.2
#=GS C3Y1A9_BRAFL/1229-1397    AC C3Y1A9.1
#=GS G1LZN7_AILME/31-206       AC G1LZN7.1
#=GS A0A452DRC4_CAPHI/39-221   AC A0A452DRC4.1
#=GS A0A3M0KHC3_HIRRU/30-205   AC A0A3M0KHC3.1
#=GS A0A455C822_PHYMC/44-219   AC A0A455C822.1
#=GS A0A2K6UFM4_SAIBB/38-220   AC A0A2K6UFM4.1
#=GS A0A1D5R4Y4_MACMU/47-115   AC A0A1D5R4Y4.1
#=GS A0A452QBA6_URSAM/27-202   AC A0A452QBA6.1
#=GS A0A452HYW3_9SAUR/63-225   AC A0A452HYW3.1
#=GS W4YAJ7_STRPU/312-484      AC W4YAJ7.1
#=GS C3YZN7_BRAFL/18-189       AC C3YZN7.1
#=GS A0A287D157_ICTTR/26-201   AC A0A287D157.1
#=GS I3MG93_ICTTR/34-209       AC I3MG93.1
#=GS F6UZU3_CALJA/38-220       AC F6UZU3.2
#=GS F5GZ45_HUMAN/41-180       AC F5GZ45.8
#=GS G3NYD9_GASAC/25-200       AC G3NYD9.1
#=GS K7EN64_HUMAN/27-130       AC K7EN64.1
#=GS R0JTG2_ANAPL/1-98         AC R0JTG2.1
#=GS A0A2G5DM75_AQUCA/36-190   AC A0A2G5DM75.1
#=GS A0A2K6M558_RHIBE/36-211   AC A0A2K6M558.1
#=GS C1EAB4_MICCC/27-183       AC C1EAB4.1
#=GS G3Q9P9_GASAC/34-195       AC G3Q9P9.1
#=GS A0A3B3Y5F4_9TELE/26-204   AC A0A3B3Y5F4.1
#=GS K7G8A6_PELSI/63-225       AC K7G8A6.1
#=GS A0A3Q4GF04_NEOBR/57-219   AC A0A3Q4GF04.1
#=GS A0A267EHC0_9PLAT/23-164   AC A0A267EHC0.1
#=GS A0A2K6ALM9_MACNE/47-206   AC A0A2K6ALM9.1
#=GS A0A3Q2KTY9_HORSE/7-170    AC A0A3Q2KTY9.1
#=GS K7F9T5_PELSI/35-217       AC K7F9T5.1
#=GS A0A3B1J8J3_ASTMX/36-197   AC A0A3B1J8J3.1
#=GS A0A3P9CAW3_9CICH/36-208   AC A0A3P9CAW3.1
#=GS F5H5L8_HUMAN/76-148       AC F5H5L8.1
#=GS A0A3M7R1L6_BRAPC/55-197   AC A0A3M7R1L6.1
#=GS A0A3Q4GHF8_NEOBR/11-184   AC A0A3Q4GHF8.1
#=GS A0A337S7S7_FELCA/48-207   AC A0A337S7S7.1
#=GS A0A0E0CMR2_9ORYZ/49-201   AC A0A0E0CMR2.1
#=GS A0A452GGX8_9SAUR/41-195   AC A0A452GGX8.1
#=GS A0A0L8HL22_OCTBM/38-170   AC A0A0L8HL22.1
#=GS A0A091VRV6_OPIHO/31-206   AC A0A091VRV6.1
#=GS A0A1A6GQV6_NEOLE/38-138   AC A0A1A6GQV6.1
#=GS A0A0L9TY98_PHAAN/26-186   AC A0A0L9TY98.1
#=GS A0A1V4KC84_PATFA/8-144    AC A0A1V4KC84.1
#=GS A0A3S1A5C9_ELYCH/35-126   AC A0A3S1A5C9.1
#=GS A0A3Q3FZF7_9LABR/27-200   AC A0A3Q3FZF7.1
#=GS A0A402EZX3_9SAUR/41-202   AC A0A402EZX3.1
#=GS FOLR2_MOUSE/29-203        AC Q05685.1
#=GS A0A3B3BC65_ORYME/36-214   AC A0A3B3BC65.1
#=GS K7F2T8_PELSI/26-195       AC K7F2T8.1
#=GS D7L3W2_ARALL/34-192       AC D7L3W2.1
#=GS A0A2R8MSW7_CALJA/36-211   AC A0A2R8MSW7.1
#=GS A0A452FHW0_CAPHI/30-205   AC A0A452FHW0.1
#=GS A0A0A0AII1_CHAVO/31-206   AC A0A0A0AII1.1
#=GS A0A091IPD0_EGRGA/3-165    AC A0A091IPD0.1
#=GS A0A1S3JNN2_LINUN/79-248   AC A0A1S3JNN2.1
#=GS A0A1D1UEU9_RAMVA/47-164   AC A0A1D1UEU9.1
#=GS A0A3Q3RTD1_9TELE/33-207   AC A0A3Q3RTD1.1
#=GS M3YEQ8_MUSPF/43-111       AC M3YEQ8.1
#=GS A0A3Q7R261_VULVU/27-177   AC A0A3Q7R261.1
#=GS F4K5P7_ARATH/38-198       AC F4K5P7.1
#=GS A0A1S4CHA6_TOBAC/41-192   AC A0A1S4CHA6.1
#=GS G1PPC4_MYOLU/31-206       AC G1PPC4.1
#=GS G5AVT7_HETGA/132-307      AC G5AVT7.1
#=GS A0A087WWY2_HUMAN/47-129   AC A0A087WWY2.1
#=GS A0A2C9LYG6_BIOGL/68-214   AC A0A2C9LYG6.1
#=GS A0A1U8CEV7_MESAU/38-220   AC A0A1U8CEV7.1
#=GS A0A452DRI5_CAPHI/39-221   AC A0A452DRI5.1
#=GS A0A287A261_PIG/21-193     AC A0A287A261.1
#=GS A0A401RF46_CHIPU/9-170    AC A0A401RF46.1
#=GS A0A2K5RKE5_CEBCA/36-211   AC A0A2K5RKE5.1
#=GS M7B581_CHEMY/56-153       AC M7B581.1
#=GS C3Y1A9_BRAFL/34-203       AC C3Y1A9.1
#=GS V4KLW5_EUTSA/37-198       AC V4KLW5.1
#=GS J3KR13_HUMAN/3-164        AC J3KR13.1
#=GS A0A091IFN5_CALAN/21-188   AC A0A091IFN5.1
#=GS A0A2R8ZPX1_PANPA/37-193   AC A0A2R8ZPX1.1
#=GS A0A1U7UUD1_TARSY/44-206   AC A0A1U7UUD1.1
#=GS A0A3P8X980_ESOLU/34-195   AC A0A3P8X980.1
#=GS K8EY55_9CHLO/29-238       AC K8EY55.1
#=GS A0A2I3LU31_PAPAN/26-208   AC A0A2I3LU31.1
#=GS A7SH49_NEMVE/214-341      AC A7SH49.1
#=GS F2U311_SALR5/18-154       AC F2U311.1
#=GS A0A3B5AU80_9TELE/41-202   AC A0A3B5AU80.1
#=GS A0A3B3QN53_9TELE/56-218   AC A0A3B3QN53.1
#=GS A0A3M0KM39_HIRRU/35-226   AC A0A3M0KM39.1
#=GS A0A3Q3FCG3_9LABR/28-170   AC A0A3Q3FCG3.1
#=GS E9PXL5_MOUSE/34-160       AC E9PXL5.1
#=GS A0A091G6J4_9AVES/21-188   AC A0A091G6J4.1
#=GS A0A060WNV0_ONCMY/1-143    AC A0A060WNV0.1
#=GS A0A2C9VH51_MANES/29-193   AC A0A2C9VH51.1
#=GS A0C2I4_PARTE/29-192       AC A0C2I4.1
#=GS A0A2K6UFL6_SAIBB/38-220   AC A0A2K6UFL6.1
#=GS A0A1S3WI24_ERIEU/4-133    AC A0A1S3WI24.1
#=GS A0A2Y9QCS1_DELLE/38-220   AC A0A2Y9QCS1.1
#=GS A0A2K6LAH7_RHIBE/38-220   AC A0A2K6LAH7.1
#=GS A0A1S3W8Y0_ERIEU/35-149   AC A0A1S3W8Y0.1
#=GS A0A402F1K4_9SAUR/20-181   AC A0A402F1K4.1
#=GS A0A2P6R7B4_ROSCH/26-188   AC A0A2P6R7B4.1
#=GS H9KWL0_CALJA/45-205       AC H9KWL0.2
#=GS A0A2U3VBB8_ODORO/31-206   AC A0A2U3VBB8.1
#=GS A0A445IMT1_GLYSO/40-203   AC A0A445IMT1.1
#=GS S4REP9_PETMA/28-195       AC S4REP9.1
#=GS Q7ZWL5_XENLA/38-218       AC Q7ZWL5.1
#=GS A0A2K5RJT0_CEBCA/3-164    AC A0A2K5RJT0.1
#=GS A0A398AQG5_BRACM/10-157   AC A0A398AQG5.1
#=GS A0A3L8RUH4_CHLGU/28-185   AC A0A3L8RUH4.1
#=GS A0A383ZAD1_BALAS/27-177   AC A0A383ZAD1.1
#=GS A0A3Q2HQY6_HORSE/47-181   AC A0A3Q2HQY6.1
#=GS F7CKM1_MONDO/29-205       AC F7CKM1.2
#=GS L8Y6R5_TUPCH/159-321      AC L8Y6R5.1
#=GS A0A099YTJ8_TINGU/21-188   AC A0A099YTJ8.1
#=GS A0A384DKN2_URSMA/2-161    AC A0A384DKN2.1
#=GS F6TB36_CIOIN/101-235      AC F6TB36.1
#=GS A0A452GAF9_CAPHI/26-201   AC A0A452GAF9.1
#=GS R0LWV5_ANAPL/5-131        AC R0LWV5.1
#=GS A0A2U9B5E4_SCOMX/23-198   AC A0A2U9B5E4.1
#=GS A0A096MER3_POEFO/51-213   AC A0A096MER3.1
#=GS A0A2Y9M7R2_DELLE/26-201   AC A0A2Y9M7R2.1
#=GS W5P256_SHEEP/30-205       AC W5P256.1
#=GS A0A0L0DUQ8_THETB/85-215   AC A0A0L0DUQ8.1
#=GS A0A498MI10_LABRO/33-194   AC A0A498MI10.1
#=GS A0A3Q7WLE2_URSAR/30-205   AC A0A3Q7WLE2.1
#=GS A0A2Y9T990_PHYMC/26-210   AC A0A2Y9T990.1
#=GS J3LEC8_ORYBR/50-202       AC J3LEC8.1
#=GS A0A1S2XY02_CICAR/50-210   AC A0A1S2XY02.1
#=GS A0A059B6W0_EUCGR/107-259  AC A0A059B6W0.1
#=GS A0A1S3JEV8_LINUN/34-211   AC A0A1S3JEV8.1
#=GS G3T5H0_LOXAF/38-220       AC G3T5H0.1
#=GS A0A090N3T5_OSTTA/66-215   AC A0A090N3T5.1
#=GS HHIP_HUMAN/38-220         AC Q96QV1.3
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO5 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG3 D; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO3 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFT A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFX B; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO4 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO5 B; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO4 B; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG3 C; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG4 B; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFT B; 214-220;
#=GS A0A3P8UW36_CYNSE/30-191   AC A0A3P8UW36.1
#=GS M3XV43_MUSPF/2-158        AC M3XV43.1
#=GS A0A3Q3KT30_9TELE/57-219   AC A0A3Q3KT30.1
#=GS A0A1U8BVG3_MESAU/28-189   AC A0A1U8BVG3.2
#=GS A0A2I2YAE8_GORGO/47-123   AC A0A2I2YAE8.1
#=GS A0A1U7SJ35_ALLSI/26-201   AC A0A1U7SJ35.1
#=GS A0A2K5U042_MACFA/3-164    AC A0A2K5U042.1
#=GS A0A3Q0FMJ2_ALLSI/1-118    AC A0A3Q0FMJ2.1
#=GS A0A0P7UWH9_SCLFO/36-215   AC A0A0P7UWH9.1
#=GS A0A2I0LYY8_COLLI/21-188   AC A0A2I0LYY8.1
#=GS J3KNP7_HUMAN/26-208       AC J3KNP7.8
#=GS A0A0G4E8A7_VITBC/54-214   AC A0A0G4E8A7.1
#=GS W2MJ21_PHYPR/33-184       AC W2MJ21.1
#=GS A0A3P8TN64_AMPPE/23-198   AC A0A3P8TN64.1
#=GS A0A2K5J2T1_COLAP/37-193   AC A0A2K5J2T1.1
#=GS A0A3B4YF19_SERLL/23-198   AC A0A3B4YF19.1
#=GS V4TAS2_9ROSI/29-191       AC V4TAS2.1
#=GS A0A0D3AFH3_BRAOL/41-180   AC A0A0D3AFH3.1
#=GS U3DHV8_CALJA/30-205       AC U3DHV8.1
#=GS D2H3P9_AILME/38-220       AC D2H3P9.1
#=GS A0A2Y9KWZ6_ENHLU/36-216   AC A0A2Y9KWZ6.1
#=GS A0A2I0LJU9_COLLI/25-165   AC A0A2I0LJU9.1
#=GS A0A0P1A6E2_PLAHL/31-166   AC A0A0P1A6E2.1
#=GS A0A2I3SDD1_PANTR/59-197   AC A0A2I3SDD1.1
#=GS A0A0E0CMR1_9ORYZ/49-201   AC A0A0E0CMR1.1
#=GS A0A091WNI0_OPIHO/3-129    AC A0A091WNI0.1
#=GS A0A1U7RC80_MESAU/26-200   AC A0A1U7RC80.1
#=GS A0A1D1UWU8_RAMVA/1-120    AC A0A1D1UWU8.1
#=GS A0A2K5PVM9_CEBCA/26-208   AC A0A2K5PVM9.1
#=GS A0A3Q4MBA7_NEOBR/4-188    AC A0A3Q4MBA7.1
#=GS A0A2K6RR38_RHIRO/3-164    AC A0A2K6RR38.1
#=GS A0A3B3VSB5_9TELE/35-196   AC A0A3B3VSB5.1
#=GS D4A4S5_RAT/29-204         AC D4A4S5.1
#=GS A0A452ST55_URSAM/1-159    AC A0A452ST55.1
#=GS A0A452HZQ9_9SAUR/33-208   AC A0A452HZQ9.1
#=GS G3TSN2_LOXAF/26-201       AC G3TSN2.1
#=GS F7CR90_MACMU/47-222       AC F7CR90.2
#=GS H2QFH1_PANTR/59-215       AC H2QFH1.1
#=GS F5H4Z6_HUMAN/30-171       AC F5H4Z6.1
#=GS H2Q4K3_PANTR/26-208       AC H2Q4K3.2
#=GS A0A383ZAP8_BALAS/44-203   AC A0A383ZAP8.1
#=GS A0A2K5WWK8_MACFA/22-183   AC A0A2K5WWK8.1
#=GS H3CCK2_TETNG/24-200       AC H3CCK2.1
#=GS A0A445BKX0_ARAHY/45-206   AC A0A445BKX0.1
#=GS V3YZA4_LOTGI/28-191       AC V3YZA4.1
#=GS G1KAA7_ANOCA/44-206       AC G1KAA7.1
#=GS A0A3B3HVB9_ORYLA/28-206   AC A0A3B3HVB9.1
#=GS A0A340XV58_LIPVE/38-220   AC A0A340XV58.1
#=GS A0A1S3JE46_LINUN/5-93     AC A0A1S3JE46.1
#=GS A0A3S1A7A7_ELYCH/1-138    AC A0A3S1A7A7.1
#=GS C6T7F8_SOYBN/40-203       AC C6T7F8.1
#=GS A0A3B3T0T9_9TELE/34-162   AC A0A3B3T0T9.1
#=GS A0A2K5QH49_CEBCA/34-199   AC A0A2K5QH49.1
#=GS A0A340Y7G3_LIPVE/27-183   AC A0A340Y7G3.1
#=GS A0A3B4FST5_9CICH/21-183   AC A0A3B4FST5.1
#=GS A0A2K5WWK3_MACFA/22-183   AC A0A2K5WWK3.1
#=GS A0A3B3IIT4_ORYLA/37-218   AC A0A3B3IIT4.1
#=GS A0A2Y9KUE2_ENHLU/13-188   AC A0A2Y9KUE2.1
#=GS A0A2K6KIA1_RHIBE/47-110   AC A0A2K6KIA1.1
#=GS A0A2K6MFR4_RHIBE/47-206   AC A0A2K6MFR4.1
#=GS A0A2K6UA21_SAIBB/30-205   AC A0A2K6UA21.1
#=GS A0A3Q1M762_BOVIN/201-256  AC A0A3Q1M762.1
#=GS A0A1S3JE36_LINUN/50-146   AC A0A1S3JE36.1
#=GS A0A2R9ABR9_PANPA/36-211   AC A0A2R9ABR9.1
#=GS A0A2I3RVZ9_PANTR/47-201   AC A0A2I3RVZ9.1
#=GS M4FHF9_BRARP/205-369      AC M4FHF9.1
#=GS A0A3B4X2Y0_SERLL/37-209   AC A0A3B4X2Y0.1
#=GS A0A3Q2H8S4_HORSE/29-160   AC A0A3Q2H8S4.1
#=GS A0A2R6RGD4_ACTCH/41-190   AC A0A2R6RGD4.1
#=GS A0A4D9DVA7_9SAUR/26-226   AC A0A4D9DVA7.1
#=GS A0A2I3MYB7_PAPAN/38-220   AC A0A2I3MYB7.1
#=GS A0A2K6NI78_RHIRO/26-208   AC A0A2K6NI78.1
#=GS A0A1V4J5R4_PATFA/108-283  AC A0A1V4J5R4.1
#=GS A0A1A6FXD0_NEOLE/1-103    AC A0A1A6FXD0.1
#=GS A0A2I3LNK9_PAPAN/59-198   AC A0A2I3LNK9.1
#=GS K7EB72_ORNAN/22-189       AC K7EB72.1
#=GS A0A3B3SB10_9TELE/32-203   AC A0A3B3SB10.1
#=GS L9LDL7_TUPCH/163-317      AC L9LDL7.1
#=GS F1STK4_PIG/26-201         AC F1STK4.3
#=GS A0A2I0VYK1_9ASPA/46-197   AC A0A2I0VYK1.1
#=GS A0A091JJM0_EGRGA/3-129    AC A0A091JJM0.1
#=GS A0A0R3UJB2_9CEST/36-228   AC A0A0R3UJB2.1
#=GS C3YF31_BRAFL/56-188       AC C3YF31.1
#=GS A0A1S3KCF9_LINUN/33-205   AC A0A1S3KCF9.1
#=GS A0A1V4JX64_PATFA/158-325  AC A0A1V4JX64.1
#=GS H2M6E9_ORYLA/23-198       AC H2M6E9.2
#=GS A0A087XS24_POEFO/23-198   AC A0A087XS24.2
#=GS A0A091CNE7_FUKDA/43-193   AC A0A091CNE7.1
#=GS L8GFZ8_ACACA/320-468      AC L8GFZ8.1
#=GS U3JIW3_FICAL/7-168        AC U3JIW3.1
#=GS F7CGN2_XENTR/29-204       AC F7CGN2.1
#=GS A0A1S3BYL2_CUCME/33-190   AC A0A1S3BYL2.1
#=GS A0A3Q1MRP4_BOVIN/30-205   AC A0A3Q1MRP4.1
#=GS G1LGF8_AILME/44-124       AC G1LGF8.1
#=GS A0A1R3JTK2_COCAP/42-205   AC A0A1R3JTK2.1
#=GS G1LY46_AILME/1-102        AC G1LY46.1
#=GS H3CIM9_TETNG/5-160        AC H3CIM9.1
#=GS A0A2K6AU50_MACNE/42-217   AC A0A2K6AU50.1
#=GS A0A124SAH4_CYNCS/279-427  AC A0A124SAH4.1
#=GS A0A2Y9E1U1_TRIMA/26-201   AC A0A2Y9E1U1.1
#=GS A0A3Q2CIF1_CYPVA/60-221   AC A0A3Q2CIF1.1
#=GS A0A2K5D9K7_AOTNA/47-201   AC A0A2K5D9K7.1
#=GS A0A2I0J249_PUNGR/24-199   AC A0A2I0J249.1
#=GS J9NX36_CANLF/1-147        AC J9NX36.1
#=GS G3Q9Q0_GASAC/1-143        AC G3Q9Q0.1
#=GS G1TPC2_RABIT/10-130       AC G1TPC2.1
#=GS G3WWL1_SARHA/29-194       AC G3WWL1.1
#=GS A0A383ZEX0_BALAS/30-205   AC A0A383ZEX0.1
#=GS A0A099YZJ2_TINGU/4-129    AC A0A099YZJ2.1
#=GS W5NUZ8_SHEEP/20-195       AC W5NUZ8.1
#=GS A0A1S3F111_DIPOR/29-204   AC A0A1S3F111.1
#=GS A0A2Y9F7K9_PHYMC/38-220   AC A0A2Y9F7K9.1
#=GS A0A401PDB6_SCYTO/37-133   AC A0A401PDB6.1
#=GS A0A2K6U9X6_SAIBB/1-174    AC A0A2K6U9X6.1
#=GS H0YWX7_TAEGU/34-216       AC H0YWX7.1
#=GS A0A3P9Q3Q5_POERE/23-198   AC A0A3P9Q3Q5.1
#=GS A0A0D9VHR3_9ORYZ/41-193   AC A0A0D9VHR3.1
#=GS A0A329S9C2_9STRA/33-184   AC A0A329S9C2.1
#=GS A0A2K6Q6I5_RHIRO/59-198   AC A0A2K6Q6I5.1
#=GS A0A093Q978_9PASS/1-139    AC A0A093Q978.1
#=GS A0A1S3JP76_LINUN/35-178   AC A0A1S3JP76.1
#=GS W5P1W2_SHEEP/35-210       AC W5P1W2.1
#=GS A0A226MGQ3_CALSU/59-234   AC A0A226MGQ3.1
#=GS A0A2K6GD42_PROCO/36-211   AC A0A2K6GD42.1
#=GS A0A2U9CRZ8_SCOMX/28-203   AC A0A2U9CRZ8.1
#=GS A0A2T7F8G7_9POAL/45-196   AC A0A2T7F8G7.1
#=GS H3ASX4_LATCH/39-187       AC H3ASX4.1
#=GS A0A1D5QAK3_MACMU/22-183   AC A0A1D5QAK3.1
#=GS A0A340XVA8_LIPVE/30-205   AC A0A340XVA8.1
#=GS A0A078GMG4_BRANA/3-101    AC A0A078GMG4.1
#=GS A0A226MRY7_COLVI/2-92     AC A0A226MRY7.1
#=GS A0A0K9PKS2_ZOSMR/44-193   AC A0A0K9PKS2.1
#=GS A0A2U3VKW6_ODORO/27-188   AC A0A2U3VKW6.1
#=GS A0A452HZT4_9SAUR/26-208   AC A0A452HZT4.1
#=GS A0A2K6GLL0_PROCO/22-183   AC A0A2K6GLL0.1
#=GS A0A061F3A3_THECC/42-205   AC A0A061F3A3.1
#=GS R4GC40_ANOCA/31-192       AC R4GC40.1
#=GS A0A286Y3Q3_CAVPO/38-220   AC A0A286Y3Q3.1
#=GS A0A397XQY0_BRACM/38-198   AC A0A397XQY0.1
#=GS A4S053_OSTLU/1-131        AC A4S053.1
#=GS A0A1S3F1E4_DIPOR/45-206   AC A0A1S3F1E4.1
#=GS A0A384BWL5_URSMA/27-202   AC A0A384BWL5.1
#=GS A0A3B3T6P1_9TELE/41-215   AC A0A3B3T6P1.1
#=GS A0A2R9CTI8_PANPA/37-208   AC A0A2R9CTI8.1
#=GS A0A2K5RGP9_CEBCA/20-181   AC A0A2K5RGP9.1
#=GS A0A200PWQ4_9MAGN/26-189   AC A0A200PWQ4.1
#=GS A0A096MMB1_PAPAN/36-211   AC A0A096MMB1.1
#=GS M1CAU9_SOLTU/41-192       AC M1CAU9.1
#=GS A0A3Q0RMK5_AMPCI/30-205   AC A0A3Q0RMK5.1
#=GS F6Z059_XENTR/53-214       AC F6Z059.1
#=GS A0A0L0FZI6_9EUKA/26-177   AC A0A0L0FZI6.1
#=GS F7IF74_CALJA/59-215       AC F7IF74.1
#=GS C0HAY9_SALSA/29-207       AC C0HAY9.1
#=GS A0A3B6QER5_WHEAT/44-197   AC A0A3B6QER5.1
#=GS A0A2K5LBG7_CERAT/36-211   AC A0A2K5LBG7.1
#=GS A0A3Q2WVY0_HAPBU/36-208   AC A0A3Q2WVY0.1
#=GS K3YUK0_SETIT/45-198       AC K3YUK0.1
#=GS A0A2Y9K9W1_ENHLU/27-201   AC A0A2Y9K9W1.1
#=GS A0A2K6AU36_MACNE/36-211   AC A0A2K6AU36.1
#=GS G3TYX8_LOXAF/28-189       AC G3TYX8.1
#=GS Q5CX08_CRYPI/39-218       AC Q5CX08.1
#=GS A0A2U3XGN1_LEPWE/27-177   AC A0A2U3XGN1.1
#=GS A0A2U3VBC3_ODORO/30-205   AC A0A2U3VBC3.1
#=GS A0A1A6FW57_NEOLE/34-218   AC A0A1A6FW57.1
#=GS A0A1U8D644_ALLSI/22-189   AC A0A1U8D644.1
#=GS A0A1S3JMU8_LINUN/25-193   AC A0A1S3JMU8.1
#=GS A0A2K5U027_MACFA/47-222   AC A0A2K5U027.1
#=GS I3LDJ1_PIG/192-248        AC I3LDJ1.1
#=GS A0A2K5LBK9_CERAT/47-110   AC A0A2K5LBK9.1
#=GS C3XSA1_BRAFL/90-235       AC C3XSA1.1
#=GS G1M0Y2_AILME/27-208       AC G1M0Y2.1
#=GS A0A2K5UR81_MACFA/26-208   AC A0A2K5UR81.1
#=GS A7T9S3_NEMVE/40-169       AC A7T9S3.1
#=GS G3WEP6_SARHA/39-222       AC G3WEP6.1
#=GS A0A3B6NQI2_WHEAT/47-198   AC A0A3B6NQI2.1
#=GS A0A093PCA7_9PASS/3-129    AC A0A093PCA7.1
#=GS A0A2K6ESG4_PROCO/44-206   AC A0A2K6ESG4.1
#=GS A0A2K5D9H1_AOTNA/30-205   AC A0A2K5D9H1.1
#=GS G1RQQ9_NOMLE/17-170       AC G1RQQ9.2
#=GS A0A3B4X2V9_SERLL/37-209   AC A0A3B4X2V9.1
#=GS A0A3Q4HYE0_NEOBR/5-166    AC A0A3Q4HYE0.1
#=GS A0A087R786_APTFO/31-206   AC A0A087R786.1
#=GS A0A0E0NH61_ORYRU/49-201   AC A0A0E0NH61.1
#=GS A0A2I4BP03_9TELE/38-210   AC A0A2I4BP03.1
#=GS G3QHP1_GORGO/59-215       AC G3QHP1.1
#=GS A0A384AQ25_BALAS/38-220   AC A0A384AQ25.1
#=GS A0A2K6A9J8_MANLE/34-196   AC A0A2K6A9J8.1
#=GS H2QZT5_PANTR/22-183       AC H2QZT5.2
#=GS A0A340X670_LIPVE/23-112   AC A0A340X670.1
#=GS A0A2H5PYP7_CITUN/19-195   AC A0A2H5PYP7.1
#=GS A0A2P6NF93_9MYCE/60-205   AC A0A2P6NF93.1
#=GS A0A096MUB4_PAPAN/36-211   AC A0A096MUB4.2
#=GS A0A3Q3MUQ5_9TELE/35-196   AC A0A3Q3MUQ5.1
#=GS E2QXF0_CANLF/30-205       AC E2QXF0.1
#=GS A0A2Y9DVM5_TRIMA/36-211   AC A0A2Y9DVM5.1
#=GS A0A3Q1C9Y7_AMPOC/26-199   AC A0A3Q1C9Y7.1
#=GS A0A2Y9JXW6_ENHLU/44-206   AC A0A2Y9JXW6.1
#=GS RTBDN_CANLF/27-177        AC Q4TUC0.1
#=GS A0A2G3AXK6_CAPCH/39-189   AC A0A2G3AXK6.1
#=GS A0A267GXH9_9PLAT/30-181   AC A0A267GXH9.1
#=GS A0A3B4G400_9CICH/30-205   AC A0A3B4G400.1
#=GS A0A402E919_9SAUR/36-218   AC A0A402E919.1
#=GS A0A493SVL6_ANAPP/26-124   AC A0A493SVL6.1
#=GS A0A384BNF0_URSMA/38-220   AC A0A384BNF0.1
#=GS A0A2Y9MWE7_DELLE/30-205   AC A0A2Y9MWE7.1
#=GS A0A3B5QDK3_XIPMA/26-201   AC A0A3B5QDK3.1
#=GS A0A4D9F027_9SAUR/35-217   AC A0A4D9F027.1
#=GS A0A3B4ES39_PYGNA/35-196   AC A0A3B4ES39.1
#=GS A0A3M6V221_9CNID/29-195   AC A0A3M6V221.1
#=GS G1PPC7_MYOLU/2-153        AC G1PPC7.1
#=GS A0A1S3JFL1_LINUN/32-204   AC A0A1S3JFL1.1
#=GS A0A0D9R2L1_CHLSB/1-120    AC A0A0D9R2L1.1
#=GS F6UJL7_CALJA/10-189       AC F6UJL7.2
#=GS A0A2K6SEV9_SAIBB/48-206   AC A0A2K6SEV9.1
#=GS A0A3Q4MBB3_NEOBR/34-195   AC A0A3Q4MBB3.1
#=GS U3JUU5_FICAL/47-222       AC U3JUU5.1
#=GS I3M7G9_ICTTR/27-208       AC I3M7G9.1
#=GS A0A3B3S631_9TELE/34-194   AC A0A3B3S631.1
#=GS A0A078G0I8_BRANA/33-173   AC A0A078G0I8.1
#=GS A0A0Q3UR77_AMAAE/25-186   AC A0A0Q3UR77.1
#=GS H3AU75_LATCH/19-181       AC H3AU75.1
#=GS A0A3Q1GX10_9TELE/23-198   AC A0A3Q1GX10.1
#=GS A5PJW9_BOVIN/38-220       AC A5PJW9.1
#=GS A0A3P8P3A5_ASTCA/23-198   AC A0A3P8P3A5.1
#=GS A0A3Q7X8Q3_URSAR/4-176    AC A0A3Q7X8Q3.1
#=GS A0A067EMB2_CITSI/29-192   AC A0A067EMB2.1
#=GS H2RXT6_TAKRU/35-201       AC H2RXT6.2
#=GS A0A2R9C5Y0_PANPA/26-208   AC A0A2R9C5Y0.1
#=GS A0A2K5DCK6_AOTNA/22-181   AC A0A2K5DCK6.1
#=GS A0A1S3HE47_LINUN/1-143    AC A0A1S3HE47.1
#=GS A0A3Q3B8W9_KRYMA/38-209   AC A0A3Q3B8W9.1
#=GS L8Y219_TUPCH/38-220       AC L8Y219.1
#=GS A0A2B4SH32_STYPI/41-152   AC A0A2B4SH32.1
#=GS K7EVL7_PONAB/47-222       AC K7EVL7.1
#=GS L5K8G1_PTEAL/30-205       AC L5K8G1.1
#=GS A0A2K6GQF4_PROCO/30-205   AC A0A2K6GQF4.1
#=GS A0A2K1K7J2_PHYPA/29-181   AC A0A2K1K7J2.1
#=GS C3Z7R5_BRAFL/50-177       AC C3Z7R5.1
#=GS V4A3I8_LOTGI/9-180        AC V4A3I8.1
#=GS A0A1A6FW57_NEOLE/213-297  AC A0A1A6FW57.1
#=GS A0A3B5KMZ9_TAKRU/46-215   AC A0A3B5KMZ9.1
#=GS A0A096M9D8_POEFO/15-184   AC A0A096M9D8.1
#=GS A0A1X7U4F1_AMPQE/33-210   AC A0A1X7U4F1.1
#=GS A0A091WBS1_OPIHO/3-165    AC A0A091WBS1.1
#=GS FOLR1_BOVIN/35-210        AC P02702.3
#=GS A0A2I3GV70_NOMLE/30-187   AC A0A2I3GV70.1
#=GS A0A0P7U0S1_SCLFO/29-212   AC A0A0P7U0S1.1
#=GS A0A218V2Q1_9PASE/26-187   AC A0A218V2Q1.1
#=GS A0A078HDM7_BRANA/1-131    AC A0A078HDM7.1
#=GS A0A3Q1CNW7_AMPOC/23-198   AC A0A3Q1CNW7.1
#=GS A0A2K5Q8J6_CEBCA/27-183   AC A0A2K5Q8J6.1
#=GS A0A2K5EWG4_AOTNA/36-211   AC A0A2K5EWG4.1
#=GS A0A1V4JJ80_PATFA/11-171   AC A0A1V4JJ80.1
#=GS A0A3Q0D977_MESAU/26-134   AC A0A3Q0D977.1
#=GS A0A2K5NV54_CERAT/59-215   AC A0A2K5NV54.1
#=GS A0A2U3YPW0_LEPWE/31-206   AC A0A2U3YPW0.1
#=GS C3Z5S2_BRAFL/82-229       AC C3Z5S2.1
#=GS A0A226NA06_CALSU/27-188   AC A0A226NA06.1
#=GS A0A0R3SDA3_HYMDI/36-214   AC A0A0R3SDA3.1
#=GS A0A2K5MMC2_CERAT/20-181   AC A0A2K5MMC2.1
#=GS A0A452GGV2_9SAUR/35-210   AC A0A452GGV2.1
#=GS A0A0R4IY94_DANRE/29-201   AC A0A0R4IY94.1
#=GS A0A2K6FL04_PROCO/41-168   AC A0A2K6FL04.1
#=GS E7EU04_HUMAN/43-210       AC E7EU04.2
#=GS A0A2K3LBL3_TRIPR/24-185   AC A0A2K3LBL3.1
#=GS A0A3P8WQC7_CYNSE/33-206   AC A0A3P8WQC7.1
#=GS A0A2U4AFZ5_TURTR/11-116   AC A0A2U4AFZ5.1
#=GS A0A2G9G2W0_9LAMI/30-190   AC A0A2G9G2W0.1
#=GS A0A0D9S170_CHLSB/38-220   AC A0A0D9S170.1
#=GS A0A3L8SQR4_CHLGU/21-188   AC A0A3L8SQR4.1
#=GS H3HEC3_PHYRM/33-184       AC H3HEC3.1
#=GS A0A091G927_9AVES/3-129    AC A0A091G927.1
#=GS A0A251PAD7_PRUPE/14-166   AC A0A251PAD7.1
#=GS A0A0N8K116_SCLFO/23-198   AC A0A0N8K116.1
#=GS A0A078FZH1_BRANA/153-313  AC A0A078FZH1.1
#=GS A0A3Q7RZ30_VULVU/45-206   AC A0A3Q7RZ30.1
#=GS M4FHF8_BRARP/34-173       AC M4FHF8.1
#=GS A0A1U7SPX6_TARSY/27-183   AC A0A1U7SPX6.1
#=GS A0A1S3GN12_DIPOR/27-173   AC A0A1S3GN12.1
#=GS A0A3Q7RSV4_VULVU/26-182   AC A0A3Q7RSV4.1
#=GS A0A384BN01_URSMA/38-220   AC A0A384BN01.1
#=GS A0A398AT13_BRACM/1-125    AC A0A398AT13.1
#=GS A0A2K5WE79_MACFA/38-220   AC A0A2K5WE79.1
#=GS G3SXL0_LOXAF/35-210       AC G3SXL0.1
#=GS A0A3B4ZPV2_9TELE/52-214   AC A0A3B4ZPV2.1
#=GS A0A1S3JMB2_LINUN/29-196   AC A0A1S3JMB2.1
#=GS A0A2P5AD84_PARAD/27-185   AC A0A2P5AD84.1
#=GS A0A3P9DJM5_9CICH/33-194   AC A0A3P9DJM5.1
#=GS U6ITH9_ECHGR/36-215       AC U6ITH9.1
#=GS A0A2I2ZUF7_GORGO/37-193   AC A0A2I2ZUF7.1
#=GS G3WWL0_SARHA/29-194       AC G3WWL0.1
#=GS A0A452EP42_CAPHI/44-206   AC A0A452EP42.1
#=GS A0A453NZF6_AEGTS/36-189   AC A0A453NZF6.1
#=GS A0A2U3V495_TURTR/38-220   AC A0A2U3V495.1
#=GS A0A2I2Z774_GORGO/36-206   AC A0A2I2Z774.1
#=GS A0A078G1E7_BRANA/37-201   AC A0A078G1E7.1
#=GS A0A397Z1Q3_BRACM/37-197   AC A0A397Z1Q3.1
#=GS A0A1S3JFL3_LINUN/34-209   AC A0A1S3JFL3.1
#=GS A0A287BJS7_PIG/82-257     AC A0A287BJS7.1
#=GS A0A3P9DIJ7_9CICH/33-194   AC A0A3P9DIJ7.1
#=GS A0A498LKF0_LABRO/1-143    AC A0A498LKF0.1
#=GS H2Q8W9_PANTR/22-183       AC H2Q8W9.2
#=GS A0A3B3XJI1_9TELE/11-173   AC A0A3B3XJI1.1
#=GS F6SQN2_HORSE/31-192       AC F6SQN2.2
#=GS A0A2D0S3X0_ICTPU/26-192   AC A0A2D0S3X0.1
#=GS A0A0D2U8N0_CAPO3/45-225   AC A0A0D2U8N0.1
#=GS FOLR1_MOUSE/34-209        AC P35846.2
#=GS A0A452Q700_HUMAN/34-104   AC A0A452Q700.1
#=GS K7EKV3_HUMAN/27-183       AC K7EKV3.1
#=GS F6PEI8_DANRE/34-195       AC F6PEI8.1
#=GS A0A1R3K877_9ROSI/29-193   AC A0A1R3K877.1
#=GS A0A0D9S1B0_CHLSB/26-201   AC A0A0D9S1B0.1
#=GS H9GJK4_ANOCA/31-192       AC H9GJK4.2
#=GS A0A087TW61_9ARAC/34-209   AC A0A087TW61.1
#=GS A0A1S3NQ50_SALSA/33-194   AC A0A1S3NQ50.1
#=GS M3VY61_FELCA/41-200       AC M3VY61.2
#=GS A0A2K5P851_CERAT/36-211   AC A0A2K5P851.1
#=GS A0A3Q3AF00_KRYMA/92-253   AC A0A3Q3AF00.1
#=GS A0A2K6Q6I7_RHIRO/37-193   AC A0A2K6Q6I7.1
#=GS A0A3M0K652_HIRRU/21-188   AC A0A3M0K652.1
#=GS D3Z631_MOUSE/26-172       AC D3Z631.1
#=GS A0A2C9JK01_BIOGL/16-180   AC A0A2C9JK01.1
#=GS F7H8H0_MACMU/22-183       AC F7H8H0.2
#=GS A0A2Y9F773_PHYMC/38-220   AC A0A2Y9F773.1
#=GS A0A1L8F099_XENLA/22-183   AC A0A1L8F099.1
#=GS G1SDN5_RABIT/126-287      AC G1SDN5.2
#=GS A0A452GH52_9SAUR/6-159    AC A0A452GH52.1
#=GS A0A2K6KI95_RHIBE/3-164    AC A0A2K6KI95.1
#=GS A0A3Q2ECL3_CYPVA/38-210   AC A0A3Q2ECL3.1
#=GS A0A067JV92_JATCU/29-192   AC A0A067JV92.1
#=GS H2Q4C3_PANTR/36-211       AC H2Q4C3.2
#=GS A0A3S3R303_9MAGN/40-191   AC A0A3S3R303.1
#=GS H3B327_LATCH/36-213       AC H3B327.1
#=GS A0A1U7R1V5_MESAU/38-220   AC A0A1U7R1V5.1
#=GS A0A384DFQ4_URSMA/1-168    AC A0A384DFQ4.1
#=GS A0A226PHG7_COLVI/27-188   AC A0A226PHG7.1
#=GS A0A1V4L0L5_PATFA/141-276  AC A0A1V4L0L5.1
#=GS A0A1S3K2Z7_LINUN/34-177   AC A0A1S3K2Z7.1
#=GS F1Q4J6_CANLF/38-220       AC F1Q4J6.2
#=GS A0A286ZQ37_PIG/38-196     AC A0A286ZQ37.1
#=GS H2N3N0_PONAB/47-205       AC H2N3N0.1
#=GS A0A2Y9M9H7_DELLE/27-177   AC A0A2Y9M9H7.1
#=GS A0A2K6L4W1_RHIBE/59-198   AC A0A2K6L4W1.1
#=GS G1T5D7_RABIT/26-201       AC G1T5D7.1
#=GS G5E8D3_MOUSE/26-170       AC G5E8D3.1
#=GS A0A3B4T3H9_SERDU/47-222   AC A0A3B4T3H9.1
#=GS U3I6W0_ANAPP/48-153       AC U3I6W0.2
#=GS R0JWY8_ANAPL/31-206       AC R0JWY8.1
#=GS G1R071_NOMLE/38-220       AC G1R071.1
#=GS G1QJ55_NOMLE/22-183       AC G1QJ55.2
#=GS A0A2K6N9T0_RHIRO/36-211   AC A0A2K6N9T0.1
#=GS A0A3Q2DXE5_CYPVA/26-204   AC A0A3Q2DXE5.1
#=GS A0A2K5R2D8_CEBCA/48-206   AC A0A2K5R2D8.1
#=GS C3Y0S4_BRAFL/3-162        AC C3Y0S4.1
#=GS A0A3Q0SB82_AMPCI/24-197   AC A0A3Q0SB82.1
#=GS A0A2K6RR53_RHIRO/47-222   AC A0A2K6RR53.1
#=GS G1NDJ8_MELGA/23-190       AC G1NDJ8.2
#=GS A0A3M6V5B8_9CNID/42-193   AC A0A3M6V5B8.1
#=GS A0A3Q0FNI2_ALLSI/26-201   AC A0A3Q0FNI2.1
#=GS A0A1S3G802_DIPOR/228-357  AC A0A1S3G802.1
#=GS A0A384APX0_BALAS/38-220   AC A0A384APX0.1
#=GS A0A2I4H1H5_JUGRE/32-195   AC A0A2I4H1H5.1
#=GS F6YV89_HORSE/38-220       AC F6YV89.2
#=GS M3YLD8_MUSPF/27-201       AC M3YLD8.1
#=GS H9GQT5_ANOCA/10-102       AC H9GQT5.2
#=GS A0A2Y9F2Q7_PHYMC/34-209   AC A0A2Y9F2Q7.1
#=GS A0A3Q7SWQ2_VULVU/56-197   AC A0A3Q7SWQ2.1
#=GS A0A2K5RGK0_CEBCA/20-181   AC A0A2K5RGK0.1
#=GS A0A3P8P175_ASTCA/33-194   AC A0A3P8P175.1
#=GS S4RHD7_PETMA/30-210       AC S4RHD7.1
#=GS A0A0A0MVH3_PAPAN/59-215   AC A0A0A0MVH3.1
#=GS A0A2K6T2M9_SAIBB/59-215   AC A0A2K6T2M9.1
#=GS A0A452SU57_URSAM/30-205   AC A0A452SU57.1
#=GS W4XKK9_STRPU/19-164       AC W4XKK9.1
#=GS A0A2K6C7H9_MACNE/22-183   AC A0A2K6C7H9.1
#=GS A0A0P7ZE86_SCLFO/55-199   AC A0A0P7ZE86.1
#=GS A0A2U3YCG8_LEPWE/27-213   AC A0A2U3YCG8.1
#=GS A0A3P9B4E6_9CICH/28-209   AC A0A3P9B4E6.1
#=GS A0A2D0S2Z2_ICTPU/42-208   AC A0A2D0S2Z2.1
#=GS G1KRJ2_ANOCA/23-190       AC G1KRJ2.2
#=GS M7BJ70_CHEMY/12-178       AC M7BJ70.1
#=GS G3U6S7_LOXAF/49-130       AC G3U6S7.1
#=GS A0A3P9C2F5_9CICH/21-183   AC A0A3P9C2F5.1
#=GS U3K058_FICAL/31-207       AC U3K058.1
#=GS F5H3Z4_HUMAN/45-198       AC F5H3Z4.1
#=GS A0A1U8I9H5_GOSHI/43-205   AC A0A1U8I9H5.1
#=GS A0A1S3ABQ2_ERIEU/54-180   AC A0A1S3ABQ2.1
#=GS F7GMI4_CALJA/22-183       AC F7GMI4.2
#=GS A0A093QB07_9PASS/21-188   AC A0A093QB07.1
#=GS A0A2K5HJW8_COLAP/42-217   AC A0A2K5HJW8.1
#=GS A0A287U6R1_HORVV/44-197   AC A0A287U6R1.1
#=GS B9RFD1_RICCO/36-198       AC B9RFD1.1
#=GS A0A2K6AU43_MACNE/36-211   AC A0A2K6AU43.1
#=GS A0A2Y9F811_PHYMC/38-220   AC A0A2Y9F811.1
#=GS A0A2R2MQE2_LINUN/5-177    AC A0A2R2MQE2.1
#=GS A0A3Q0D6Q1_MESAU/43-204   AC A0A3Q0D6Q1.1
#=GS A0A0Q3U3A0_AMAAE/333-508  AC A0A0Q3U3A0.1
#=GS A0A067QXU6_ZOONE/110-207  AC A0A067QXU6.1
#=GS A0A1Q3DEW2_CEPFO/27-190   AC A0A1Q3DEW2.1
#=GS A0A060ZA98_ONCMY/1-169    AC A0A060ZA98.1
#=GS H3AJ36_LATCH/1-106        AC H3AJ36.1
#=GS A0A2K6UMR7_SAIBB/36-211   AC A0A2K6UMR7.1
#=GS G3TAX8_LOXAF/39-200       AC G3TAX8.1
#=GS A0A2K1XZF1_POPTR/29-191   AC A0A2K1XZF1.1
#=GS A0A287BP62_PIG/29-204     AC A0A287BP62.1
#=GS A0A1S3JNS0_LINUN/23-192   AC A0A1S3JNS0.1
#=GS FOLR2_HUMAN/30-205        AC P14207.4
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN0 A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KMY A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 C; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 B; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KMZ A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN1 A; 30-205;
#=GS A0A340XP17_LIPVE/34-209   AC A0A340XP17.1
#=GS A0A267GZF5_9PLAT/45-230   AC A0A267GZF5.1
#=GS A0A2K6T2H0_SAIBB/37-193   AC A0A2K6T2H0.1
#=GS K7EIS2_HUMAN/27-183       AC K7EIS2.1
#=GS M3WR11_FELCA/31-206       AC M3WR11.1
#=GS A0A251TBJ9_HELAN/46-194   AC A0A251TBJ9.1
#=GS A0A2I3TNA5_PANTR/37-193   AC A0A2I3TNA5.1
#=GS R7VC87_CAPTE/22-180       AC R7VC87.1
#=GS A0A3B4CK08_PYGNA/27-199   AC A0A3B4CK08.1
#=GS A0A2K5ZD61_MANLE/36-211   AC A0A2K5ZD61.1
#=GS A0A3B4T9N7_SERDU/37-210   AC A0A3B4T9N7.1
#=GS W5KAU7_ASTMX/41-203       AC W5KAU7.2
#=GS A0A0E0G967_ORYNI/49-201   AC A0A0E0G967.1
#=GS A0A287BB49_PIG/38-220     AC A0A287BB49.1
#=GS A0A2K6KI91_RHIBE/47-222   AC A0A2K6KI91.1
#=GS A0A3B3SI27_9TELE/80-245   AC A0A3B3SI27.1
#=GS G1LWD6_AILME/34-202       AC G1LWD6.1
#=GS A0A3Q0SDH6_AMPCI/30-191   AC A0A3Q0SDH6.1
#=GS A0A287AG84_PIG/27-206     AC A0A287AG84.1
#=GS A0A3B3UE12_9TELE/65-243   AC A0A3B3UE12.1
#=GS E2RQM1_CANLF/29-185       AC E2RQM1.2
#=GS A0A3B4V0D4_SERDU/28-209   AC A0A3B4V0D4.1
#=GS A0A3B4GEC7_9CICH/36-208   AC A0A3B4GEC7.1
#=GS M3XH66_LATCH/42-190       AC M3XH66.1
#=GS A0A2U4BPU2_TURTR/34-209   AC A0A2U4BPU2.1
#=GS A0A2J7QBQ4_9NEOP/1-132    AC A0A2J7QBQ4.1
#=GS A0A3Q1EF35_9TELE/26-207   AC A0A3Q1EF35.1
#=GS E9PYD9_MOUSE/34-137       AC E9PYD9.1
#=GS A0A1L8H304_XENLA/26-180   AC A0A1L8H304.1
#=GS A0A3Q3F7P7_9LABR/29-190   AC A0A3Q3F7P7.1
#=GS A0A2K5JMS7_COLAP/38-220   AC A0A2K5JMS7.1
#=GS A0A0R3WW82_HYDTA/36-215   AC A0A0R3WW82.1
#=GS A0A1U7XLM8_NICSY/41-192   AC A0A1U7XLM8.1
#=GS A0A2K5DR67_AOTNA/38-220   AC A0A2K5DR67.1
#=GS G1PDG2_MYOLU/38-220       AC G1PDG2.1
#=GS A0A3B3YMF8_9TELE/35-196   AC A0A3B3YMF8.1
#=GS W2QZC1_PHYPN/33-184       AC W2QZC1.1
#=GS I3LDJ1_PIG/29-169         AC I3LDJ1.1
#=GS A0A498M645_LABRO/27-199   AC A0A498M645.1
#=GS A0A3B4AFX2_9GOBI/36-197   AC A0A3B4AFX2.1
#=GS H0UUP4_CAVPO/27-198       AC H0UUP4.2
#=GS A0A2U3ZAQ4_ODORO/34-209   AC A0A2U3ZAQ4.1
#=GS A0A3Q0FY17_ALLSI/57-232   AC A0A3Q0FY17.1
#=GS RTBDN_ICTTR/27-208        AC Q5DRQ5.1
#=GS G3VZ16_SARHA/6-166        AC G3VZ16.1
#=GS A0A2U9CIJ6_SCOMX/57-218   AC A0A2U9CIJ6.1
#=GS G3RFV1_GORGO/26-208       AC G3RFV1.2
#=GS F6S8Y5_XENTR/23-177       AC F6S8Y5.1
#=GS A0A1S3CUH7_DIACI/30-204   AC A0A1S3CUH7.1
#=GS A0A151MKL1_ALLMI/26-189   AC A0A151MKL1.1
#=GS K1PDZ2_CRAGI/29-160       AC K1PDZ2.1
#=GS A0A2R9BIN5_PANPA/1-108    AC A0A2R9BIN5.1
#=GS H2NEK1_PONAB/36-211       AC H2NEK1.1
#=GS A0A3P8ZWH6_ESOLU/23-198   AC A0A3P8ZWH6.1
#=GS A0A0R4IXN7_DANRE/28-203   AC A0A0R4IXN7.1
#=GS A0A2R9B8A1_PANPA/30-205   AC A0A2R9B8A1.1
#=GS A0A067EQR5_CITSI/29-192   AC A0A067EQR5.1
#=GS A0A2T7PMZ6_POMCA/44-145   AC A0A2T7PMZ6.1
#=GS A0A068V9B7_COFCA/53-201   AC A0A068V9B7.1
#=GS F6XN05_XENTR/14-175       AC F6XN05.1
#=GS A0A2K5YE35_MANLE/47-206   AC A0A2K5YE35.1
#=GS I1P1R4_ORYGL/49-201       AC I1P1R4.1
#=GS E1BGX8_BOVIN/44-206       AC E1BGX8.2
#=GS A0A1D5Q8N0_MACMU/26-208   AC A0A1D5Q8N0.1
#=GS A0A2I2YC44_GORGO/47-201   AC A0A2I2YC44.1
#=GS A0A0S3SQM8_PHAAN/36-196   AC A0A0S3SQM8.1
#=GS A0A2K6F2B6_PROCO/36-211   AC A0A2K6F2B6.1
#=GS A0A087X2K1_POEFO/53-214   AC A0A087X2K1.1
#=GS A0A2K5HJY9_COLAP/33-208   AC A0A2K5HJY9.1
#=GS A0A3Q3LHK4_9TELE/33-208   AC A0A3Q3LHK4.1
#=GS H0VLN7_CAVPO/34-160       AC H0VLN7.2
#=GS A0A3B3T870_9TELE/54-216   AC A0A3B3T870.1
#=GS A0A1B0GQW7_MOUSE/29-87    AC A0A1B0GQW7.1
#=GS A0A0D3E146_BRAOL/221-381  AC A0A0D3E146.1
#=GS A0A287BK62_PIG/31-206     AC A0A287BK62.1
#=GS A7RPJ5_NEMVE/32-187       AC A7RPJ5.1
#=GS A0A4D9B3N1_SALSN/50-198   AC A0A4D9B3N1.1
#=GS I1IB47_BRADI/46-199       AC I1IB47.1
#=GS A0A3Q7WXT0_URSAR/38-220   AC A0A3Q7WXT0.1
#=GS A0A1S3V654_VIGRR/38-198   AC A0A1S3V654.1
#=GS F7GD25_ORNAN/21-180       AC F7GD25.1
#=GS E1BJL8_BOVIN/30-205       AC E1BJL8.2
#=GS A0A3Q2LEL7_HORSE/30-205   AC A0A3Q2LEL7.1
#=GS A0A2K5LBN5_CERAT/3-164    AC A0A2K5LBN5.1
#=GS A0A453NZ04_AEGTS/34-187   AC A0A453NZ04.1
#=GS A0A091VAP1_NIPNI/31-206   AC A0A091VAP1.1
#=GS HIPL1_HUMAN/22-183        AC Q96JK4.2
#=GS A0A3Q0FUI1_ALLSI/129-304  AC A0A3Q0FUI1.1
#=GS A0A2P5RKS1_GOSBA/38-192   AC A0A2P5RKS1.1
#=GS E2R888_CANLF/47-206       AC E2R888.1
#=GS A0A2K6V1Q0_SAIBB/2-158    AC A0A2K6V1Q0.1
#=GS A0A093IA02_STRCA/3-129    AC A0A093IA02.1
#=GS A0A2K6L4U9_RHIBE/37-193   AC A0A2K6L4U9.1
#=GS L5L0C6_PTEAL/26-177       AC L5L0C6.1
#=GS W5PJZ5_SHEEP/39-221       AC W5PJZ5.1
#=GS A0A2K5U066_MACFA/36-211   AC A0A2K5U066.1
#=GS M3YFP6_MUSPF/31-206       AC M3YFP6.1
#=GS RTBDN_MOUSE/27-203        AC Q8QZY4.1
#=GS A0A0D9QVZ6_CHLSB/1-148    AC A0A0D9QVZ6.1
#=GS E1BK45_BOVIN/27-177       AC E1BK45.3
#=GS A0A3Q0FTQ0_ALLSI/36-211   AC A0A3Q0FTQ0.1
#=GS E2RTK1_CANLF/26-171       AC E2RTK1.2
#=GS A0A093GNC2_DRYPU/21-188   AC A0A093GNC2.1
#=GS A0A3Q4I5G8_NEOBR/5-166    AC A0A3Q4I5G8.1
#=GS A0A2R9CP43_PANPA/36-211   AC A0A2R9CP43.1
#=GS B7PRB5_IXOSC/1-110        AC B7PRB5.1
#=GS A0A452DS15_CAPHI/31-192   AC A0A452DS15.1
#=GS A0A2U4BPH0_TURTR/30-205   AC A0A2U4BPH0.1
#=GS A0A2A9MBR2_9APIC/75-244   AC A0A2A9MBR2.1
#=GS W5PLT6_SHEEP/47-204       AC W5PLT6.1
#=GS A0A1S3HG53_LINUN/34-210   AC A0A1S3HG53.1
#=GS A0A452EP48_CAPHI/44-206   AC A0A452EP48.1
#=GS F7AZK3_MACMU/47-206       AC F7AZK3.2
#=GS A0A3M6VV48_9STRA/5-113    AC A0A3M6VV48.1
#=GS L8H8F4_ACACA/30-211       AC L8H8F4.1
#=GS A0A2K5Y4M3_MANLE/38-220   AC A0A2K5Y4M3.1
#=GS A0A162DD41_9CRUS/41-214   AC A0A162DD41.1
#=GS A0A3Q1CDN9_AMPOC/47-209   AC A0A3Q1CDN9.1
#=GS A0A3B4CU07_PYGNA/20-181   AC A0A3B4CU07.1
#=GS A0A3P8P3A6_ASTCA/23-176   AC A0A3P8P3A6.1
#=GS A0A3B4GM25_9CICH/33-194   AC A0A3B4GM25.1
#=GS A0A4D9EL97_9SAUR/63-225   AC A0A4D9EL97.1
#=GS F7DUE2_ORNAN/39-222       AC F7DUE2.2
#=GS A0A0D3F724_9ORYZ/49-201   AC A0A0D3F724.1
#=GS F7A0H6_HORSE/30-205       AC F7A0H6.1
#=GS H0X6F3_OTOGA/27-208       AC H0X6F3.1
#=GS A0A2K6FMI0_PROCO/39-221   AC A0A2K6FMI0.1
#=GS A0A1Y1HPQ5_KLENI/12-158   AC A0A1Y1HPQ5.1
#=GS L9LAB8_TUPCH/30-205       AC L9LAB8.1
#=GS A0A0A0AHT2_CHAVO/21-188   AC A0A0A0AHT2.1
#=GS B6AIB9_CRYMR/25-190       AC B6AIB9.1
#=GS A0A2K6R864_RHIRO/36-211   AC A0A2K6R864.1
#=GS A0A218UGW8_9PASE/82-257   AC A0A218UGW8.1
#=GS A0A099ZIV6_TINGU/3-165    AC A0A099ZIV6.1
#=GS HIPL2_ARATH/27-181        AC Q94F08.2
#=GS A0A2I3SSW9_PANTR/36-206   AC A0A2I3SSW9.1
#=GS G1SMW7_RABIT/38-220       AC G1SMW7.2
#=GS A0A3Q2W5I8_HAPBU/33-194   AC A0A3Q2W5I8.1
#=GS A0A1S3EVX4_DIPOR/4-107    AC A0A1S3EVX4.1
#=GS A0A3Q1EN57_9TELE/38-199   AC A0A3Q1EN57.1
#=GS A0A2Y9QIY5_DELLE/38-220   AC A0A2Y9QIY5.1
#=GS A0A443SE65_9ACAR/1-154    AC A0A443SE65.1
#=GS F5H2G8_HUMAN/34-74        AC F5H2G8.1
#=GS A0A2K5RQN5_CEBCA/34-104   AC A0A2K5RQN5.1
#=GS A0A3Q7V2L7_VULVU/38-220   AC A0A3Q7V2L7.1
#=GS G5C3X2_HETGA/50-179       AC G5C3X2.1
#=GS G3TGC7_LOXAF/59-204       AC G3TGC7.1
#=GS H2ZRN0_LATCH/30-204       AC H2ZRN0.1
#=GS F7F3D9_MACMU/67-187       AC F7F3D9.2
#=GS A0A4D8Z232_SALSN/47-195   AC A0A4D8Z232.1
#=GS A0A2K5LBK1_CERAT/36-211   AC A0A2K5LBK1.1
#=GS A0A369RWN8_9METZ/21-149   AC A0A369RWN8.1
#=GS A0A3P8Y848_ESOLU/29-178   AC A0A3P8Y848.1
#=GS H0WLX7_OTOGA/33-195       AC H0WLX7.1
#=GS A0A2Y9F0R6_PHYMC/30-205   AC A0A2Y9F0R6.1
#=GS G5BYW7_HETGA/29-211       AC G5BYW7.1
#=GS K7F2U8_PELSI/26-201       AC K7F2U8.1
#=GS A0A2Y9Q8H2_DELLE/38-220   AC A0A2Y9Q8H2.1
#=GS A0A1L8G145_XENLA/52-210   AC A0A1L8G145.1
#=GS A0A452CM71_BALAS/38-220   AC A0A452CM71.1
#=GS F6TQQ8_MONDO/48-210       AC F6TQQ8.2
#=GS A0A0P7VCE9_SCLFO/34-194   AC A0A0P7VCE9.1
#=GS A0A2K6PQ69_RHIRO/38-220   AC A0A2K6PQ69.1
#=GS E0VVL1_PEDHC/33-206       AC E0VVL1.1
#=GS RBP_CHICK/21-188          AC P02752.2
#=GS RBP_CHICK/21-188          DR PDB; 6HCE A; 21-188;
#=GS A0A1S3HG59_LINUN/1-143    AC A0A1S3HG59.1
#=GS A8MS02_ARATH/40-200       AC A8MS02.2
#=GS A0A2U3WI08_ODORO/44-206   AC A0A2U3WI08.1
#=GS HIPL1_MOUSE/28-189        AC Q14DK5.1
#=GS R0FGV8_9BRAS/37-198       AC R0FGV8.1
#=GS A0A3B4CWE8_PYGNA/34-195   AC A0A3B4CWE8.1
#=GS A0A401NPK4_SCYTO/49-197   AC A0A401NPK4.1
#=GS A0A1A6G263_NEOLE/38-213   AC A0A1A6G263.1
#=GS A0A3Q1HKH9_ANATE/23-198   AC A0A3Q1HKH9.1
#=GS A0A401PCQ3_SCYTO/23-189   AC A0A401PCQ3.1
#=GS F7GD28_ORNAN/24-179       AC F7GD28.1
#=GS M3Y5G6_MUSPF/38-220       AC M3Y5G6.1
#=GS A0A3M6T9Y8_9CNID/26-192   AC A0A3M6T9Y8.1
#=GS A0A3Q2D842_CYPVA/23-198   AC A0A3Q2D842.1
#=GS A0A0L8HYB6_OCTBM/30-200   AC A0A0L8HYB6.1
#=GS A0A340X6T2_LIPVE/31-192   AC A0A340X6T2.1
#=GS Q69L70_ORYSJ/49-201       AC Q69L70.1
#=GS G1S5Y4_NOMLE/36-211       AC G1S5Y4.2
#=GS A0A2K5DWK8_AOTNA/26-208   AC A0A2K5DWK8.1
#=GS A0A2K5DRF2_AOTNA/38-220   AC A0A2K5DRF2.1
#=GS A0A2K5YTW5_MANLE/26-208   AC A0A2K5YTW5.1
#=GS A0A3Q1EN42_9TELE/38-199   AC A0A3Q1EN42.1
#=GS HIPL2_HUMAN/44-206        AC Q6UWX4.1
#=GS K7FZF8_PELSI/19-156       AC K7FZF8.1
#=GS H0WV59_OTOGA/38-220       AC H0WV59.1
#=GS A0A3P8N784_ASTCA/28-209   AC A0A3P8N784.1
#=GS A0A1S3EZ02_DIPOR/35-210   AC A0A1S3EZ02.1
#=GS A0A2I4BN34_9TELE/30-191   AC A0A2I4BN34.1
#=GS G3NYE5_GASAC/30-205       AC G3NYE5.1
#=GS A0A384DET5_URSMA/31-206   AC A0A384DET5.1
#=GS A0A287U713_HORVV/41-194   AC A0A287U713.1
#=GS A0A093G981_DRYPU/31-160   AC A0A093G981.1
#=GS A0A3Q2LMS3_HORSE/3-164    AC A0A3Q2LMS3.1
#=GS A0A3R7NL63_9STRA/48-199   AC A0A3R7NL63.1
#=GS R4GDF8_ANOCA/7-121        AC R4GDF8.1
#=GS A0A210R2X3_MIZYE/34-171   AC A0A210R2X3.1
#=GS A0A2K5YHP2_MANLE/20-181   AC A0A2K5YHP2.1
#=GS A0A2D0RR57_ICTPU/23-184   AC A0A2D0RR57.1
#=GS A0A2K5C4C4_AOTNA/48-206   AC A0A2K5C4C4.1
#=GS W5MM21_LEPOC/28-203       AC W5MM21.1
#=GS A0A3M7S946_BRAPC/46-193   AC A0A3M7S946.1
#=GS A0A3M0KY50_HIRRU/30-149   AC A0A3M0KY50.1
#=GS F1NGW6_CHICK/35-217       AC F1NGW6.3
#=GS M4A9K7_XIPMA/23-198       AC M4A9K7.1
#=GS A0A3B4BE12_9GOBI/24-198   AC A0A3B4BE12.1
#=GS A0A199VWI2_ANACO/42-190   AC A0A199VWI2.1
#=GS A0A2C9JGR2_BIOGL/35-207   AC A0A2C9JGR2.1
#=GS A0A445IMQ3_GLYSO/40-203   AC A0A445IMQ3.1
#=GS G3P081_GASAC/7-132        AC G3P081.1
#=GS A0A2U3YYH4_LEPWE/7-112    AC A0A2U3YYH4.1
#=GS A0A4D9DXW4_9SAUR/26-201   AC A0A4D9DXW4.1
#=GS A0A140T8H8_CHICK/21-188   AC A0A140T8H8.1
#=GS A0A1S3JEC5_LINUN/34-210   AC A0A1S3JEC5.1
#=GS M4E4P6_BRARP/40-187       AC M4E4P6.1
#=GS A0A0D2MI20_9CHLO/46-214   AC A0A0D2MI20.1
#=GS I3M4T2_ICTTR/29-204       AC I3M4T2.1
#=GS A0A2K5TT47_MACFA/59-198   AC A0A2K5TT47.1
#=GS F7CL75_MONDO/29-205       AC F7CL75.2
#=GS A0A0K9PSK5_ZOSMR/20-185   AC A0A0K9PSK5.1
#=GS G7I8R3_MEDTR/42-203       AC G7I8R3.2
#=GS A0A3M6T6G4_9CNID/32-211   AC A0A3M6T6G4.1
#=GS F6X5A6_XENTR/22-188       AC F6X5A6.1
#=GS A0A2K5W2J6_MACFA/47-206   AC A0A2K5W2J6.1
#=GS H2Q4C5_PANTR/30-205       AC H2Q4C5.1
#=GS A0A3M0JCQ9_HIRRU/26-187   AC A0A3M0JCQ9.1
#=GS A0A3P9PHY5_POERE/26-201   AC A0A3P9PHY5.1
#=GS A0A2Y9QJG0_DELLE/38-220   AC A0A2Y9QJG0.1
#=GS Q9XSH1_PIG/28-203         AC Q9XSH1.1
#=GS A0A3Q3LNQ8_9TELE/28-201   AC A0A3Q3LNQ8.1
#=GS K7ENA4_HUMAN/27-174       AC K7ENA4.1
#=GS C3Y181_BRAFL/80-227       AC C3Y181.1
#=GS A0A2K5Y2E7_MANLE/59-198   AC A0A2K5Y2E7.1
#=GS A0A3B6PLG0_WHEAT/54-207   AC A0A3B6PLG0.1
#=GS A0A2K5F410_AOTNA/59-215   AC A0A2K5F410.1
#=GS F7F3D9_MACMU/36-69        AC F7F3D9.2
#=GS G3QS30_GORGO/36-211       AC G3QS30.1
#=GS A0A2U9CK68_SCOMX/34-196   AC A0A2U9CK68.1
#=GS M3XZP6_MUSPF/27-177       AC M3XZP6.1
#=GS B3RXI9_TRIAD/32-204       AC B3RXI9.1
#=GS G1NKP2_MELGA/1-102        AC G1NKP2.1
#=GS A0A2J6KPQ2_LACSA/72-220   AC A0A2J6KPQ2.1
#=GS A0A1S3HHT0_LINUN/34-210   AC A0A1S3HHT0.1
#=GS A0A444XKH3_ARAHY/1-94     AC A0A444XKH3.1
#=GS T0PZY6_SAPDV/6-156        AC T0PZY6.1
#=GS D3ZGL3_RAT/38-220         AC D3ZGL3.1
#=GS A0A3Q3NPD7_9LABR/23-198   AC A0A3Q3NPD7.1
#=GS A0A2K6BUM7_MACNE/59-215   AC A0A2K6BUM7.1
#=GS A0A1D1UKL7_RAMVA/25-165   AC A0A1D1UKL7.1
#=GS A0A3B3T646_9TELE/83-257   AC A0A3B3T646.1
#=GS A7RN66_NEMVE/1-169        AC A7RN66.1
#=GS A0A1D5QFI7_MACMU/59-198   AC A0A1D5QFI7.1
#=GS F6R036_CALJA/26-208       AC F6R036.2
#=GS V3ZYM9_LOTGI/31-204       AC V3ZYM9.1
#=GS A0A3Q0H7L2_ALLSI/429-591  AC A0A3Q0H7L2.1
#=GS I3M939_ICTTR/43-205       AC I3M939.2
#=GS A0A2K5J324_COLAP/59-198   AC A0A2K5J324.1
#=GS A0A2K6RRY9_RHIRO/22-183   AC A0A2K6RRY9.1
#=GS A0A0R3T8X3_HYMNN/1-179    AC A0A0R3T8X3.1
#=GS C1MHV6_MICPC/49-171       AC C1MHV6.1
#=GS A0A2B4SCE1_STYPI/23-165   AC A0A2B4SCE1.1
#=GS A0A2K6T2N3_SAIBB/59-195   AC A0A2K6T2N3.1
#=GS K7E4M5_MONDO/139-265      AC K7E4M5.1
#=GS W9RZ38_9ROSA/53-202       AC W9RZ38.1
#=GS A0A2K6KI84_RHIBE/47-261   AC A0A2K6KI84.1
#=GS A0A3B3II88_ORYLA/35-195   AC A0A3B3II88.1
#=GS F1S9I3_PIG/147-306        AC F1S9I3.2
#=GS A0A433TG37_ELYCH/50-178   AC A0A433TG37.1
#=GS B5XAT1_SALSA/23-198       AC B5XAT1.1
#=GS A0A2I4C0I7_9TELE/50-212   AC A0A2I4C0I7.1
#=GS A0A3Q4H3Z1_NEOBR/28-129   AC A0A3Q4H3Z1.1
#=GS A0A3Q1M762_BOVIN/35-169   AC A0A3Q1M762.1
#=GS A0A091VAB3_NIPNI/21-188   AC A0A091VAB3.1
#=GS A0A0P7TVM8_SCLFO/49-211   AC A0A0P7TVM8.1
#=GS A0A267DD81_9PLAT/45-189   AC A0A267DD81.1
#=GS D0NJK0_PHYIT/1-136        AC D0NJK0.1
#=GS F6VC07_XENTR/1-155        AC F6VC07.1
#=GS A0A1S3JP30_LINUN/19-188   AC A0A1S3JP30.1
#=GS G3QMX1_GORGO/36-211       AC G3QMX1.2
#=GS A0A151PJC7_ALLMI/26-201   AC A0A151PJC7.1
#=GS A0A2K6MAB0_RHIBE/36-211   AC A0A2K6MAB0.1
#=GS M0RS22_MUSAM/44-195       AC M0RS22.1
#=GS A0A3Q7WCW2_URSAR/27-188   AC A0A3Q7WCW2.1
#=GS A0A2I0AFQ7_9ASPA/44-195   AC A0A2I0AFQ7.1
#=GS A0A445F9J6_GLYSO/74-235   AC A0A445F9J6.1
#=GS V7BGJ2_PHAVU/38-199       AC V7BGJ2.1
#=GS A0A2K6BV46_MACNE/38-220   AC A0A2K6BV46.1
#=GS G3TWH6_LOXAF/35-210       AC G3TWH6.1
#=GS C3YX07_BRAFL/83-216       AC C3YX07.1
#=GS A0A2K5Q8K1_CEBCA/59-215   AC A0A2K5Q8K1.1
#=GS A0A3B4BF19_9GOBI/26-204   AC A0A3B4BF19.1
#=GS A0A2G8KPA3_STIJA/48-220   AC A0A2G8KPA3.1
#=GS F1RS40_PIG/38-220         AC F1RS40.3
#=GS A0A1S3SZ67_SALSA/33-194   AC A0A1S3SZ67.1
#=GS A0A452HZX8_9SAUR/3-161    AC A0A452HZX8.1
#=GS I3JN61_ORENI/28-209       AC I3JN61.1
#=GS A0A087XRZ0_POEFO/26-204   AC A0A087XRZ0.2
#=GS A0A384DES7_URSMA/30-205   AC A0A384DES7.1
#=GS A0A3Q2H404_HORSE/47-138   AC A0A3Q2H404.1
#=GS H0ZR53_TAEGU/3-164        AC H0ZR53.1
#=GS A0A3B4EU26_9CICH/28-209   AC A0A3B4EU26.1
#=GS A0A151PFV0_ALLMI/507-682  AC A0A151PFV0.1
#=GS A0A1S3S497_SALSA/29-207   AC A0A1S3S497.1
#=GS A0A3Q2D8Y1_CYPVA/29-204   AC A0A3Q2D8Y1.1
#=GS A0A199VVS9_ANACO/42-190   AC A0A199VVS9.1
#=GS A0A091DG56_FUKDA/12-187   AC A0A091DG56.1
#=GS H2NEK0_PONAB/36-211       AC H2NEK0.2
#=GS A0A2K5LBM4_CERAT/47-222   AC A0A2K5LBM4.1
#=GS A0A2I2ZAL4_GORGO/3-164    AC A0A2I2ZAL4.1
#=GS A0A3P9NEK5_POERE/35-196   AC A0A3P9NEK5.1
#=GS A0A3P8WD03_CYNSE/28-209   AC A0A3P8WD03.1
#=GS A0A3Q1BQR2_AMPOC/37-210   AC A0A3Q1BQR2.1
#=GS A0A2K5HD22_COLAP/36-211   AC A0A2K5HD22.1
#=GS A0A2K5XKY8_MANLE/30-205   AC A0A2K5XKY8.1
#=GS A0A401Q2K9_SCYTO/37-207   AC A0A401Q2K9.1
#=GS A0A3Q1DFP0_AMPOC/37-210   AC A0A3Q1DFP0.1
#=GS A0A3Q7TM33_VULVU/30-205   AC A0A3Q7TM33.1
#=GS G1R639_NOMLE/26-208       AC G1R639.2
#=GS A0A093FXR0_DRYPU/29-178   AC A0A093FXR0.1
#=GS M4F6A3_BRARP/38-198       AC M4F6A3.1
#=GS F6V730_CALJA/36-211       AC F6V730.1
#=GS A0A3Q2DAP0_CYPVA/38-210   AC A0A3Q2DAP0.1
#=GS A0A287BC44_PIG/27-202     AC A0A287BC44.1
#=GS A0A2K5CPZ0_AOTNA/34-104   AC A0A2K5CPZ0.1
#=GS A0A3B6PKA1_WHEAT/44-197   AC A0A3B6PKA1.1
#=GS A7REX3_NEMVE/16-184       AC A7REX3.1
#=GS B7PZS9_IXOSC/69-157       AC B7PZS9.1
#=GS H0ZCK8_TAEGU/21-188       AC H0ZCK8.1
#=GS B3RPR0_TRIAD/63-205       AC B3RPR0.1
#=GS A0A3B5B2E8_9TELE/23-198   AC A0A3B5B2E8.1
#=GS A0A2T7PWW2_POMCA/308-444  AC A0A2T7PWW2.1
#=GS A0A2U3VUE8_ODORO/27-183   AC A0A2U3VUE8.1
#=GS K7F2T6_PELSI/31-206       AC K7F2T6.1
#=GS JUNO_HUMAN/26-208         AC A6ND01.3
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKA A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKC B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q C; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKA B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4E B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKE B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKD B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKE D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB C; 26-208;
#=GS D7M5H4_ARALL/37-198       AC D7M5H4.1
#=GS A0A2G2W863_CAPBA/38-189   AC A0A2G2W863.1
#=GS A0A067EZ42_CITSI/29-149   AC A0A067EZ42.1
#=GS H2ML72_ORYLA/28-204       AC H2ML72.2
#=GS A0A151U4S3_CAJCA/26-187   AC A0A151U4S3.1
#=GS A0A2K5DR85_AOTNA/38-220   AC A0A2K5DR85.1
#=GS L9LDL7_TUPCH/33-165       AC L9LDL7.1
#=GS A0A369SFE9_9METZ/63-205   AC A0A369SFE9.1
#=GS A0A2Y9M495_DELLE/54-204   AC A0A2Y9M495.1
#=GS F7DID7_HORSE/26-207       AC F7DID7.2
#=GS F7F2B5_MACMU/37-193       AC F7F2B5.2
#=GS L5K5G6_PTEAL/61-206       AC L5K5G6.1
#=GS A0A2P6N040_9MYCE/20-164   AC A0A2P6N040.1
#=GS A0A0D9YUD5_9ORYZ/49-201   AC A0A0D9YUD5.1
#=GS A0A3L8SF87_CHLGU/3-123    AC A0A3L8SF87.1
#=GS A0A3P8WT43_CYNSE/20-192   AC A0A3P8WT43.1
#=GS A0A1V4JXD0_PATFA/88-255   AC A0A1V4JXD0.1
#=GS A0A1S3JE31_LINUN/91-267   AC A0A1S3JE31.1
#=GS A0A2I3N2D9_PAPAN/20-181   AC A0A2I3N2D9.1
#=GS A0A2I3RMJ5_PANTR/38-220   AC A0A2I3RMJ5.1
#=GS A0A2K5RJR2_CEBCA/29-204   AC A0A2K5RJR2.1
#=GS A0A453NZU6_AEGTS/44-197   AC A0A453NZU6.1
#=GS A0A1S3XZ96_TOBAC/41-192   AC A0A1S3XZ96.1
#=GS A0A2K5UR19_MACFA/36-211   AC A0A2K5UR19.1
#=GS A0A3P8VNG7_CYNSE/51-213   AC A0A3P8VNG7.1
#=GS A0A2K6BC26_MACNE/36-211   AC A0A2K6BC26.1
#=GS A0A093G5D5_DRYPU/3-164    AC A0A093G5D5.1
#=GS A0A3P8P191_ASTCA/33-194   AC A0A3P8P191.1
#=GS Q1LVK0_DANRE/3-164        AC Q1LVK0.3
#=GS A0A2K5XKZ3_MANLE/47-110   AC A0A2K5XKZ3.1
#=GS J3KQP4_HUMAN/47-201       AC J3KQP4.1
#=GS A0A445IMV4_GLYSO/40-203   AC A0A445IMV4.1
#=GS A0A498L7K2_LABRO/30-205   AC A0A498L7K2.1
#=GS A0A3P9QB93_POERE/40-210   AC A0A3P9QB93.1
#=GS F6ZAF6_MONDO/37-213       AC F6ZAF6.2
#=GS G1PPC1_MYOLU/31-206       AC G1PPC1.1
#=GS A0A3B4ZAU8_9TELE/28-209   AC A0A3B4ZAU8.1
#=GS A0A074TB36_HAMHA/134-325  AC A0A074TB36.1
#=GS A0A368UKD6_SOYBN/40-203   AC A0A368UKD6.1
#=GS A0A397ZMW1_BRACM/38-169   AC A0A397ZMW1.1
#=GS A0A287ATT5_PIG/26-130     AC A0A287ATT5.1
#=GS A0A493T8D8_ANAPP/24-129   AC A0A493T8D8.1
#=GS G3II15_CRIGR/30-205       AC G3II15.1
#=GS A0A452CMJ6_BALAS/26-210   AC A0A452CMJ6.1
#=GS A0A398ATP3_BRACM/35-199   AC A0A398ATP3.1
#=GS M7YXN7_TRIUA/45-198       AC M7YXN7.1
#=GS A0A2P6RT00_ROSCH/1-77     AC A0A2P6RT00.1
#=GS A0A2J8PZV0_PANTR/36-211   AC A0A2J8PZV0.1
#=GS A0A1D1UEM0_RAMVA/28-206   AC A0A1D1UEM0.1
#=GS A0A067CKG8_SAPPC/6-156    AC A0A067CKG8.1
#=GS A0A3Q0FT35_ALLSI/1-118    AC A0A3Q0FT35.1
#=GS A0A3M0IMC5_HIRRU/35-210   AC A0A3M0IMC5.1
#=GS A0A445BKP2_ARAHY/96-257   AC A0A445BKP2.1
#=GS I0YWR8_COCSC/31-183       AC I0YWR8.1
#=GS A0A2I3REZ6_PANTR/32-207   AC A0A2I3REZ6.1
#=GS F7HQP4_MACMU/38-220       AC F7HQP4.1
#=GS A0A151PG94_ALLMI/1-151    AC A0A151PG94.1
#=GS A0A2K2AAM1_POPTR/102-265  AC A0A2K2AAM1.1
#=GS A0A3Q2HIS8_HORSE/26-201   AC A0A3Q2HIS8.1
#=GS A0A371I712_MUCPR/48-209   AC A0A371I712.1
#=GS A0A3B3XUV8_9TELE/23-198   AC A0A3B3XUV8.1
#=GS A0A452G9E6_CAPHI/35-210   AC A0A452G9E6.1
#=GS A0A3S3P226_9ACAR/1-116    AC A0A3S3P226.1
#=GS F4K5P9_ARATH/51-169       AC F4K5P9.1
#=GS G4YYY1_PHYSP/5-140        AC G4YYY1.1
#=GS G1RTU4_NOMLE/47-206       AC G1RTU4.1
#=GS G3SE03_GORGO/22-183       AC G3SE03.2
#=GS A0A2R2MQN6_LINUN/3-176    AC A0A2R2MQN6.1
#=GS H9H222_MELGA/1-49         AC H9H222.1
#=GS A0A3B3XDW2_9TELE/40-210   AC A0A3B3XDW2.1
#=GS A0A0A0AVC0_CHAVO/3-129    AC A0A0A0AVC0.1
#=GS C3Y1A9_BRAFL/232-410      AC C3Y1A9.1
#=GS A0A1S3IUU4_LINUN/3-83     AC A0A1S3IUU4.1
#=GS H0YQN1_TAEGU/1-93         AC H0YQN1.1
#=GS A0A3Q0SRT7_AMPCI/28-209   AC A0A3Q0SRT7.1
#=GS D8SI08_SELML/50-197       AC D8SI08.1
#=GS A0A2K6LCX2_RHIBE/26-208   AC A0A2K6LCX2.1
#=GS I3NFY1_ICTTR/30-191       AC I3NFY1.1
#=GS A0A2Y9MH62_DELLE/30-205   AC A0A2Y9MH62.1
#=GS E7FH52_DANRE/111-273      AC E7FH52.1
#=GS A0A401RK23_CHIPU/42-217   AC A0A401RK23.1
#=GS A0A369SH13_9METZ/47-179   AC A0A369SH13.1
#=GS A0A2Y9F0Y7_PHYMC/30-205   AC A0A2Y9F0Y7.1
#=GS A7RXK6_NEMVE/1-170        AC A7RXK6.1
#=GS G3RC18_GORGO/38-220       AC G3RC18.1
#=GS A0A2P6N8E5_9MYCE/2-136    AC A0A2P6N8E5.1
#=GS A0A218V333_9PASE/35-217   AC A0A218V333.1
#=GS M3WP33_FELCA/38-220       AC M3WP33.1
#=GS A0A091EW28_CORBR/30-205   AC A0A091EW28.1
#=GS D4A9N1_RAT/28-189         AC D4A9N1.1
#=GS A0A452R2G0_URSAM/27-177   AC A0A452R2G0.1
#=GS D8R3C0_SELML/21-178       AC D8R3C0.1
#=GS F6UT79_MONDO/39-222       AC F6UT79.2
#=GS A0A151PJ91_ALLMI/26-201   AC A0A151PJ91.1
#=GS A0A452EDH0_CAPHI/30-205   AC A0A452EDH0.1
#=GS A0A1L8HJG5_XENLA/22-162   AC A0A1L8HJG5.1
#=GS A0A2I0M519_COLLI/65-227   AC A0A2I0M519.1
#=GS A0A2R9APD6_PANPA/38-220   AC A0A2R9APD6.1
#=GS A0A2I3LGL6_PAPAN/37-193   AC A0A2I3LGL6.1
#=GS H0ZTN3_TAEGU/15-190       AC H0ZTN3.1
#=GS A0A2C9VD44_MANES/28-191   AC A0A2C9VD44.1
#=GS A0A2I0MP14_COLLI/3-133    AC A0A2I0MP14.1
#=GS A0A2D0SUG3_ICTPU/29-204   AC A0A2D0SUG3.1
#=GS B8AEQ3_ORYSI/49-201       AC B8AEQ3.1
#=GS A0A402EQF8_9SAUR/22-189   AC A0A402EQF8.1
#=GS A0A2K5JM99_COLAP/47-206   AC A0A2K5JM99.1
#=GS A0A3Q2ZU36_KRYMA/23-198   AC A0A3Q2ZU36.1
#=GS A0A1A6H606_NEOLE/62-198   AC A0A1A6H606.1
#=GS A0A452HUE8_9SAUR/29-195   AC A0A452HUE8.1
#=GS A7RJ26_NEMVE/6-179        AC A7RJ26.1
#=GS G1KBS8_ANOCA/4-128        AC G1KBS8.1
#=GS A0A3Q3RTD1_9TELE/211-274  AC A0A3Q3RTD1.1
#=GS A0A1U7UG53_TARSY/36-211   AC A0A1U7UG53.1
#=GS A0A2Y9JT75_ENHLU/27-188   AC A0A2Y9JT75.1
#=GS A0A024GLH2_9STRA/27-180   AC A0A024GLH2.1
#=GS HHIP_MOUSE/38-220         AC Q7TN16.2
#=GS A0A091VE79_NIPNI/69-200   AC A0A091VE79.1
#=GS A0A226N4I9_CALSU/23-198   AC A0A226N4I9.1
#=GS A0A2B4SQG0_STYPI/33-169   AC A0A2B4SQG0.1
#=GS A0A2U3YJZ3_LEPWE/38-220   AC A0A2U3YJZ3.1
#=GS A0A2K5CPX8_AOTNA/36-211   AC A0A2K5CPX8.1
#=GS A0A3B4YQU5_SERLL/28-209   AC A0A3B4YQU5.1
#=GS A0A340Y9Q8_LIPVE/27-177   AC A0A340Y9Q8.1
#=GS A0A2I2Z2K8_GORGO/59-197   AC A0A2I2Z2K8.1
#=GS A0A444Z2S9_ARAHY/65-227   AC A0A444Z2S9.1
#=GS K7EQL9_HUMAN/33-189       AC K7EQL9.8
#=GS H0WIF9_OTOGA/22-183       AC H0WIF9.1
#=GS A0A3Q2H6M5_HORSE/47-209   AC A0A3Q2H6M5.1
#=GS G3Q9P7_GASAC/15-127       AC G3Q9P7.1
#=GS A0A2Y9NR48_DELLE/31-192   AC A0A2Y9NR48.1
#=GS A0A388KRW8_CHABU/68-227   AC A0A388KRW8.1
#=GS A0A3L6RQR9_PANMI/45-196   AC A0A3L6RQR9.1
#=GS A0A2R9AW72_PANPA/38-220   AC A0A2R9AW72.1
#=GS A0A340WLY7_LIPVE/26-209   AC A0A340WLY7.1
#=GS A0A2K6SRE9_SAIBB/26-208   AC A0A2K6SRE9.1
#=GS A0A337SLR6_FELCA/31-189   AC A0A337SLR6.1
#=GS M3YFP1_MUSPF/30-205       AC M3YFP1.1
#=GS A0A226EVC4_FOLCA/40-214   AC A0A226EVC4.1
#=GS A0A091FUI9_CORBR/3-129    AC A0A091FUI9.1
#=GS F7AHC3_MONDO/23-198       AC F7AHC3.2
#=GS V4T0R8_9ROSI/29-192       AC V4T0R8.1
#=GS A0A2P5BTL3_TREOI/27-185   AC A0A2P5BTL3.1
#=GS A0A3B6PNH3_WHEAT/44-197   AC A0A3B6PNH3.1
#=GS A0A2I0LPJ3_COLLI/26-201   AC A0A2I0LPJ3.1
#=GS A0A1S3G7N1_DIPOR/26-201   AC A0A1S3G7N1.1
#=GS A0A2K6U9Z4_SAIBB/2-164    AC A0A2K6U9Z4.1
#=GS A0A0D2S538_GOSRA/43-205   AC A0A0D2S538.1
#=GS A0A3Q0SGD8_AMPCI/35-208   AC A0A3Q0SGD8.1
#=GS A0A1S3JLL6_LINUN/25-193   AC A0A1S3JLL6.1
#=GS A0A3B3YTZ6_9TELE/68-230   AC A0A3B3YTZ6.1
#=GS A0A3Q3FVR4_9LABR/27-200   AC A0A3Q3FVR4.1
#=GS A0A1U7SWL9_ALLSI/32-207   AC A0A1U7SWL9.1
#=GS A0A4D9E0R2_9SAUR/27-194   AC A0A4D9E0R2.1
#=GS A0A383ZF57_BALAS/59-234   AC A0A383ZF57.1
#=GS V4T5J6_9ROSI/29-192       AC V4T5J6.1
#=GS I3LHD8_PIG/28-189         AC I3LHD8.2
#=GS A0A2R8PJJ1_CALJA/47-201   AC A0A2R8PJJ1.1
#=GS W5MMF9_LEPOC/29-202       AC W5MMF9.1
#=GS G1PL64_MYOLU/27-201       AC G1PL64.1
#=GS A0A452HZX5_9SAUR/30-205   AC A0A452HZX5.1
#=GS H3AUG3_LATCH/21-187       AC H3AUG3.1
#=GS A0A2U3VUI7_ODORO/27-177   AC A0A2U3VUI7.1
#=GS A0A287B6L1_PIG/41-216     AC A0A287B6L1.1
#=GS C0H9Y7_SALSA/34-195       AC C0H9Y7.1
#=GS A0A0K9RED2_SPIOL/30-187   AC A0A0K9RED2.1
#=GS A0A3Q3WG09_MOLML/30-214   AC A0A3Q3WG09.1
#=GS E9Q543_MOUSE/34-156       AC E9Q543.8
#=GS A0A3Q0H308_ALLSI/415-577  AC A0A3Q0H308.1
#=GS H0VX48_CAVPO/38-220       AC H0VX48.2
#=GS A0A3Q1IJW5_ANATE/16-176   AC A0A3Q1IJW5.1
#=GS A0A2K6TR25_SAIBB/1-90     AC A0A2K6TR25.1
#=GS A0A287U6M0_HORVV/1-114    AC A0A287U6M0.1
#=GS A0A452HUK2_9SAUR/56-223   AC A0A452HUK2.1
#=GS F7BP60_MACMU/36-211       AC F7BP60.1
#=GS A0A1D5PDP9_CHICK/35-217   AC A0A1D5PDP9.1
#=GS A0A2I3GWK6_NOMLE/43-155   AC A0A2I3GWK6.1
#=GS A0A091EMR9_CORBR/30-205   AC A0A091EMR9.1
#=GS HIPL2_MOUSE/43-205        AC Q9D2G9.2
A0A0D9QVZ4_CHLSB/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
H2PEE7_PONAB/38-171                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..N..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQNL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPK-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------hkhncfciqevvs...................................................
A0A022RC25_ERYGU/30-193              ........................................vcisqggrfppfsse-----....-----G.KAPKKa..arDALRF.........................C.RVFRKR...............................TC....CDVSQTHA..ALLSIRK...LS.SY----..-........G..E..G...SQ..........DCL.QLW...ELV..E.CSI...-CDP.LVG--....VQH...........................................----..---.GPP.lIC....SS....LCDRLYQACSTA.....YFAM...D...AK.....--.T.QA..........................LSPCG..A---G..D..FVC........GRASEWV.SN..GTE.LC......RAS-GF.SVTTS....-----................------ssseeeeeelsscyg.................................................
G3R6P4_GORGO/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
K7EM70_HUMAN/27-177                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKG...............................KL....HLAEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0BRL9_PARTE/29-183                  ............................................ecslknriayg-----....------.---QQ.....KLHQLtg....................myfC.DSYAKR...............................TC....CSQQNLEE..LKFKWYR...E-.---QQL..A........V..E..L...SQ..........QCQ.EIF...TKT..I.CSD...-CDG.DIG--....-QQ...........................................----..--I.RVG..FC....PH....YCTQMYQACWRD.....LFQY...D...EK.....TQ.K.--..........................LRLCY..---QN..D..VLC........SELRNIV.NN..GDQ.FC......TSL-GY.KVNS-....-----................------ysdreewmenkyl...................................................
A0A3Q7ENE1_SOLLC/41-192              ..............................................rfsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RVFRGK...............................TC....CDVTQTHP..AFMSIRR...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSNA.....YFSI...D...A-.....KT.Q.VL..........................AP---..CAV-N..D..FVC........GRASEWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A3Q2VYP3_HAPBU/23-198              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..T..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A1L8F8R7_XENLA/54-213              ..................................................qcldy-----....--KPPF.QPSQP.....LDF--.........................C.SVYSSF...............................GC....CDSAQDEA..IASRYHY...IT.DF-LDH..S........G..V..-...-A..........ACG.DYI...RDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PLR.DVP.gLC....GN....YCMEFWHHCRNT.....LSL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------iiedkdvtelegdlgkfcsfltlddvnycypnvltnaelnsglgdvkedeegc...........
A0A2K5Y8K7_MANLE/20-194              .....................................qtpdlslpkcwdyrrepp-----....------.-----.....---SP.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A3P8TBX2_AMPPE/26-207              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.GLYADN...............................SC....CTEEHIQD..ISYVPSA..sSK.NEPWDK..C........G..R..L...SP..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigsegdgsrpcgclt..........................................
A0A3Q7VCQ0_URSAR/27-177              ......................................................a-C---....GGSHPL.PSMSQ.....THQRL.........................A.ADLGTG...............................QL....HLTEMDTP..EASDPGM...VP.----ER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCEND.....ITC-...-...--.....GL.T.WL..........................PLLEK..RGC--..E..PGC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K5NSK3_CERAT/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.RQ..........................ESHGM..DGV--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A2K6GQH9_PROCO/3-164               .................................................saatev-----....------.-----.....----Q.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........R..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQHWWEDCRTS.....YTCK...S...NW.....HQ.G.WE..........................WTSGV..NKCPA..G..ATC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
G3QYN5_GORGO/19-179                  ............................................ahpqwplcrpp-----....------.-----.....QPLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
U3ICJ7_ANAPP/29-190                  ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYGAF...............................GC....CEPRRDRE..LLQRFYR...LS.---AHL..D........G..H..T...YA..........ACA.GHL...QEL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FRYL...S...SD.....PE.L.VA..........................LE---..NNM--..A..KLC........RYLSL--.-E..DTD.YCf....pHLLTNE.NLNQNl..gLVTAD................AEGCL-q...............................................................
A0A2G5DLG5_AQUCA/36-190              .............................................sfssegkppr-----....-----K.VNKGP.....KDLTL.........................C.RVFRRS...............................TC....CDVTQTHQ..ALLTIRR...LA.SV----..-........G..E..A...NQ..........ECL.QLW...ELL..E.CSI...-CDP.LVG--....VQR...........................................----..---.GPP.lIC....SS....LCDRIFQSCSSA.....YFSM...D...A-.....KT.Q.VL..........................SPCG-..--L-S..D..FVC........GRASEWV.SN..GTE.LC......QHA-GF.SVKSS...gNG---................------hkgmeetfcyg.....................................................
A0A091IU12_EGRGA/31-206              .......................................................VCMDA....KHHKTK.PGPEG.....KLHEQ.........................C.APWKDN...............................AC....CTANTSLE..AHKDQSN...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDC.....MTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PR..PKD.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
W5MQI6_LEPOC/34-194                  ......................................................q-CL--....DFKPPF.KPPEE.....LTF--.........................C.VMYKDF...............................GC....CDAIKDQE..LMAKFYR..iMD.NFD---..-........Y..H..G...YA..........TCA.GYV...QDI..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....GD....YCSEFWLQCRTA.....ITLL...S...DD.....MQ.L.VE..........................LQEDQ.eQLC--..-..---........-------.--..---.--......------.-----....-----................------qylelgdrdycypgllanerlarnlgrvtadaegcl............................
A0A0R3UCR5_9CEST/37-165              .......................................................MCQES....EHQKQR.PSPEY.....GLTS-.........................C.TAWKNN...............................SC....CTAATATS..ITSEK--...LH.GFNFEV..C........G..K..M...SS..........ACL.AFF...HDD..H.CLV...KCSP.NLGPW....LVQls.......................................ssRFNE..RAF.KVP..LC....ES....DCNSWYDACKND.....KTCA...T...NW.....NSgG.FD..........................WES--..-----..-..---........-------.--..---.--......------.-----....-----................------gr..............................................................
A0A093PLD3_9PASS/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYEKF...............................GC....CDQERDNS..IAAKYWD...IM.DYIDP-..-........-..R..G...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.SLP.gLC....FD....YCSEFHSNCRSA.....IRL-...-...--.....--.-.LT..........................RDKHI..QECCE..T..NRT........RFCNLLQ.LH..DED.YCf....pNVLRNT.ALNYNl..gSVVED................QGGCIQ................................................................
A0A1P8BFS7_ARATH/14-174              ..................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKK...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................KRVIG.pCGVND..D..IIC........IKASNWE.SN..GTS.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
F4K5P6_ARATH/57-217                  ..................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKK...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................KRVIG.pCGVND..D..IIC........IKASNWE.SN..GTS.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A3P8TFB6_AMPPE/26-198              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....L---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A3P9BJ31_9CICH/23-198              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..S..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A2Y9RL39_TRIMA/30-205              .......................................................VCMDA....KYHKTK.PGPED.....KLHGQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...EP..........DCK.RHF...IQD..N.CLY...ECSP.NVGPW....IKQvn.......................................qrWRKE..RFL.DVP..LC....KE....DCQSWWEACRTS.....YTCK...T...NW.....HR.G.WD..........................WTSGV..NKCPV..G..TTC........HTFEFYF.PT..PAD.LC......EGLWSH.SYKAS....NYSRG................SGRCIQ................................................................
RTBDN_HUMAN/27-183                   ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3P8NBF4_ASTCA/57-219              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYATE..HDV--..T..TFC........SM---VD.LP..DQD.YC......YPI---.-----....-----................------vlkssdlnsnlgqvvedprgclq.........................................
A0A2K5NUV5_CERAT/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2T7PMZ4_POMCA/48-174              .......................................................MCIDG....RNHKSQ.PGEES.....SLMSF.........................C.SPWKKR...............................SC....CTQEIAER..MHLDRNW...LN.-FDWNH..C........G..E..L...SP..........SCR.EFF...VKD..L.CFY...ECSP.NLGPW....IVPes......................................tpvQLEE..R--.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vknlqifleqqngsakecgttalkwfqmemiasd..............................
A0A1S3HEA3_LINUN/39-216              ......................................................t-CMELl..kSHSKSK.PSPEP.....GLE--.........................C.PQYTKK...............................SC....CKAGVTED..FETKENW...QN.ITNYVH..Cp.....qkS..S..L...SP..........MCH.KMF...FDE..L.CFF...LCSP.YIGPW....IAPat......................................hdePVTD..RFT.DVP..LC....AS....ECNSWWEACKGE.....YTCH...E...NW.....YT.D.FD..........................RDENG.lNVCKA..G..AEC........RTYEAMY.RT..ASN.FC......EIIWDR.SFKVV....---PD................EEPCM-k...............................................................
A0A2R9BSE7_PANPA/1-108               ....................................................agy-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.--A...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyvlinknlnsnlghvvadakgclq......................................
A0A3Q1MAD6_BOVIN/42-138              ................................................elyeevd-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....--P..........................................rWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.G.WA..........................WSRGK..PRCPE..W..EPC........RPFPHHF.PT..PAD.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
G3HSP0_CRIGR/26-186                  .......................................................ICMNA....KHHKRE.PGPED.....KLFLE.........................C.VPWKDN...............................AC....CTFTTSWE..AHLDELL...FF.NFSMLH..C........G..L..L...TP..........VCH.KHF...IQA..V.CLH...ECSP.NLGPW....IQLvv.......................................pnRQEE..QVQ.GVP..LC....LE....DCEEWWEDCRSS.....YTCK...S...NW.....HS.S.F-..........................-----..HS---..-..---........--SQDYF.PT..PSD.LC......EKIWSN.TFKAS....PEHRN................SGRCLQ................................................................
A0A1D5NYI4_CHICK/27-188              ..............................................qcldfkppf-----....------.RPPR-.....-ALAF.........................C.RRYGAF...............................GC....CDARRDRA..LLQRFYR...LS.---AHL..D........G..P..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FHYL...S...TD.....QE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YCf....pHLLANE.NL---....-----................------nqnlglvtadaegclq................................................
A0A0P7YL54_SCLFO/38-212              .......................................................ACLQD....GKHKAT.PSPE-.....PFLNQ.........................C.ALYAEN...............................AC....CSQNDIPE..LAASPGL..kVE.EIFWDT..C........G..P..L...SP..........GCT.DFL...RRI..A.CFH...LCSP.DAARW....PHP...........................................QHPA..SYQ.AVP..LC....HS....FCRDWFETCKTD.....LTCT...R...NS.....VG.D.GE..........................WHRHP..INC--..T..GNC........VTYQQMY.EN..GRN.LC......ESVWGD.AFMSVe.ddG---Dgt...........eagSCGCL-t...............................................................
A0A3P9C1U5_9CICH/57-219              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SMV---D.LP..DQD.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
A0A151NL07_ALLMI/35-221              .......................................................RCLNG....SPPRRL.KKRER.....RLLLLdepas..............gaellpC.RGHYPR..............................lSC....CARAGRHG..LLLLPAA...TK.IFS---..-........V..T..N...NT..........ECM.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
FOLR1_HUMAN/36-211                   .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCAV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
#=GR FOLR1_HUMAN/36-211        SS    .......................................................BEEST....SS-ESS.-BSBT.....TGGTT.........................T.GGGSSS...............................BS....SBHHHHHH..TTSTT-T...TT.SS-TTT..T........S..S..-...-H..........HHH.HHH...HHH..H.HHH...HH-S.TTGGG....EEEEE.......................................ETTEEE..EE-.SB-..B-....HH....HHHHHHHHTTTS.....EES-...S...-S.....SS.S.-B..........................GTTSS..-B-SS..G..GG-........EEHHHHS.SS..HHH.HH......HHTTTT.SB---....SS-TT................SSSSB-................................................................
A0A2I4B9B7_9TELE/28-206              .......................................................ACLQD....GKYKAT.PGPEA.....HLT-E.........................C.GIYAEN...............................SC....CTEEHIQD..ISYVPSA..sSK.NEPWDK..C........G..P..M...SP..........ECE.GFL...KRV..A.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFNACRMD.....MTCA...-...--.....-R.N.WA..........................KDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPQevmeag...dsgaegrP-----cgclt...........................................................
A0A226PHQ1_COLVI/21-188              ......................................................g-CLEG....DTHKEK.PSPEP.....NMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVS.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....INP...........................................RHTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICA...H...NW.....LT.D.WD..........................WDDRG.eNHC--..R..SKC........VPYSEMY.AN..GTD.MC......QNMWGE.SFKVS....---EA................SCLCLQ................................................................
A0A067EM12_CITSI/29-192              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetscy............................................
A0A0E0NH62_ORYRU/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
C3Z5S0_BRAFL/64-202                  .........................enpnnkvaerlgwpspvddchlqslhkdtv-----....------.-----.....-----.........................-.------...............................--....--------..QKIKEAY...GK.EWHWDR..C........G..P..L...SS..........ACE.RFF...VQE..A.CLY...ECEP.NAGFY....-RKfpdhvy...............................ndsdpnHNKW..QME.GMP..IR....AD....YCDAWFRACRYD.....RFCA...A...DS.....--.-.GS..........................YSS--..-----..-..---........-------.--..---.--......------.-----....-----................------careyakvdntgdn..................................................
A0A3Q3WCH9_MOLML/42-208              .......................................................ACLQD....GKHKAM.PGPEL.....NLRE-.........................C.TLYADN...............................SC....CTEGDIHD..ISHLPSE..iNR.NEPWDK..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................----..--H.HEP..--....--....-----KTQCQTD.....MTCA...R...--.....--.N.WV..........................GDPRG..QSC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDELE................------evgeaaevgaegdggrpcsclt..........................................
A0A1U7SMZ8_ALLSI/53-228              .......................................................VCMDA....KHHKTK.PGPEG.....ELHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.RHF...IQD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
A0A3Q2VVC9_HAPBU/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleihdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A1V9Z6B1_9STRA/11-177              ........................................crstgglkfdpaepp-----....------.RQQRP.....GAMEH.........................C.AKYAKN...............................TC....CNATHVLP..LKRLVLE..pLV.------..-........A..G..V...NG..........RCQ.ELS...EEL..T.CSA...-CHP.LMGTS....---...........................................----..---.RME.rVC....PD....LCDEWFDACKHE.....FYMA...G...NH.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------hlapcygnalicsplkdivstsvtrrthvalieaycrgrdfcrrmgytpgkatdtegkdcfd..
A0A2K6N9T1_RHIRO/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...QP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WSSGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
A0A314KWB8_NICAT/41-192              ..............................................rfsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RIFRGK...............................TC....CDVTQTHP..ALLSIRR...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRASQWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A401SFU6_CHIPU/99-260              .......................................................TCPVT....GSHKAA.PSPEP.....DLHD-.........................C.PLYSKN...............................AC....CTANIKDK..VNTSPEA...VS.---WNQ..C........G..R..L...ST..........KCE.QFF...SQL..S.CFY...RCSP.DVTIW....ASP...........................................RHSN..SLL.NVP..LC....QG....FCDQWYKACEND.....QTCV...R...DW.....NA.G.LK..........................GSNRT.rGIC--..T..SDC........IPFTKMY.KN..GKD.LC......ESISGS.SFKVR....-----................SCNCLN................................................................
A0A151P3F2_ALLMI/66-228              ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SAYEKF...............................GC....CDQEKDNS..IAAKYWE...IM.DYIS--..-........P..Q..G...HR..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHFNCHSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.LQ..DQD.YCf....pNILKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
Q94BQ5_ARATH/38-198                  ..................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKK...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................KRVIG.pCGVND..D..IIC........IKASNWE.SN..GTS.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A060WNJ3_ONCMY/33-194              ......................................................q-CL--....DYKPPF.QPREP.....LVF--.........................C.KEYAKF...............................GC....CDLEKDDK..ISQNFYK...IM.DY-FDY..S........G..Y..-...-M..........TCA.KYI...RTI..L.C-Q...ECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRYT.....ISLL...T...DN.....NA.T.VG..........................IEEDR.nKFC--..-..---........NF---LE.LK..DRE.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A3Q3ASB6_KRYMA/46-208              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.TQYQDF...............................GC....CDQKTDNM..IAERYWD..iIE.--HLEK..-........-..A..G...YD..........LCE.AML...KKI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSKFHSKCRHV.....LKYL...-...-T.....VN.Q.VL..........................LDTSE..RDM--..S..TFC........SIVD---.LS..DQD.YCy....pNVLKST.DLNSNl..gQVVED................PRGCL-q...............................................................
W5NI26_LEPOC/18-180                  ..........................................qcldyrppfkppf-----....------.-----.....-HLEF.........................C.TEYETF...............................GC....CDQDTDNA..IAERYWD...IM.DFY---..D........I..Q..G...YE..........LCG.GFV...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPYT..PLR.NLP.gLC....FN....YCSEFHVKCHSV.....VKLL...T...--.....--.-.-D..........................DKHIQ..ETC-E..K..DRF........MFCSLLN.LP..DQD.YCy....pN-----.-----....-----................------vlqntilnrnlgsmvqdrsgclq.........................................
A0A401PDQ3_SCYTO/172-236             .....................................................tk-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....-----YKACEHD.....QTCV...R...NW.....NT.D.LK..........................WSNRT.eGTC--..T..SDC........ISFDKMY.KD..GKD.LC......QSTSGD.SFKVK....-----................SCNCLN................................................................
G1SCR2_RABIT/35-210                  .......................................................VCMDA....KHHKEK.PSPED.....KLHEQ.........................C.SPWKKK...............................AC....CSTNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCQRWWEDCRTS.....HTCK...S...NW.....HK.G.WN..........................WTSGF..NQCPV..G..AAC........HPFHFYF.PT..PAA.LC......EEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
H9GSY7_ANOCA/1-64                    .......................................................-----....------.-----.....----Q.........................C.SPWKEL...............................AC....CTANTSQA..AHQDVSY...LY.NFNWNH..C........G..I..M...TA..........KCK.AHF...IQD..T.CLY...ECSP.NLGPW....VV-...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------q...............................................................
A0A397Z2E1_BRACM/37-197              ......................................vcvskggrfppyesegk-----....------.-PPKPvgkgsKDLTL.........................C.QVFRKR...............................TC....CSPAQTNP..AFVAVRN...LA.TF----..-........G..E..A...SQ..........ECQ.HLF...ELL..E.CSI...-CNP.NIG--....VQP...........................................----..---.GPP.rIC....AS....FCNKVFAACKDA.....YFAS...N...AL.....--.-.--..........................TQMIG.pCGV-N..D..IIC........VKTSSWE.SN..GTS.FC......EAA-GF.SVQTN....-DDSR................KEPC--yg..............................................................
H0VJP2_CAVPO/12-187                  .......................................................VCMNA....RYHKRE.PGPED.....KLFLQ.........................C.APWKDN...............................AC....CTATTSWE..AHRSESY...LH.NFSLIH..C........G..L..L...TP..........SCQ.RHF...IQA..T.CFY...ECSP.NLGPW....IRLvd.......................................pqDLEE..RVL.GVP..LC....QE....DCEEWWADCSSS.....YTCK...S...NW.....HG.G.WD..........................WSQGK..SRCPA..G..ALC........RPFPDYF.PT..PAD.LC......EKIWSN.SFKAS....SAHRN................SGRCLQ................................................................
F7GMA9_CALJA/22-183                  ...............................................qcldfkpp-----....-----F.--RPP.....QLLTL.........................C.SRYSAF...............................GC....CDAKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRH-...-...--.....--.-.FS..........................TDKAL..RAL-E..D..NRD........KFCHYLS.LD..DTD.YCy....pDLMSNK.NLNSDl..gHMVAD................ATGCL-q...............................................................
F7BP69_MACMU/3-164                   ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
K8EAN2_9CHLO/37-209                  ...................................................mtmk----K....RCKNTN.DAPKK.....QPLTF.........................C.DDYRSH...............................TC....CTSRDTDR..ILVHHVE...MQ.R-----..-........Q..S..V...SA..........TCA.SLF...GRF..E.CSK...-CDArNLGGS....TRN..........................................nNNSE..DDD.RFK..VC....SA....YAKQLYRACKEE.....YFVE...G...AV.....GG.G.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vgagrgssglissggrltpckstdaicakleefsgnwkeavemmgakvvgrtkkkarl......
A0A3Q1MF97_BOVIN/26-167              .......................................................VCMNA....KPHKPE.PGPEA.....ELYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.G.WA..........................WSRGN..SR---..-..---........-------.--..---.--......------.-----....-----................------vvgktaegi.......................................................
A0A2R9CB09_PANPA/44-206              ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGR..DGT--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
A0A3B4DJ87_PYGNA/33-208              .......................................................MCMDA....KHHKTE.PGPEG.....ELYKQ.........................C.APWREN...............................AC....CTANTTAE..AHEDNSY...LY.NFNWNH..C........G..V..M...SE..........QCK.SHF...IQD..T.CFY...ECSP.HLGPW....IQQvd.......................................ssWRKE..RIL.DVP..LC....LE....DCEGWYKDCKDD.....FTCK...D...NW.....HI.G.WD..........................WSSGV..NYCPK..Y..AHC........RKWTEVF.PD..AKS.MC......EKIWSN.SYKYT....TLTKD................SGRCMQ................................................................
U3FQI0_CALJA/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6GLL1_PROCO/22-183              .................................................rcldfr-----....---PPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEQDAA..LARRFGA...LAaRV----..D........A..A..V...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLDMWQTCRGL.....FRHF...S...PD.....--.R.VL..........................WSLEG..NRA--..-..---........KFCHYLS.LD..DAD.YCf....pHLLVNE.NLNANl..gRVVAD................AKGCLQ................................................................
A0A096MUT0_PAPAN/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A3P8X963_ESOLU/34-195              ..............................................qcldfkppf-----....------.KPQ--.....EDLQF.........................C.TMYGTF...............................GC....CDSVKDQE..LMTKFYN..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PTR.TIP.gLC....PD....YCSQFWSKCRST.....ITLL...S...DQ.....PQ.H.AE..........................TEQDQ.vRFC--..-..---........---QN--.--..---.--......------.-----....-----................------lqledpdycyphilrneqltqnlgrvvanpegclq.............................
A0A183TCR0_SCHSO/1-112               .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.-MP..LC....QS....DCDAWYDACRKG.....LTCA...R...NW.....RS.GgFNwtseeldtileqeinkvtsksvlkqkSPAGT..NHCHE..G..LTC........QPIELVF.SS..AKD.FC......EQVWDG.SWKVI....PDSKH................------vwldeeplclh.....................................................
A0A3R7MUC2_PENVA/16-201              ......................................................w-CLDA....RHHKKL.PGPEG.....DLFKQ.........................C.TPWKTR...............................SC....CTEEVTRK..IHEDS--...LY.SFNFNH..Cmh...qtkK..E..M...SR..........ECH.RHF...KQD..H.CFY...ECSP.NVGPW....VVSek.......................................rsWRKE..RYF.KVP..LC....AS....DCEAWFNSCADD.....YTCT...D...NW.....SR.N.FDwles.................sqctsGTKCK.tNFCPK..G..SDC........RTFKEIY.LT..AQN.FC......EKVWDD.AWEYT....---ND................SSPCM-r...............................................................
A0A3Q3BLK1_KRYMA/38-209              ..........................................chpqcldykppfg-----....------.--PQQ.....PLVF-.........................C.KEYTKF...............................GC....CDLSKDEE..ISSRFYT..iMD.NF--DH..-........-..S..G...FT..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWWECRYT.....LS--...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llledlgnppqfanltsaieedhkrfcdvlelkdkqycypnvltnaelnanlglvredpkgcl.
A0A3L6QEC6_PANMI/135-286             ..............................................fssegkppg-----....------.RAPKG....rRDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALISVRN...LA.L-----..T........G..E..G...SQ..........ECI.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.aIC....AS....FCDMVFKACSES.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SV---....-----................------qvsgtssglvddifc.................................................
H2TG96_TAKRU/121-296                 .......................................................MCMDA....KHHKKV.PGPEG.....QLYLQ.........................C.APWRDN...............................AC....CTANTSTE..AHEDNSY...LY.NFNWNH..C........G..A..M...SD..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQEvd.......................................qsWRKE..RIF.NVP..LC....KE....DCHEWWEDCKNE.....FTCK...S...NW.....HT.G.WD..........................WSSGI..NKCPA..D..RKC........RKWTEVY.PT..PKY.MC......EQIWSN.SYLYT....TYSKT................SGRCMQ................................................................
A0A091J841_EGRGA/21-188              ......................................................g-CLEG....DTHKLK.PSPEP.....NMHE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVR.NSYWNR..C........G..Q..L...SK..........PCE.DFT...KKI..E.CFY...RCSP.HAAHW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICA...H...NW.....LT.D.WE..........................WDESG.eNRC--..K..SKC........IPYSEMY.TN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K6RRY4_RHIRO/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....RE.L.Q-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------alegnrarfcrylslddmdycfpyllvnknlnsnlghvvadakgclq.................
A0A1U7QHH8_MESAU/31-206              .......................................................VCMDA....KHHKEK.PGPED.....NLHNQ.........................C.SPWKKN...............................SC....CSTNTSQE..AHEDISY...LY.RFNWDH..C........G..K..M...TP..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWQDCRTS.....FTCK...S...NW.....HK.G.WN..........................WTSGH..NQCPV..G..ASC........HPFDFYF.PT..PAA.LC......EEIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A3P8T9E3_AMPPE/37-209              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....L---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A2Y9DQ33_TRIMA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMPQldlls...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRVDNK...IF.S-----..-........V..T..N...NT..........ECR.KLL...EEI..K.CAH...-CSP.HSQNL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A210PDV1_MIZYE/48-187              ...................................................fcsf-----....-FNNRA.PEPQP.....NLKN-.........................C.TWFKEN...............................SC....CMQEEIAE..TFEQVKS...LP.------..-........-..G..A...SP..........ACQ.QYT...NYL..M.C-Y...ICAP.YQNMF....YIW...........................................----..--G.YLK..VC....EE....FCDAWYGACGSA.....ILKG...S...RV.....NQ.L.--..........................YTNGS..DFC--..K..SRS........YKVSTIA.QK..---.--......------.-----....-----................------dcfffdklmdttngqrs...............................................
A0A091UZ53_NIPNI/1-110               .......................................................-----....------.-----.....----Q.........................C.ALWKEN...............................AC....CTANTSVE..AHQDQSY...LY.NFNWDH..C........G..A..M...PE..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................nsWRKE..RIL.HVP..LC....RE....DCEQWWEDCQDA.....VTCK...V...NW.....HK.G.WN..........................WTS--..-----..-..---........-------.--..---.--......------.-----....-----................------g...............................................................
A0A3Q2EC14_CYPVA/37-198              .............................................qcldfkppfr-----....------.---PN.....RDLEF.........................C.VMYREF...............................GC....CDQQKDQE..LMARYYQ..iME.NL--D-..-........L..G..G...YE..........SCA.AFV...MEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNECRSV.....IPSL...S...ND.....HR.L.HH..........................AKDNQ..NRL--..-..--C........---KLLE.LD..DAD.YCy....pHLLSNQ.KLTQNl..gRVQRD................SDGCLQ................................................................
A0A3B5A5T3_9TELE/31-203              ...............................................chpqcldy-----....--KPPF.QPHQP.....LLF--.........................C.KEYSKF...............................GC....CDVVKDEE..ISRRFYN..iMD.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDT..........................................eDANT..PMR.IVP.gLC....GD....YCYDYWHQCRYT.....LGLL...L...E-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dsgslqqfanltamieedrkkfcdflelkdkqycypnvltnaelnanlglvredpkgcle....
A0A0D9RDG0_CHLSB/24-185              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LE.S---RV..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....--.-.--..........................--QEL..QAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A3Q2I7B9_HORSE/26-171              .......................................................VCMNT....QHHKRE.PGPED.....KLHKE.........................C.IPWKDS...............................AC....CTANTSWK..AHLNVSL...LY.NFSLVH..C........G..L..M...MP..........GCQ.RHF...IQA..V.CFY...ECSP.NLGPW....IQQvg.......................................rwGQEE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSGEE..KGNP-..-..---........-------.--..---.--......------.-----....-----................------rqnqlgsqgmn.....................................................
A0A060W5W4_ONCMY/34-195              ..............................................qcldfkppf-----....------.KPQ--.....EDLQF.........................C.AMYRNF...............................GC....CDSAKDQE..LMAKFYK..iMD.NFD---..-........N..Y..G...YA..........NCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRST.....ITLL...S...DD.....LQ.L.AQ..........................AEPDQ.vHFC--..-..---........-------.--..---.--......------.-----....-----................------qhleledpdycyphllsneqltqnlghvladpegclq...........................
G1U5B1_RABIT/30-205                  .......................................................ICMDA....KHHKVK.PGPED.....KLHAQ.........................C.SPWRKN...............................AC....CSVSTSQE..LHKDGSR...LY.NFQWDH..C........G..K..M...EP..........ACK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KD....NCQRWWEDCRTS.....HTCK...S...NW.....HK.G.WD..........................WTSGV..NRCPA..G..ATC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSSG................SGRCIQ................................................................
I3IVA9_ORENI/27-189                  ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SM---VD.LP..DQD.YCy....pNVLKSS.DLNSNl..gQVVED................PRGCL-q...............................................................
A0A024UI10_9STRA/18-172              ........................................qplcrstggikfdpt-----....---EPS.RQQKQ.....RSLEH.........................C.SKYWQN...............................SC....CNETHTIP..LKLRVME...--.----PH..V........A..M..F...NS..........KCQ.ALH...EEL..T.CSV...-CHP.FVGTG...rMD-...........................................----..---.--R..IC....PD....LCDDWFDACKDE.....FYT-...-...PD.....GS.Q.AL..........................SPCYG..NAL--..-..-IC........SPLHTIL.ST..GRD.FC......KAM-GY.-----....-----................------tpgkstdtdgvtcfd.................................................
A0A1S3AF88_ERIEU/21-196              .......................................................VCMRS....AHHKPK.PSPED.....QLYEE.........................C.APWKAN...............................AC....CTANTSWL..AHLDVSP...LL.GASLSH..C........G..L..L...AP..........DCR.RHF...TRA..L.CFL...HCSP.NLGPW....IRPep.......................................gaLQAR..RAA.GVP..LC....KE....DCEQWWEDCRSA.....STCK...D...DW.....LH.G.WH..........................RSGGR..TRCPP..G..ASC........RPFPRVF.PG..PAA.LC......GRLWGG.TFRAS....GEPRG................SGRCLQ................................................................
A0A3Q1GNY2_9TELE/38-210              ...........................................schpqcldykpp-----....-----F.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISQRFYT..iME.NF--DH..S........G..-..-...YS..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRYT.....LS--...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A3Q1F5K7_9TELE/38-210              ...........................................schpqcldykpp-----....-----F.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISQRFYT..iME.NF--DH..S........G..-..-...YS..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRYT.....LS--...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A1V4JUL1_PATFA/1-154               ......................................................m-----....------.-----.....-----.........................C.RGLYPR..............................lSC....CSRTDAQG..LLHAEAK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKDEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9L219_ENHLU/31-206              .......................................................VCMDA....KHHKEK.PSPED.....ELHKQ.........................C.SPWKKN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HQ.G.WD..........................WTSGY..NRCPA..G..AAC........LPFHFHF.PT..PAA.LC......SEIWTH.SYQAS....NYSRG................SGRCIQ................................................................
K7FXM7_PELSI/32-199                  .......................................................RCLEG....ETHKPR.PSPEP.....DMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVS.HSSWDR..C........G..E..L...SK..........SCE.EYM...KKI..E.CFY...RCSP.HAAHW....INP...........................................NYTS..GIK.LVP..LC....QN....FCDDWYEACKSD.....LTCV...H...NW.....LT.D.WE..........................WDENG.eNHC--..K..NEC........ISYDKVY.AN..GTD.LC......QSMWGD.SFKVS....---DS................SCLCLQ................................................................
A0A2K5MME5_CERAT/20-181              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FHHL...S...T-.....--.-.--..........................-DQEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A3P8QUM8_ASTCA/36-208              .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDVEKDEE..ISGRFYN..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDADT..PMR.ALP.gLC....GD....YCSDYWRQCRYT.....LSLL...L...ED.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle.....
A0A1U8DXJ0_ALLSI/26-201              .......................................................ICMDA....KHHKAK.PGPEG.....ELHGQ.........................C.TPWKAN...............................AC....CTGNTSTE..AHQDQSY...LY.RFNWNH..C........G..V..M...PR..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IVKtd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCE...E...NW.....HK.G.WN..........................WATGT..NHCPW..G..TMC........RPFKQVF.PR..AAD.LC......EKIWSD.SYRYT....TAPRG................SGRCIQ................................................................
A0A2U4AE87_TURTR/7-166               ....................................................fih-----....------.-----.....---LQ.........................C.IPWKDS...............................AC....CTANTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IRRld.......................................prGRAE..RIL.DAP..LC....RE....DCEQWWADCRTS.....YTCK...S...NW.....HG.G.WT..........................WSRGK..PRCPA..R..ALC........RPFLHYF.PT..PAD.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
A0A368UHK4_SOYBN/40-203              ...........................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
H2QQ84_PANTR/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................egEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2U4BPN7_TURTR/30-205              .......................................................VCMDA....KHHKVK.PGPED.....KLHDQ.........................C.IPWKKN...............................AC....CSAKVSQE..LHRDTSS...LY.NFNWEH..C........G..K..M...KP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...A...DW.....HK.G.WN..........................WTSGS..NKCPT..G..TTC........GTFEFYF.PT..PAA.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A337S480_FELCA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FNSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3B3B8J1_ORYME/23-198              .......................................................MCMDG....KHNKVE.PGPEG.....QLYSQ.........................C.SPWREN...............................AC....CTANTSEE..AHNDNSY...LY.NFNWNH..C........G..V..M...SE..........ACK.KHF...VQD..T.CFY...ECSP.HLGPW....IQEad.......................................esWRKE..RII.DVP..LC....KE....DCESWWSDCKNE.....LTCK...T...NW.....HK.G.WD..........................WSSGT..NKCPE..G..SKC........SKWTDMF.PT..PQS.MC......EQIWSN.SYVYT....TYTKS................SGRCMQ................................................................
M7BFF1_CHEMY/76-239                  ................psqslhcsmgehdareetsnckmfgagivsllyvytrdr-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.-----Q..C........L..A..C..gQP..........GCE.DYM...KKI..E.CFY...RCSP.HAAHW....INP...........................................NYTA..GIE.FVP..LC....QN....FCDDWYEACKND.....STCI...R...NW.....MT.D.WE..........................WDENG.vNHC--..K..NEC........IPYNKPI.QS..DHC.--......------.-----....-----................------lhnvydnqgvsdfslrvalqtllkeycev...................................
A0A3Q1G199_9TELE/35-210              ........................................wwgschpqcldykpp-----....-----F.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISQRFYT..iME.NF--DH..S........G..-..-...YS..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRYT.....LS--...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A1U7SYQ8_TARSY/30-205              .......................................................VCMDA....KHHKTK.PGPED.....ELHGQ.........................C.SPWRKS...............................AC....CTVDTSQE..LHKDTSR...LY.NFNWEH..C........G..T..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KD....DCQSWWQDCRTS.....YTCK...S...NW.....HE.G.WD..........................WSSGV..NKCPT..G..ATC........RTFESYF.PT..PAA.LC......EELWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B4AS81_9GOBI/26-199              .......................................................VCLQD....GKHKAV.PSPEP.....HLQE-.........................C.SLYAGN...............................SC....CTEEHIQD..IFPVSTT..sNK.NEPWDK..C........G..P..L...SP..........ECD.SFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................QHPS..SIQ.AVP..LC....HS....FCRDWFEACRTD.....VTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GSC........VSYQQMY.QH..GRD.LC......ESLWGD.AFMAV....EDEPEelte........ntgtPCGCL-t...............................................................
A0A314YQ87_PRUYE/27-183              ......................................cidsrapstlssplkfc-----....------.-----.....-----.........................-.-PYNET...............................AC....CNSTEDSQ..IQKQFQT...MN.------..-........-..I..S...NS..........GCA.SLL...KSV..L.CA-...RCDP.FSGEL....FTVdsvprpvp..........................llcnstvsaNSSQ..SIQ.DV-..--....ND....FCSNIWDTCQNV.....SILN...S...P-.....--.-.FA..........................PSLQG.qAGVPV..K..SNV........SELTKLW.QS..KAD.FC......NAFGG-.-----....-----................------assdgs..........................................................
C3Y1A9_BRAFL/437-606                 ......................................................g-CLGG....RTNKRT.PGPEP.....DLQV-.........................C.SEYSMN...............................SC....CSAEFDQQ..LRMSPVV..kID.KFYMNR..C........G..T..M...SP..........RCE.QFG...LAM..N.CHY...HCDP.MIYRY....GKR...........................................GHPW..AVQ.NIP..IC....SS....FCDDFFDACRDD.....LTCA...E...SQ.....AT.D.WY..........................YSPEG.iNNCRP..D..SKC........RTFAEVY.VD..GRG.LC......NNIWGD.SYVYT....---ED................DDTCI-n...............................................................
W5KWD9_ASTMX/32-207                  .......................................................MCMNG....KHQKTE.PGPEG.....ELYKQ.........................C.VPWREN...............................AC....CTANTSAE..AHEDNSY...LY.NFNWNH..C........G..V..M...SP..........KCK.SHF...VQD..T.CFY...ECSP.HLGPW....IQLad.......................................ssWRKE..RII.DVP..LC....LE....DCESWYNDCKYD.....FTCK...D...NW.....HK.G.WD..........................WSSGT..NHCPT..G..AEC........RLWSDVF.PD..AKS.MC......ENIWTN.SYKYT....TLTKD................SGRCMQ................................................................
F6ZR48_HORSE/72-247                  .......................................................VCMDA....KHHKQK.PGPED.....TLHEQ.........................C.NPWKEN...............................SC....CSLTTSQE..AHKDISH...LY.RFNWDH..C........G..R..M...EA..........IRK.RHF...IQD..T.CLC...ECSP.NLGPW....IQQvd.......................................qsWSKE..RIL.DVP..LC....KE....DCPCRWEDCHPS.....YTCK...T...NW.....HK.G.WN..........................CTSGF..NQCPV..E..AAC........RPFDFYF.PT..PEA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3BS36_ORYME/28-206              .......................................................VCLQD....GKHKAT.PSPEP.....YLTE-.........................C.GLYADN...............................SC....CTPEDIQD..ISHVPSV..sNK.NEPWDK..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..HNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPQeqgeag...esgvegrP-----cgclt...........................................................
M3W3V7_FELCA/48-199                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.TPWRKN...............................AC....CSHNTSQE..LHKDPSL...LY.NFNLDH..C........G..K..I...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQE...........................................LAQG..RFL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGE.gLGVN-..-..---........-------.--..---.--......------.-----....-----................------ysrgsgrciqmwfdpaqgnp............................................
A0A2U3WNY1_ODORO/27-213              .......................................................VCMNT....KHHKRE.PGPED.....KLYEE.........................C.LPWQGN...............................AC....CTAGTSWE..AHLDVSL...LY.NFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..V.CFY...QCSP.NLGPW....IRKvrrlgqg............................ggrhmdsgGPGE..RIL.DAP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WD..........................WSGGK..NRCPA..R..AVC........RPFPHYF.PT..PAD.LC......EKIWSR.SFKAS....PEHRG................SGQCLQ................................................................
A0A3P8NBB6_ASTCA/21-183              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYATE..HDV--..T..TFC........SM---VD.LP..DQD.YC......YPI---.-----....-----................------vlkssdlnsnlgqvvedprgclq.........................................
A0A2U3V4B3_TURTR/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K5F404_AOTNA/37-193              ......................................................a-C---....GGSRSL.QARSQ.....RHHGL.........................A.TDLGKDkph.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A0D2R9S0_GOSRA/43-205              .....................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRR...LA.L-----..T........G..E..A...SE..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGA..NDF--..-..-VC........GRASEWA.SN..GTE.LC......LA----.-----....-----................------agfrveqsvgmhggieelscy...........................................
A0A2K5TT37_MACFA/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3B5Q412_XIPMA/39-210              ...........................................hpqcldykppfg-----....------.--PQQ.....PLVF-.........................C.KEYIKF...............................GC....CDLQKDEE..ISRKYDS..iME.NFD---..-........T..L..G...SA..........KCG.AYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRDCRYT.....LSLL...L...E-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dkgnpqqfanltaaieedrrrfcdflefkdkqycypnvltdaelnanlglvqedskgcle....
A0A2C9VFH6_MANES/11-134              ...................................................fhhf-----....------.-----.....-----.........................-.------...............................--....--------..--QLKEN...LQ.KRRLAS..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.KIG--....VQP...........................................----..---.GLP.lIC....TS....FCDRVYQACADA.....YFSM...D...AK.....-T.Q.VV..........................A-P--..CGV-N..D..FVC........GKASQWV.SN..GTE.LCl....sAGFTVK.SYEAA....EGGTE................EASC--yg..............................................................
W5NB87_LEPOC/15-167                  ......................................................q-CL--....DYKPPF.QPPEP.....LTF--.........................C.KEYSEF...............................GC....CDLERDTR..ISGRYYE...IM.DYF-D-..-........F..S..G...FI..........ICG.KYI...RSI..L.C-Q...ECSP.YAAHL....FDA..........................................eDANT..PMR.ELA.gLC....GD....YCTEFWLQCRST.....LSLL...M...D-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------netiiqiegdrdtfcallelkdpeycypnvltntelnanlgav.....................
H9GK27_ANOCA/32-193                  .......................................................RCLSG....GKHKPS.PSSEE.....QLGV-.........................C.QIYAES...............................AC....CSPEIAQD..LSKANDI...--.--YWNR..C........G..H..L...SS..........RCE.KYL...EQV..E.CFY...RCSP.IAAQW....PHP...........................................QRPT..ALL.AVP..LC....QG....FCDRWYDACKDD.....LTCA...R...NW.....LT.D.WH..........................WGPDG..NNC--..S..QDC........ISYGQMY.QN..GKE.LC......ETIWDD.TFTVS....---TD................PCECL-t...............................................................
A0A087XCB2_POEFO/40-210              ............................................pqcldykppfg-----....------.--PQQ.....PLVF-.........................C.TDYTKF...............................GC....CDLQKDEE..ISRKYDL..iME.NFD---..-........T..L..G...SA..........RCG.KYI...SSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..QMR.VLP.gLC....GD....YCSDYWRDCRYT.....LSLL...L...ED.....KG.N.LQ..........................QFANL..TAAIE..E..DRR........RFCDFLE.LK..DKQ.YCy....pNVLTDA.ELNA-....-----................------nlglvredstgcle..................................................
A0A2Y9KV80_ENHLU/31-206              .......................................................VCMDA....KHHKAK.PGPED.....KLHGQ.........................C.TPWKEK...............................AC....CSVSTSQE..LHKDTSL...LY.NFTWEH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRTS.....YTCK...N...NW.....QR.G.WD..........................WTSGI..NKCPA..G..TTC........RTFETYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
K1PIY6_CRAGI/27-189                  .............................................cldfrppfnp-----....------.---E-.....GALQF.........................C.TEYSNF...............................GC....CTNRDDLD..VRDEYDR...IM.R---QL..S........D..A..D...VR..........ACE.RYV...KEL..V.C-Q...RCSP.YAAHI....YDA...........................................EGTL..MSR.PFP.gLC....NS....YCRDFYRSCRQI.....VRH-...-...--.....--.-.FT..........................PDPNI.qQQI-S..Y..GTS........AFCNYIR.LN..DDD.YCypdlktNPILNN.RISIK....QYTSE................GCLCM-e...............................................................
G3NU04_GASAC/28-209                  ......................................................l-CLQD....GKHKAA.PGPEP.....QLTE-.........................C.GIYADN...............................SC....CTEENIQD..ISHVPSE..vNK.NEPWDK..C........G..A..L...SS..........ECK.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACKMD.....MTCA...-...--.....-R.N.WA..........................KDPRG..HNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFVAV....EDEPEyageageagseggggrP-----cgclt...........................................................
I3M8E2_ICTTR/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlelln...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCVQ................................................................
A0A498K8T5_MALDO/26-188              ......................................vcisqggrfppfssegk-----....------.-PPKRvskgsKDLTL.........................C.RVFRKK...............................TC....CDVAQTHP..ALVSVRK...LA.S-----..S........G..E..A...GP..........ECL.HLW...ELL..E.CSI...-CDP.RIG--....VQS...........................................----..---.GPP.vIC....AS....FCDRVFEACAEA.....YYST...-...DA.....IT.Q.VL..........................APCGV..NDY--..-..-VC........GRASEWI.RN..GTE.FC......YAA---.-----....-----................------gfavkddisvskeepfcyg.............................................
A0A3Q2W1W4_HAPBU/28-209              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTQEQIQD..ISHVPSA..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..L.CFY...RCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
A0A4D9E2K4_9SAUR/40-206              .......................................................RCLAG....GKHKVA.PSPEG.....QLGV-.........................C.QLYAAN...............................AC....CSPKVAQE..ISSAPLT..kLN.DIYWNR..C........G..S..L...SP..........RCE.HYL...QRV..E.CFY...RCSP.SAARW....PHP...........................................QRPT..AVL.GVP..LC....LS....FCGVWYEACKDD.....LTCA...R...NW.....VS.D.WQ..........................WGPQG..NNC--..S..RDC........VPYSQMY.RD..GRE.LC......ENIWGD.SFVAA....---RQ................PCPCL-s...............................................................
A0A2U4AZE6_TURTR/27-116              ......................................................a-C---....GGSHPL.PARSQ.....RHHRL.........................V.TNLGTS...............................QL....HLAEMNTP..EASDPGI...VS.----GS..C........G..E..L...SP..........GCE.SFL...GNL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAW-------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A1L8G6J3_XENLA/51-210              .............................................dygppfkplv-----....------.-----.....-HLEF.........................C.SQYETF...............................GC....CDQDKDNV..IAEKYWS..iMD.YFD---..-........L..N..G...YH..........TCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQNS.....ITLL...T...E-.....--.-.--..........................DKQIR..ESC-D..K..GRD........LFCNLLN.LP..DED.YC......F-----.-----....-----................------pnvlhntelnnnlgsvvedpegcik.......................................
A0A2K5TT28_MACFA/59-215              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A0Q3PC11_AMAAE/1-154               ......................................................m-----....------.-----.....-----.........................C.RGLYPR..............................lSC....CSRSDAQG..LLHAESK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..R.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GICf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2U3YPX7_LEPWE/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKNISL...LY.NFTVDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...S...NW.....HR.G.WN..........................WTSGI..NQCPT..G..TTC........RTFETYF.PT..PAA.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2R8MPG7_CALJA/36-211              .......................................................VCMDA....KHHKAH.PGPED.....NLYGQ.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3VVA9_9TELE/11-173              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.SQYEQF...............................GC....CDQRTDNV..IAERYWD..vIE.QLE---..-........T..A..G...YD..........LCE.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHSKCRHV.....LRYL...T...D-.....-N.Q.LL..........................LDTSG..RDM--..A..TFC........SLVD---.LS..DQD.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
A0A2K6PQ81_RHIRO/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A059B747_EUCGR/107-259             ............................................asegkppgkvg-----....------.--RGS.....KGLTL.........................C.RVFRKK...............................TC....CDVSQTHP..ALIATRR...LT.L-----..K........G..E..A...SE..........ECV.QLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....LCDKIFQACSNA.....YFSM...D...PK.....-T.Q.VL..........................APCGV..NEV--..-..-IC........ARASECV.SN..GTE.LC......LAA---.-----....-----................------gfsvkldddryvgseeahcyg...........................................
W1NXD4_AMBTC/33-196                  ......................................cisqggrfppfslegkp-----....---PQK.ATKGP.....KDLAL.........................C.RVFRAK...............................TC....CDIVQTYP..ALLSIRR...LA.S-----..S........G..E..A...NP..........ECL.HLW...EML..E.CSL...-CDP.RVG--....VQR...........................................----..---.GPP.vIC....KS....FCDSVFQACSNA.....YFA-...-...--.....ID.G.ST..........................QVLSP..CG-SK..D..IVC........GAATGWA.KN..GSE.FC......QLA---.-----....-----................------gfsvhsledgshgiedsycfg...........................................
G1P7A4_MYOLU/33-191                  ............................................lsgrpsgppqp-----....------.-----.....--LSF.........................C.AQYSAF...............................GC....CAPERDAA..LGRRFWA...LAaRV----..D........A..G..V...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TLP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RK.L.WA..........................LEGDR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
Q0VCN9_BOVIN/30-205                  .......................................................VCMDA....KHHKAE.PGPED.....KLHNQ.........................C.TPWKKN...............................AC....CSARVSQE..LHKDTSS...LY.NFTWDH..C........G..K..M...EP..........ACQ.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGS..NKCPT..G..TIC........RTFEAYF.PT..PAA.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
C3YX09_BRAFL/253-382                 ..................................................ycpff-----....--DNRA.PSAQP.....NLRN-.........................C.SWYQSR...............................SC....CQQREIDI..IFLATYP...LS.------..-........-..A..A...SD..........ECL.KQL...SFL..Y.C-Y...VCDP.AQNTF....YSY...........................................----..--E.TLT..VC....ET....FCDRIFAACGTA.....LWKG...S...SM.....RS.V.--..........................YSSGR..D----..-..---........-------.--..---.--......------.-----....-----................------fclrrsfkanatgahgnmsnls..........................................
F1M928_RAT/26-202                    .......................................................VCMNS....KHHKQE.PGPED.....KLYFE.........................C.MPWKDN...............................AC....CTRDTSWE..AHLDEPL...LF.NFSMTH..C........G..L..L...TP..........LCH.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvv......................................pnrQEEQ..RLW.DVP..LC....LE....DCEEWWKDCRTS.....HTCK...A...DW.....LH.G.WV..........................WDQGK..NGCPA..H..APC........LPFSDYF.PT..PAD.LC......EKIWNN.TFKAS....PERRN................SGRCLQ................................................................
A0A2K5DCI7_AOTNA/22-181              ...............................................qcldfrpp-----....------.-FRPQ.....QLLSL.........................C.SRYSAF...............................GC....CDEKRDAE..LTSRFWS...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.CQV...SGRA.ATARA....EDP...........................................--ST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....IRH-...-...--.....--.-.FS..........................TDKEL..QAL-E..D..NRD........KFCHRLS.LD..DAD.YCy....pNLMVNK.NLNSDl..gHMVTD................ATGCLQ................................................................
H2NEZ7_PONAB/28-204                  .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLKTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvg......................................slgWEGE..RIV.NAP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A0P7VT40_SCLFO/30-191              ......................................................q-CL--....DYKPPF.QPPEP.....LTF--.........................C.KEYIKF...............................GC....CDKEKDNL..ISQRYHH...IM.EY-FDQ..L........G..S..L...--..........TCG.KYI...HSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.QLP.gLC....AP....YCSEFWNYCRYT.....LSLL...L...DS.....N-.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vtlsieddrekfcnflelkdpeycypnvltnaelnanlgtvqadpegclq..............
A0A3Q3AI29_KRYMA/26-204              .......................................................ACLQD....GKHKST.PSPEP.....HLTE-.........................C.GLYADN...............................SC....CTEEHIQD..IGYVPSA..sNK.NEPWDK..C........G..P..V...NP..........ECE.GFL...KRV..A.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPQevgeag...dtgvegrP-----cgclt...........................................................
A0A3B3UPY6_9TELE/23-198              .......................................................MCMNA....KHHKVE.PGPEG.....ALYGQ.........................C.APWREN...............................AC....CTANTSEE..AHNDNSY...LY.YFNWNH..C........G..A..M...SS..........KCK.QHF...IQD..T.CFY...ECSP.HLGPW....IQSad.......................................esWRKE..RIL.NVP..LC....KE....DCEQWWEDCKDD.....FTCK...T...NW.....HE.G.WD..........................WSSGI..NKCPA..G..SQC........RKWTDIY.PT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
I3JBR1_ORENI/17-188                  .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDVEKDEE..ISGRFYT..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRYT.....LGL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcl..
V4AWK8_LOTGI/5-94                    .....................................................fa-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..A...SK..........TCA.NMM...NYL..M.CFF...-CSP.DQHIW....YKQ...........................................----..---.RAR..VC....SD....FCTDLYDECKDA.....EFKG...E...KI.....GS.N.YE..........................NGSM-..-FCE-..-..---........-------.--..---.--......------.-----....-----................------aqdfsvadsgcfkfdpkvfdgav.........................................
A0A2K5D9I4_AOTNA/3-164               .................................................paatev-----....------.-----.....----Q.........................C.SPWRKN...............................AC....CTADTSQE..LHKDTSR...LY.NFNWEH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFEFYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q1JZL4_ANATE/35-196              ..........................................qcldfkppfrplr-----....------.-----.....-ELEF.........................C.VMYKDF...............................GC....CDYQKDKE..LMTKYYR..iMD.HFD---..-........Y..Y..E...YA..........NCA.GFV...MEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDQST..LVR.TIP.gLC....PD....YCSQFWKKCNST.....IPFI...S...D-.....NP.H.IA..........................-----..-KI-K..E..DQT........RLCHYLE.LD..DMD.YCy....pHLLSNQ.KLTQNl..gQVQSD................SDGCLQ................................................................
G1NTC5_MYOLU/26-201                  .......................................................VCMKT....KHHKPE.PGPED.....QLYDE.........................C.SPWKGN...............................AC....CTTNTSWE..AHLDEAV...LY.NFSLIH..C........G..L..M...IP..........DCQ.KHF...IQA..K.CLH...QCSP.NLGPW....IRQva.......................................pcEQEE..RIL.DAP..LC....QE....DCVQWWADCRTS.....YTCK...S...NW.....LR.G.WD..........................WSRGK..SRCPA..R..ARC........RPFPYYF.PT..PAA.LC......EKIWGN.SFKAS....PERRN................SGRCLQ................................................................
A0A2B4SLT0_STYPI/10-111              ............................................eafsaegpdyv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...ECQP.SKEKL...aVLP...........................................NSRL..NLR.KVP..--....WE....FCTIFHGT----.....IVEH...E...DW.....LE.D.FN..........................YTSSK..YVCRS..D..SKC........RKFSKLN.KD..GKG.LC......NKMWGQ.SFKYE....----N................SHNC--mm..............................................................
A0A3B4DGP3_PYGNA/22-183              ...................................................qcld-----....-YKPPF.QPQEP.....LVF--.........................C.KEYAKF...............................GC....CDLDRDSQ..ISKQFYQ...IM.DY-FDP..S........G..-..-...YM..........ACG.KYI...RSI..M.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....RG....YCYDFWHQCRYS.....LSLL...T...ND....nIT.S.II..........................EEDRE..KFC--..-..---........-------.--..---.--......------.-----....-----................------dhlelkdpeycypnvlssdelnanlgnvqadtkgcvq...........................
A0A2K6FMJ5_PROCO/39-221              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....LPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K5MD48_CERAT/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G3UM80_LOXAF/4-128                   .....................................................sv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECG.KLL...EEV..K.CAH...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKAEEi..sRKHKH................NCFCIQ................................................................
A0A3B3Y5H0_9TELE/26-235              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADSectlsvrshnhicvemtavvwcfcfilaaadSC....CTEEDIQD..IAYVPSD..rNK.NEPWDK..C........G..P..L...SS..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeageag...engaegrP-----cgclt...........................................................
A0A1U8CQ94_MESAU/24-199              ..................................................flvtr-----....GGSHPL.QARSW.....GHPGL.........................A.ADVGTSqlhlagrpqpypr.....iqdpdsqtspvpePC....CTPEKDRP..EAPRPGI...LL.----ES..C........G..A..P...SP..........ECE.FFL...GHL..Q.RAL...RNRF.HPLLL....G--...........................................----..---.VQP..LC....PE....LCQIWFTACEAD.....FTC-...-...--.....GL.T.WL..........................QPSVK..RGC--..E..ASC........RTFGQTF.TN..AED.LC......RMALGQ.APVAA....---PG................SRHCLN................................................................
E9FW82_DAPPU/43-215                  ......................................................s-CIDG....NNHKRE.PGPED.....SLHKQ.........................C.LPWKNN...............................SC....CTGNTTVH..AHGGKMY...--.GFNYNH..Cp......nR..K..M...SS..........KCL.EHF...VQD..L.CFY...ECSP.NVGPW....MQMvn.......................................mkMRRE..RFL.DVP..LC....AT....DCDDWFNACKDD.....YTCT...D...NW.....TL.N.FK..........................WINGT..NHCRP..E..SEC........RTFSDIF.QN..SSN.FC......ERVWDH.SWKYT....---NN................SEPCM-r...............................................................
A0A402EUL2_9SAUR/62-224              ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.TAYETF...............................GC....CDQEKDNV..VAAKFWE...IM.DYID--..-........P..Q..A...YE..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHLYCRSA.....ITLL...T...D-.....--.-.--..........................DKHIQ..ECC-E..K..NKT........RFCNLLD.IQ..DPD.YCf....pNVLKNT.DLNRNl..gSVVED................KKGCL-q...............................................................
A0A340XNT4_LIPVE/30-205              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGY..NQCPL..R..AAC........HRFDFYF.PM..PAD.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
M5WJ83_PRUPE/27-188                  ................................ctsqggrfppfsyegkpprrvnk-----....------.---GP.....KDLTL.........................C.RVFRKK...............................TC....CDVSQTHP..ALVSVRK...LA.S-----..T........G..E..A...NP..........ECL.QLW...ELL..E.CSI...-CDP.RIG--....VQP...........................................----..---.GPP.vIC....AS....FCDRVFKACAEA.....YYST...-...DA.....IT.Q.VL..........................APCGV..NDY--..-..-VC........GRASEWI.VN..GTE.FC......HAA---.-----....-----................------gfavkdditvrkreafcyg.............................................
A0A3L8RTB7_CHLGU/28-203              .......................................................VCMDA....KHHKTE.PGPEG.....QLYGQ.........................C.ILWKDN...............................AC....CTANTSLE..AHQDQSY...LY.NFNWDH..C........G..A..M...PE..........KCK.RHF...IQD..L.CLY...ECSP.NLGPW....IDQad.......................................tsWRKE..RIR.DVP..LC....QE....DCEQWWEDCQDA.....VTCK...V...NW.....HK.G.WN..........................WTTGT..NQCPK..G..AMC........QKFKFVF.PT..AAA.LC......EQIWSG.SYRYT....SHHRG................SGRCIQ................................................................
K7F2U2_PELSI/35-210                  .......................................................MCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.TPWKDN...............................AC....CTAQTSTE..AHKDQSY...LY.SFNWHH..C........G..V..M...PE..........KCR.QHF...IQD..T.CLY...ECSP.NLGPW....IHQhs.......................................ssWRRQ..RIL.HVP..LC....KE....DCEQWWEDCKDA.....RTCK...E...NW.....HK.S.WN..........................WTAGT..NRCPR..G..SRC........RPFWSVF.PR..PAD.LC......EKIWSN.SYKYT....QEHRG................GGRCIQ................................................................
A0A3Q2I2P9_HORSE/26-162              .......................................................VCMNT....QHHKRE.PGPED.....KLHKE.........................C.IPWKDS...............................AC....CTANTSWK..AHLNVSL...LY.NFSLVH..C........G..L..M...MP..........GCQ.RHF...IQA..V.CFY...ECSP.NLGPW....IQQvg.......................................rwGQEE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSGGE..CSC--..-..---........-------.--..---.--......------.-----....-----................------llp.............................................................
U3K4J0_FICAL/22-189                  ......................................................g-CLEG....DTQKLK.PSPEP.....SMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVS.SSYWSR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.YASRW....IHP...........................................NDSA..AIQ.AVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................RDESG.eNHC--..K..NKC........IPYREMY.TN..GTD.LC......QSMWGK.SFKVS....---ES................SCLCLQ................................................................
A0A1S3SQX4_SALSA/34-195              .............................................qcldfkppfk-----....------.--PK-.....DDLQF.........................C.AMYRNF...............................GC....CDSAKDKE..LMAKFYK..iMD.NFD---..-........Y..Y..G...YA..........SCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRST.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ.dRFC--..-..---........-------.--..---.--......------.-----....-----................------qhleledpdycyphllsneqltqnlgrvradpegclq...........................
G3SMM0_LOXAF/11-186                  .......................................................VCMEA....KYHKTK.PGPED.....KLYGQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQNWWEACRTS.....YTCK...N...NW.....HK.G.WD..........................WTSGV..NECPV..G..TTC........HTFEFYF.PT..PAD.LC......ERLWSY.SYKAS....NYSRG................SGRCIQ................................................................
A0A3P9PH90_POERE/26-201              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..sNK.NEPWDK..C........G..P..L...SA..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....ITCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
C5XWG6_SORBI/45-198                  ..............................................fssegkppg-----....------.RAPKG....rRDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALVSVRN...LA.L-----..T........G..E..G...SQ..........ECI.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSES.....YFSV...-...-D.....MK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....ET---................------ssdgvddtfcyg....................................................
A0A2K5LBK7_CERAT/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A443RRG9_9ACAR/58-231              ......................................................s-CMDT....NYHKKE.PGNET.....QLFGE.........................C.TRWQEN...............................GC....CTPNTTRR..FHETVNQ...F-.NFDLSH..Cye...qtnR..T..M...SE..........KCK.KFF...HQD..I.CFY...GCEP.HVGHW....FINvn.......................................lsFARE..RMY.KVP..LC....AS....VCNEWWNACKKE.....FTCH...S...NW.....PK.N.--..........................YKSIK..NHC-S..N..STC........KRFDQVW.TS..ASD.FC......ENVWNH.SWKYT....---ND................KEPCM-k...............................................................
A0A1U8IUT8_GOSHI/17-179              .....................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRR...LA.L-----..T........G..E..A...SE..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGA..NDF--..-..-VC........GRASEWA.SN..GTE.LC......LAA---.-----....-----................------gfrveqsvgmhggieemscy............................................
A0A2U9CLX5_SCOMX/34-196              ........................................pqcldfkppfrplre-----....------.-----.....--LDF.........................C.VMYKEF...............................GC....CDYQKDQE..LMTKFYR..iMD.NFD---..-........Y..H..G...YT..........SCA.GFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPGT..TLR.TIP.gLC....QD....HCFQFWEKCSST.....IPLL...S...DD.....--.-.--..........................--PHM..VKV-K..E..DRA........RFCQYVG.LD..DVD.YCy....pHLLSNQ.KLTNNl..gRVQSD................SDGCLQ................................................................
A0A2K6BUM3_MACNE/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
M7AN26_CHEMY/4-129                   .....................................................sv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRGQ.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEl..sRKHKH................NCFCIQ................................................................
K7ESG0_HUMAN/59-185                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTY----.--..---.--......------.-----....-----................------g...............................................................
A0A3Q7U7Q6_VULVU/38-220              .......................................................RCLNG....NPPKRL.KRRER.....RLMSQlells...............ggealC.GGFYPR..............................lSC....CLRSDSAG..LGRPDTK...IF.S-----..-........M..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....IQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A0D9QVX7_CHLSB/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCRTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
U3JSL4_FICAL/25-156                  ................................................cglqvls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCY.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A1D2NCW9_ORCCI/33-207              .......................................................TCMDA....RNHKSK.PGPED.....SLHAQ.........................C.SPWFNR...............................SC....CTTKTSIM..THTQNMY...--.NFQWSH..Cs.....qvA..P..L...SE..........KCL.KHF...RQD..L.CFY...ECSP.NVGPW....LVKvd.......................................mkIRKQ..RFI.NVP..LC....KS....DCTAWFRDCSDD.....YTCT...D...NW.....GI.N.FE..........................WTKYG..NRCPT..G..SIC........KKFREIYsNN..ATH.FC......ETVWDH.SWKVV....---ED................NEHCM-r...............................................................
M3WCE9_FELCA/40-199                  ......................................................f-C---....GGSRPL.PALSR.....RHHRL.........................A.TDFGTVqlhl......................ypspwSC....CPSEMDTP..EASDPGA...VP.----ER..C........G..E..P...SP..........GCE.SFL...GHL..Q.AAL...QSRF.RLLLL...gIRQ...........................................----..---.TQP..LC....SE....LCDVWFATCESD.....ITC-...-...--.....GP.T.WL..........................PFPEK..RGC--..E..PGC........ATYEQTF.AD..GAD.LC......RSVLGY.VLPVA....--APG................ADHCLN................................................................
A0A2J8RY52_PONAB/27-183              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A218UKV1_9PASE/45-220              .......................................................VCMDA....KHHKTE.PGPEG.....QLYGQ.........................C.ILWKDN...............................AC....CTANTSLE..AHQDQSY...LY.NFNWDH..C........G..A..M...PE..........KCK.RHF...IQD..L.CLY...ECSP.NLGPW....IDQad.......................................tsWRKE..RIR.DVP..LC....WE....DCEQWWEDCQDA.....VTCK...V...NW.....HK.G.WN..........................WTTGT..NQCPK..G..AMC........QKFKFVF.PT..AAA.LC......EQIWSG.SYRYT....SHHRG................SGRCIQ................................................................
H2Q164_PANTR/44-206                  ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGR..DGT--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
E9PXB5_MOUSE/34-103                  .......................................................VCMDA....KHHKEK.PGPED.....NLHDQ.........................C.SPWKTN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..T..M...TS..........ECK.RHF...IQD..T.C--...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
G3QFT6_GORGO/44-206                  ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQHNDRR..VAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGR..DGT--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
A0A3Q0RXJ0_AMPCI/37-199              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.RQYEQF...............................GC....CDQRTDNM..IAERYWD..iIE.QLE---..-........T..A..G...YE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FD....YCSEFHGKCRHV.....LKY-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ltvnqlllyaseqdvttfcsmvdlsdpdycypnvlkspdlnsnlgrvvedprgclq........
G3U4R3_LOXAF/45-206                  ............................................cldygppfkpq-----....------.-----.....VHLEF.........................C.SDYEAF...............................GC....CDQSKDHR..IASRYWD...IM.DYFD--..-........L..R..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NFP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...SD.....--.-.--..........................RRLQG..--SQG..K..DGA........RFCHLVN.IP..DKD.YC......------.-----....-----................------fpnvlrkdhlnrnlgvvaedqqgclq......................................
A0A087RHL9_APTFO/21-188              ......................................................g-CLEG....DTHKLK.PSPEP.....NMHE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.VFT...KKI..E.CFY...RCSP.HAAHW....IHP...........................................SYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICV...H...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........IPYSEMY.AN..GTD.MC......QTMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K5Y8J7_MANLE/32-202              .........................................phlmirpscpvssp-----....------.-----.....---IQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
H2Y7U9_CIOSA/24-200                  .......................................................TCPRG....DYHKET.PSAET.....HLQA-.........................C.KQYTCD...............................SC....CFENITIE..LASVPIA..qVG.KLDYHQ..C.......sK..Q..L...TD..........ACS.NQH...TYL..Q.CLY...QCSP.NLYPW....MGK...........................................-VTR..IPN.SIP..LC....SN....FCDQWYLTCQAD.....MTCA...PgvgNW.....KT.G.LNkg......................fdADGNP.vNPCKD..G..VMC........RNYTEVY.GS..GQA.LC......ENIWGT.MFTYT....---TD................TTNCI-d...............................................................
B3RPR5_TRIAD/37-169                  ......................................................y-CP--....YFHNRL.ARPQS.....QLSS-.........................C.SWFRNQ...............................SC....CYQAEIDS..IFTDNIP...LF.------..-........-..N..V...ND..........QCR.QSL...TYL..M.C-Y...ICAP.DQKDF....YAD...........................................----..--R.RLT..IC....DD....MCQDLYDACINA.....TYKG...-...DP.....IY.Y.W-..........................YRNGR..EFC--..Q..GRQ........FQV----.--..---.--......------.-----....-----................------qsyqsgkcysikryen................................................
A0A022RAA7_ERYGU/30-193              ........................................vcisqggrfppfsse-----....-----G.KAPKKa..arDALRF.........................C.RVFRKR...............................TC....CDVSQTHA..ALLSIRK...LS.SY----..-........G..E..G...SQ..........DCL.QLW...ELV..E.CSI...-CDP.LVG--....VQH...........................................----..---.GPP.lIC....SS....LCDRLYQACSTA.....YFAM...D...AK.....--.T.QA..........................LSPCG..A---G..D..FVC........GRASEWV.SN..GTE.LC......RAS-GF.SVTTS....-----................------ssseeeeeelsscyg.................................................
A0A3Q0E9K2_TARSY/1-120               .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....QK.G.WN..........................WTSGI..NQCPT..G..TTC........RTFESYF.PT..PAA.LC......EDLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2B4SW98_STYPI/68-255              ......................................................k-CLPG....AKHKES.PSAEE.....SMAA-.........................C.KSYKDA...............................SC....CTSDFTRQ..LATPPIK..kVG.NFSWTP..C.......nK..T..L...ST..........KCE.AFM...VMV..E.CFY...RCSH.NAYFW....KNP...........................................YFTS..AIT.KAP..VC....SG....FCDGWFDACKDD.....LTCA...K...NW.....IT.D.FK..........................MEAGV..NNC--..K..QPC........KNFSDYY.AN..GKD.LC......ESMWGA.SFVYK....-----................KTNCL-qmnftspnpndalveklskekqf.........................................
F7AWH6_CIOIN/27-202                  .......................................................TCPRG....DYQKES.PSGQE.....HLAA-.........................C.KQYTCN...............................SC....CFENITTQ..LAIMPIQ..qVG.KLNYNQ..C........D..K..L...TD..........ACS.TQH...TYL..Q.CLY...QCSP.NLYPW....MIE...........................................-STR..KLI.AIP..LC....AS....FCDQWFMTCSAD.....MTCApgeG...NW.....KT.G.LNkg......................fdASGNP.vNPCKP..G..VMC........RNYTETY.GS..GEG.LC......NNIWGT.LFKYS....---TD................TKNCI-d...............................................................
A0A091DMG9_FUKDA/34-209              .......................................................VCMDA....KHHKDK.PSPED.....KLHEQ.........................C.SPWKKN...............................SC....CSANTSQE..AHKNISN...LY.RFNWDH..C........G..E..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWEDCKTS.....LTCK...S...NW.....HK.G.WN..........................WEKGY..NKCPT..D..AAC........HPFPFYF.PT..PAD.LC......QEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A091EID6_CORBR/1-107               ......................................................g-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.-HL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCMQVWQNCRSI.....FRSL...S...AD.....PE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YCf....pH-----.-----....-----................------llanqnlnqnlglvtadaegclq.........................................
F7D0L5_HORSE/27-200                  .....................................................ac-----....GRSHPF.PATSR.....RHHGL.........................V.ADLGTGqlhlagdpqalvpqpylriqdpssqespsprPC....CPSEMDTP..KALGPGI...I-.------..-........-..-..-...-P..........RCK.SFL...GHL..Q.IAL...RSRL.RLLQL...gVRR...........................................----..---.GQP..LC....AE....LCDAWFATCESA.....IAC-...-...--.....GR.T.WL..........................PFPEK..KGC--..E..PDC........TIYGQTF.TD..GAD.LC......RSVLGS.ALPVA....--APG................TAHCL-s...............................................................
U3EWX7_CALJA/37-193                  ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
I3KJ02_ORENI/23-198                  .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EEIWSN.SYIYT....TYTKT................SEKCMQ................................................................
A0A493TRT2_ANAPP/96-213              .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQ...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------mwfdpakgnpnvvvakhpsshagapshlfscctc..............................
Q8BY83_MOUSE/26-162                  .......................................................VCMNS....KRHKQE.PGPED.....ELYQE.........................C.RPWEDN...............................AC....CTRSTSWE..AHLEEPL...LF.NFSMMH..C........G..L..L...TP..........ACR.KHF...IQA..I.CFH...ECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHSS.....LTCK...S...NW.....LH.G.WD..........................WSEV-..-----..-..---........-------.--..---.--......------.-----....-----................------kgllsm..........................................................
A0A087QV99_APTFO/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYENF...............................GC....CDQERDNS..IAAKYWD...IM.DYI---..D........P..Q..R...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ISLL...-...--.....--.-.-T..........................SDKHI..QECCE..T..NKT........RFCNLLH.LH..DED.YCf....pNVLKNT.ALNHNl..gSVVQD................RKGCLQ................................................................
A0A093PR50_9PASS/21-196              .......................................................VCMDA....KHHKSQ.PGPEG.....KLHDQ.........................C.SPWKDN...............................AC....CTANTSSE..AHKDESN...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....QE....DCEQWWEDCREA.....VTCK...E...NW.....HK.G.WN..........................WATGR..NRCPW..G..SLC........RPFSEVF.PR..PRD.LC......EKIWSH.SYRYT....TARRG................SGRCVQ................................................................
A0A0G4IP33_PLABS/18-159              ................................................pdavhcn-----....------.-APGP.....RFLKY.........................C.DAYADA...............................TC....CSRQDDQR..ALRRAAP...LY.T-----..-........G..Q..F...SA..........RCK.EIT...AQM..A.CSV...-CDP.RVG--....MKK...........................................----..---.VDA..VC....QS....RCDDWYESCKND.....FFTT...P...AS.....TS.A.VL..........................EP---..CSV-S..S..LVC........SRLSDIV.TS..GEE.FC......SRS-GY.SVATS....----S................STACF-d...............................................................
H0WKX3_OTOGA/30-205                  .......................................................VCISA....RPHKRK.PGPED.....ELYDE.........................C.TPWKDN...............................AC....CTAKTSWE..AHLEVSP...LY.NFSLVH..C........G..L..L...LP..........GCL.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvt.......................................slGLGE..RAA.AIP..LC....QE....DCEEWWEDCSSS.....YTCK...A...NW.....HV.G.WD..........................WSRGR..NHCPA..G..AQC........LPFPHYF.PT..PAD.LC......EKIWSN.LFKAS....PERRH................SGRCL-r...............................................................
M3X2M1_FELCA/27-188                  ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEQDAA..LARRFGA...LAaRVD---..-........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LE..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A3P8WSY5_CYNSE/23-198              .......................................................MCMDA....KHHKTS.PGPEG.....LLYNQ.........................C.APWKNN...............................AC....CTANTSEE..AHSDNSY...LY.NFNWNH..C........G..S..M...SP..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQEvd.......................................qsWRKE..RIV.DVP..LC....ME....DCHSWWEDCKDD.....FTCK...S...DW.....HT.G.WN..........................WNSGF..NHCPA..G..AKC........RKWTDFY.PT..PKS.MC......EQIWSN.SYLYT....THSKT................SGRCMQ................................................................
A0A3P9NQM6_POERE/68-230              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.SQYEQF...............................GC....CDQRTDNV..IAERYWD..vIE.QLE---..-........T..A..G...YD..........LCE.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHSKCRHV.....LRYL...T...D-.....-N.Q.LL..........................LDTSG..RDM--..A..TFC........SLVD---.LS..DQD.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
A0A2K5QP32_CEBCA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VFP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2I2UXU2_FELCA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FNSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3B1IPY3_ASTMX/14-189              .......................................................MCMNG....KHQKTE.PGPEG.....ELYKQ.........................C.VPWREN...............................AC....CTANTSAE..AHEDNSY...LY.NFNWNH..C........G..V..M...SP..........KCK.SHF...VQD..T.CFY...ECSP.HLGPW....IQLad.......................................ssWRKE..RII.DVP..LC....LE....DCESWYNDCKYD.....FTCK...D...NW.....HK.G.WD..........................WSSGT..NHCPT..G..AEC........RLWSDVF.PD..AKS.MC......ENIWTN.SYKYT....TLTKD................SGRCMQ................................................................
A0A125YTP5_TOXGV/134-324             ........................kssrerhaesrkhttngvclpsmgflpdvpr-----....------.-DRRD.....EVFLA.........................C.HEHESN...............................TC....CQRRDTES..ILRRLAFy.fTP.EAVKSD..V........S..F..P...PK..........NCA.SFT...SAA..L.CSK...-CDA.RVGVG...kM--...........................................----..TRK.NAP.lLC....RS....FCERWYHACEND.....YFAP...-...--.....AP.S.GS..........................PQALT..FCYPD..S..VIC........SPLRDVA.RD..GAT.FC......SKLG--.-----....-----................------fevagldreesaeqeeeedaaacy........................................
A0A4D9E3P2_9SAUR/24-191              .......................................................RCLEG....ETHKHR.PSPEL.....DMHE-.........................C.TLYSEF...............................SC....CYANFTEQ..LAHSPVI..qVS.NSYWNR..C........G..N..L...SK..........SCE.DYM...KKI..E.CFY...RCSP.HAAHW....INP...........................................NYTA..GIE.FVP..LC....QN....FCDDWYEACKND.....STCV...R...NW.....IT.D.WE..........................WDENG.eNHC--..K..NEC........IPYNKVY.AN..GTD.MC......QSMWGD.SFKVS....---ES................SCLCLQ................................................................
A0A0E0K1U4_ORYPU/51-203              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RIFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTQ.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A384DSE0_URSMA/27-177              ......................................................a-C---....GGSHPL.PSMSQ.....THQRL.........................A.ADLGTG...............................QL....HLTEMDTP..EASDPGM...VP.----ER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCEND.....ITC-...-...--.....GL.T.WL..........................PLLEK..RGC--..E..PGC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K6FVT6_PROCO/26-201              .......................................................ICMNA....KHHKRK.PSPED.....KLYEE.........................C.IPWKGN...............................AC....CTAETSWE..AHLDVSP...LY.NFSRIH..C........G..L..L...MP..........GCQ.KHF...IQA..T.CFY...ECSP.NLGPW....IQPaa.......................................wsGQGE..RVV.DVP..LC....RE....DCEEWWEDCRWS.....YTCK...S...NW.....QG.G.WD..........................WSQGK..NRCPA..K..ARC........LPFPHYF.PT..PAD.LC......EKVWSN.SFKAS....PERRH................SGRCLQ................................................................
A0A452CAM7_BALAS/30-203              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.SPWKKK...............................AC....CSVNTSRE..AHKDISY...LY.RFNWDH..C........G..K..M...EX..........--K.RHV...IQD..P.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGY..NQCPV..R..TAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A3Q7XHC1_URSAR/31-206              .......................................................VCMDA....KHHKEK.PSPED.....ELHKQ.........................C.SPWKKN...............................SC....CFTNTSEE..AHKDISY...LY.KFNWNH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGY..NRCPA..G..AAC........LPFHFYF.PT..SAA.LC......SEIWSH.SYKPS....NYSRG................SGRCIQ................................................................
JUNO_MOUSE/26-202                    .......................................................VCMNS....KRHKQE.PGPED.....ELYQE.........................C.RPWEDN...............................AC....CTRSTSWE..AHLEEPL...LF.NFSMMH..C........G..L..L...TP..........ACR.KHF...IQA..I.CFH...ECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHSS.....LTCK...S...NW.....LH.G.WD..........................WSEEK..KHCPA..H..EPC........LPFSYHF.PT..PDD.LC......EKIWNN.TFKAS....PERRN................SGRCLQ................................................................
#=GR JUNO_MOUSE/26-202         SS    .......................................................----S....SSS-SS.-B--S.....---GG.........................G.GGGTTS...............................BS....S-HHHHHH..TTSSS--...SS.S----E..E........S..-..-...-H..........HHH.HHH...HHH..H.HHH...HH-G.GGGGG....EEESS......................................SSSSSSE..EE-.-EE..E-....HH....HHHHHHHHTTTS.....EES-...S...--.....S-.-.--..........................-----..----T..T..S--........EEHHHH-.SS..HHH.HH......HHTTTT.TEEE-....SS-GG................GSSSB-................................................................
A0A3B3S646_9TELE/34-194              .............................................qcldfkppfk-----....------.--PQD.....TLVF-.........................C.VMYTDF...............................GC....CDSRKDRE..LRAKFYE..iMD.NFD---..-........S..Q..G...YA..........SCA.GYV...QEL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SLP.gLC....PD....YCSRFWLRCRSV.....ITLL...S...NNt...sLE.G.LE..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------adkhrfcrylelddadycyphllsnpqltkdlgrvtaneegcl.....................
W5P2F1_SHEEP/30-207                  .......................................................VCMDA....KHHKAE.PGPED.....KLHNQt.......................qC.TPWKKN...............................AC....CSARVSQE..LHKDTSS...LY.NFTWDH..C........G..K..M...EP..........ACQ.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRTS.....HTCK...S...NW.....HR.G.WD..........................WTSGS..NKCPN..G..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2Y9T9A0_PHYMC/33-194              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEHDAA..LARRFRA...LE.A---RV..D........A..A..I...WA..........ECA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRGL.....FRHL...S...PD.....RE.L.WT..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLANE.NLNSNl..gRVVAD................AMGC--lq..............................................................
A0A3Q7W815_URSAR/27-213              .......................................................VCMNT....KHHKRE.PGPED.....KLYEE.........................C.IPWQDN...............................AC....CTAGTSWE..AHLDASL...LY.TFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..I.CFY...ECSP.NLGPW....IQKvrrlgrg............................grrrvdssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WD..........................RSGGK..NRCPA..R..AVC........HPFPHYF.PT..PAD.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
G3WJX2_SARHA/110-235                 ..........................................stsgspimagicl-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.--IWDR..C........G..G..L...SP..........RCE.SFL...QNL..S.NFL...HCSP.LGANW....THL...........................................EKPR..SIQ.ALP..IC....AA....FCDQWFLACKND.....LTCG...-...--.....-R.N.WL..........................S-QPG..GSC--..E..GGC........LTFDQTF.LD..ARD.LC......GSALGD.YLVAA....---PA................PCPCLQ................................................................
H9GUQ6_ANOCA/9-102                   ..............................slhafyvlsretsqskatfynlsls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....-S....LCR--YDACKND.....FICV...K...NA.....LT.D.WE..........................IDERG.eNHC--..K..NEC........ISYRKMY.AN..GTE.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
W5MF72_LEPOC/23-189                  ......................................................k-CLQG....RDHKKA.PSEEH.....-SMKE.........................C.TVYSNS...............................SC....CYSNFTEQ..LVSPVKK...VD.NTQWDL..C........Q..K..L...ST..........GCE.AFM...KKV..E.CFY...QCSP.SAVNW....MNP...........................................NYTA..GLL.HVP..LC....VS....FCNNWFDACKND.....LTCA...K...NW.....IT.D.FK..........................WDENG.nNHC--..S..GDC........VPFNKMY.SN..GTD.LC......QSMWGQ.TFMVT....---DS................DCRCL-r...............................................................
F5GXV3_HUMAN/30-167                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSA-..-----..-..---........-------.--..---.--......------.-----....-----................------alceglws........................................................
Q69GM1_XENLA/38-218                  .......................................................RCLNG....SSPRRV.KKRHR.....KLQTLdlgg.................agegC.RGLYPR..............................lSC....CPKTDIPG..MPMDSKI...LS.------..-........V..A..N...NT..........ECA.KLV...EEI..R.CAH...-CSP.HAQNL....FHAse.......................................rsETSE..RQL.FLP.vLC....KD....YCKEFYYTCRGQ.....IPG-...-...-L.....LQ.T.SA..........................DEFCF.yHGMRD..S..GLCf.....pdFPRKQMR.GP..ASN.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
A0A1U8DMF6_ALLSI/9-109               .........................................evlsslpmqtdssc-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................-QRE..AIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGP..NHCPW..G..TMC........RPFKQVF.PR..AAD.LY......EKIWSD.SYKYT....TAPRG................NGRCIQ................................................................
A0A0D3CMJ5_BRAOL/39-190              ........................................vciskegpfstsase-----....---GKL.ADPEF.....EDLNV.........................C.KVFHEK...............................TC....CSASRMLS..ASKAVES...LA.TY----..-........G..E..A...AK..........DCL.YLF...ELL..E.CSI...-CQP.G----....---...........................................----..---.TLP..IC....AS....FCGRVFQACSDA.....YFSS...D...AS.....--.-.--..........................DQVIV.pCGASE..S..IIC........GKATKWE.TN..GTA.FC......YAL---.GFTVQ....-----................------saveescygsk.....................................................
A0A0D3AFH2_BRAOL/43-207              .....................................vcvskggrshqayelegk-----....------.-LPESadlefKDLNM.........................C.NMFHEK...............................TC....CSASRMLS..ASLALQN...LA.TH----..-........G..E..A...SK..........DCL.FWF...ELL..E.CSI...-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSDA.....YFST...S...DS.....TN.Q.VI..........................V---P..CVASN..D..TIC........EKASKLE.TN..GTA.FC......EAV---.G----....-----................------ftvakpagdsveepcyg...............................................
A0A401S518_CHIPU/23-189              ......................................................g-CVSG....INHKAM.PSPEP.....DMRE-.........................C.KLYSQS...............................SC....CFSNYTEQ..LAVSPVI..kVY.NTYWNR..C........G..Q..L...SS..........RCE.EYM...KKI..D.CFY...HCSP.HAFNW....INP...........................................NNSY..SLL.AAP..IC....QS....FCDDWFAACRND.....LTCV...R...NW.....IS.D.WE..........................WDDHG..NNC--..R..NEC........IPYHQMY.KN..GKD.LC......NNMWGA.TFNVT....---SY................PCHCL-m...............................................................
A0A3B4BBS1_9GOBI/39-199              ............................................ldfappfkplw-----....------.-----.....-HLEF.........................C.TQYQEF...............................GC....CDQKTDNM..IAERYWD..iIE.VLE---..-........I..Q..G...LD..........LCA.DSL...KEI..M.C-Q...ECSP.YAAHL....FDA..........................................eDPYT..PVR.ELP.gLC....FS....YCQDFHSKCRHI.....IKYL...T...--.....QN.Q.LL..........................QDTSQ..RDM--..S..TFC........TM---MD.LS..DQD.YC......------.-----....-----................------ypnvlnspglnsnlgqvvedprgclq......................................
A0A1A6FTX1_NEOLE/29-204              .......................................................VCMDA....KHHKTK.PGPED.....XLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..IHKDNSR...LY.NFNWDH..C........G..K..M...TP..........TCK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KE....DCQEWWEACRTS.....STCK...T...DW.....HK.G.WD..........................WTSGI..NKCPD..T..AVC........HTFQHYF.PT..PAS.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
G3HCX1_CRIGR/27-199                  ......................................................a-C---....GGSHPL.QARFW.....EHPGL.........................A.ANVSTSqlhlaghpqpyrr.....iqdpgsqtspvpePC....CTSDKDRP..EAPSPGV...L-.---LES..C........G..A..P...SP..........ECE.LFL...GHL..L.RTL...RNRF.HPLLL....GMQ...........................................----..---.--P..LC....PE....VCQIWFTTCEAD.....FTC-...-...--.....GL.T.WL..........................QPSGK..RGC--..E..SSC........RTFGQTF.TN..AED.LC......RTALGH.AVVAA....---PG................SRHCLN................................................................
A0A3M6UV93_9CNID/50-223              ......................................................k-CIEG....KWHKKS.PSPET.....AEFKT.........................C.HAFKES...............................SC....CNAAFTVE..LMANETR..nLY.NHSWHR..C........G..T..L...SA..........KCQ.SFW...VKQ..E.CFY...QCSP.KVYRY....EDP...........................................NFKG..GLK.GVP..VC....SG....FCDEWYEACKED.....QICV...E...NV.....LV.D.YN..........................FTKHE.eNYCPV..N..SSC........KSYQAMY.GN..GKN.LC......EKMWGE.SYKYT...lP-DAD................YSNCL-m...............................................................
W5KD05_ASTMX/27-199                  .......................................................ACLQD....GRHKAT.PSPEP.....YLKE-.........................C.TMYMEN...............................AC....CSEQDITD..LTAPPAG...DD.GTPWDR..C........G..T..L...SP..........VCD.AFL...KRV..V.CFY...RCSP.HAAHW....PHP...........................................QRNS..FLK.AVP..LC....TS....FCRDWYEACKSD.....LTC-...-...--.....AR.D.WA..........................GDPRG..LNC--..T..GSC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEAGeedg........veghGCGCL-t...............................................................
K7F2U9_PELSI/27-202                  .......................................................ICMDA....KHHKTR.PGPEG.....KLYQQ.........................C.ALWKDN...............................AC....CTANTSTE..AHQDQSY...LY.NFNWNH..C........G..V..M...PA..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQad.......................................nsWRRE..RIL.HVP..LC....KE....DCEQWWEDCKDA.....ITCK...E...NW.....HK.G.WN..........................WTAGT..NRCPR..G..SMC........QPFRYVF.PR..PAD.LC......EKIWSN.SYKYT....QEHRG................SGRCIQ................................................................
A0A1S3A0V0_ERIEU/31-207              .......................................................VCMNA....KHHKEK.PGPED.....KLHYQ.........................C.SPWKKN...............................SC....CSVNTSQE..IHKDISY...LY.NFNWDH..C.......pE..K..M...TP..........ACK.RHF...IQD..V.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NQCPV..E..AAC........HPFSFYF.PT..PEA.LC......SNIWSN.SYKVS....NYSRG................SGRCIQ................................................................
M4FEA4_BRARP/39-188                  ..................................vciskegpfsssasegkladl-----....------.---EF.....EDLNV.........................C.KVFHEK...............................TC....CSASRMLS..ASKAVET...LA.TY----..-........G..E..A...PK..........DCL.DLF...ELL..E.CSI...-C--.-----....-QS...........................................----..--G.TLP..IC....AS....FCDRVFEACSDA.....YFSS...D...AT.....NQ.V.I-..........................---VP..CGASE..S..IIC........GKATKWE.TN..GTA.FC......YAL---.-----....-----................------gftvqsaveepcyg..................................................
H2NM84_PONAB/22-183                  ...............................................qcldfrpp-----....-----F.RPPQ-.....-PLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR..AGF--..-..--C........RYLS---.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadtkgclq......................................
A0A1U8ACQ3_NELNU/44-200              ...........................................rfppfssegsap-----....----RK.ATKGP.....KDLTL.........................C.RVFRRK...............................TC....CDVAQTHP..ALLSIRR...LA.S-----..T........G..E..A...NQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....AS....LCDRVFQACSNA.....YFSM...-...DV.....KT.Q.VL..........................S-P--..CGL-S..E..FIC........GRASEWA.PN..GTE.LC......RLA---.-----....-----................------gfavkpsedsyqsteqpscy............................................
A0A2K6R535_RHIRO/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrnlgmvaqdprgclq......................................
A0A0L8HUS0_OCTBM/23-187              ..............................................chpqcldfk-----....------.PPFQS.....NTLEF.........................C.SQYRDF...............................GC....CTKQQEDV..IFQRYEY...VK.---TQL..S........E..T..L...LQ..........TCE.PYL...REL..L.C-Q...PCSP.YAAHI....YSA...........................................EQTM..HAS.TFP.gLC....SN....YCSEFYTKCKDLa...kYITS...D...QE.....IL.G.TL..........................N-SK-..-----..E..NFC........LVVQ---.LT..DTD.YCy....pNLLKNE.HLNFN....-----................------isiqqitkegcmcve.................................................
A0A340XRU3_LIPVE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
W4H1E2_9STRA/9-169                   ...................................asstpsqplcrstggikfdp-----....----TE.PSRQQk...qRSLDH.........................C.TKYWQN...............................SC....CNATHTIP..LKRRVME..pIV.------..-........A..L..F...NS..........KCQ.ALH...DEM..T.CSA...-CHP.FVGTG...rL--...........................................----..---.-ER..IC....PD....LCDDWFDACKDE.....YYT-...-...PD.....GS.Q.AL..........................SPCYG..NAL--..-..-IC........SPLHSIV.PS..GRE.FC......KAM-GY.-----....-----................------tpgkstdtegvtcfd.................................................
F7BPH5_CIOIN/32-206                  .......................................................VCLDG....KHHKES.PGPEA.....ELFDT.........................C.SPWKTR...............................SC....CTNETAFL..THQDGVN..gAY.NFNYNH..C........G..I..M...SD..........KCR.RHF...NED..S.CFY...ECSP.NMGPW....IVDve.......................................ssYRNQ..KFE.DVP..LC....RS....ECVDWWADCKDE.....LTCK...N...NW.....SV.G.WN..........................WTSGV..NECPS..G..AEC........KKFSEYF.TG..AVD.LC......ENIYPR.DFKVP....--SND................SAPCM-v...............................................................
A0A2Y9LC22_ENHLU/27-187              ......................................................a-C---....GGSRPL.PAMSR.....RHHRL.........................A.ADLGTSqlhla.....................gehsrPC....LTSEMDTP..EALDPGM...--.--APER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCESD.....ITC-...-...--.....GP.T.WL..........................TILEK..RGC--..E..PGC........PTYEQTF.AD..GAE.LC......RSVLGY.AMPVA....--APG................AGHCLN................................................................
A0A2R9B8B1_PANPA/3-164               .................................................paatev-----....------.-----.....----Q.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........S..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3P8TBQ6_AMPPE/37-209              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....L---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A3Q1AU19_AMPOC/35-196              ..............................................qcldfkppf-----....------.--RPR.....RDLEF.........................C.VMYKEF...............................GC....CDYEKDQE..LMTKYYQ..iMD.NFD---..-........Y..H..G...YA..........NCA.SFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSII.....IPLL...S...DD.....--.-.--..........................--PHV..AKI-R..E..NQT........HLCQYLE.LD..DVD.YCy....pHLLSNQ.KLSQHl..gRVQSD................SYGCL-q...............................................................
A0A3Q1M192_BOVIN/30-205              .......................................................VCMNA....KPHKPE.PGPEA.....ELYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.G.WA..........................WSRGK..PRCPE..W..EPC........RPFPHHF.PT..PAD.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A3B3SHV7_9TELE/34-199              ......................................................s-CLGG....AHHKNA.PGPER.....NMRE-.........................C.FTYSNS...............................SC....CHANFTEK..LVSPVTK...VD.NTSWIT..C........G..N..L...SD..........RCE.AFM...KKI..E.CFY...QCSP.HAAHW....VNK...........................................DYPA..GFL.NVP..VC....VS....FCDGWLEACKDD.....LTCA...K...NW.....LT.D.FK..........................LDIDG..NHC--..Q..HDC........VPFSKMY.SN..GTD.LC......NSMWGP.SFTAS....---SS................NCACLQ................................................................
A0A3Q3RZ90_9TELE/28-209              .......................................................VCLQD....GKHKAT.PSPEP.....HLG-E.........................C.ALYADN...............................SC....CTQEDIQD..IAHVPSA..sSK.NEPWDR..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HSRS..YIQ.AVP..LC....HS....FCHDWFEACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFVTV....EEEPA................------dvgqagepgaegdgrrpcgclt..........................................
H0WGV9_OTOGA/36-211                  .......................................................VCMDA....KHHKEK.PGPED.....NLHRQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDNSY...LY.NFNWDH..C........G..M..M...QP..........ICK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGT..NHCPV..K..TTC........RPFHIVF.PT..PAA.LC......NEIWSH.SYEVS....NYSRG................SGRCIQ................................................................
A0A1V4JW39_PATFA/1-154               ......................................................m-----....------.-----.....-----.........................C.RGLYPR..............................lSC....CSRTDAQG..LLHAEAK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKDEEi..sRKHKH................NCFCIQ................................................................
A0A3Q1M4M1_BOVIN/26-208              .......................................................VCMNA....KPHKPE.PGPEA.....ELYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQQvgrgg................................lgvdprWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.G.WA..........................WSRGK..PRCPE..W..EPC........RPFPHHF.PT..PAD.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A093GV59_STRCA/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.TAYENF...............................GC....CDQEKDNS..IAAKYWE..iMD.HID---..-........P..Q..R...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....IGLL...-...--.....--.-.TA..........................DKHIQ..ECC-E..T..NKT........RFCNLLN.VH..DKD.YCf....pN-----.-----....-----................------vlknialnrnlgsvvedrkgclq.........................................
A0A3B4X6X7_SERLL/35-196              ..............................................qcldfkppf-----....------.RPP--.....RELEF.........................C.VMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..H..G...YA..........NCA.GFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PDR.TIP.gLC....PD....YCSQFWNKCSST.....IPLL...-...--.....--.-.-T..........................DDPHI..AKV-K..A..DQT........RVCQYLA.LD..DVD.YCy....pHLLSNQ.KLTQNl..gRVQSD................TDGCL-q...............................................................
A0A2K6RR39_RHIRO/47-110              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrt...........................................................
A0A2K6A9I0_MANLE/4-146               .....................................................gs-----....------.-----.....-----.........................-.------...............................--....CVFPTHQE..LHKDTSH...LY.NFNWDH..C........G..K..M...EP..........ACK.CHF...IQD..T.CLY...ECSP.NLGPW....ICW...........................................-RKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A1U7SET6_ALLSI/5-167               ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SAYEKF...............................GC....CDQEKDNS..IAAKYWE...IM.DYIS--..-........P..Q..G...HR..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHFNCHSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.LQ..DQD.YCf....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
A0A3Q2H4A7_HORSE/36-211              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSRE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRTS.....YTCK...S...NW.....QK.G.WD..........................WTSGS..NKCPA..E..ATC........RTFESYF.PT..PAA.LC......EELWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2Y9F958_PHYMC/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A452STK5_URSAM/20-194              .......................................wgaqprtprarmdlln-----....------.-----.....----Vc......................mdC.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
F7FPZ6_MONDO/33-194                  ..............................................qcldfkppf-----....------.RPPRP.....LP--F.........................C.EQYTAF...............................GC....CDAEQDAA..LSRRYWA..vTS.RLE---..-........P..D..T...FA..........VCA.AYV...RDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCIDVWQKCRII.....FRHL...S...PD.....PE.L.WA..........................LETNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A1U7T349_TARSY/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RVMSQlells...............ggeapC.GGFYPR..............................lSC....CLRSDSPG..LGRLESK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................ekEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
K7FXM9_PELSI/22-189                  .......................................................RCLEG....ETHKPR.PSPEP.....DMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVS.HSSWDR..C........G..E..L...SK..........SCE.EYM...KKI..E.CFY...RCSP.HAAHW....INP...........................................NYTS..GIK.LVP..LC....QN....FCDDWYEACKSD.....LTCV...H...NW.....LT.D.WE..........................WDENG.eNHC--..K..NEC........ISYDKVY.AN..GTD.LC......QSMWGD.SFKVS....---DS................SCLCLQ................................................................
A0A068Y5C3_ECHMU/36-215              ......................................................i-CPDS....GELKDH.PSPEP.....DLKQ-.........................C.GEWKSR...............................TC....CSPETAEQ..IA--NAT...LH.GFSFDF..C........G..N..M...SE..........QCR.NYF...HYD..Y.CMV...KCSP.DLGPW....IVKmt.......................................ssRFKE..RAF.RVP..LC....ES....DCCAWYEACKWD.....KACF...T...NW....rSG.G.FD..........................WSEGT..NKCRK..G..FEC........LNISMVY.GS..PTA.FC......EHVWDH.AYRVV....PVE--................------svavwgssdkycmh..................................................
G1NQU6_MELGA/30-211                  .......................................................VCMDA....KHHKTK.PGPE-.....GLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvgy.....................................pssPRDS..STL.RAL..LC....DE....HFYIYWWCMAES.....WICP...P...SPvlshhTS.G.WQ..........................LSSGT..NRCPW..G..SMC........RPFTQVF.PR..PKD.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A151NL04_ALLMI/35-221              .......................................................RCLNG....SPPRRL.KKRER.....RLLLLdepas..............gaellpC.RGHYPR..............................lSC....CARAGRHG..LLLLPAA...TK.IFS---..-........V..T..N...NT..........ECM.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6KH33_RHIBE/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....-R.-.--..........................----E..LQVLE..G..NRA........RFCHYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
H2ZLB1_CIOSA/30-139                  .......................................................VCMDG....KHHKAT.PGPEA.....ELFGT.........................C.SPWKDR...............................SC....CTNETAFL..SHQDGEE..gAY.GFNYDH..C........G.qK..M...SD..........KCR.QRF...NED..N.CFY...ECSP.NMGPW....IVDvq.......................................ssYRNQ..KFE.DVP..LC....MS....ECVDWW------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A2I3RAM3_PANTR/3-164               .................................................paatev-----....------.-----.....----Q.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A1S3JE41_LINUN/10-111              .......................dhspeknqyqnqrpdqnpypfwyqspeqnqfg-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....LCEEWWDACKEE.....YTCH...R...NW.....IT.D.MD..........................W--GE.iNSCKE..G..SVC........KKYKEFY.SS..AAD.FC......TAIWHD.AYKVV....---PD................SEPCM-v...............................................................
A0A452F775_CAPHI/27-177              ......................................................a-C---....GGSHPL.PARSQ.....RHRRL.........................A.TNLGTD...............................QL....CLEEMNPP..EASDSGL...LP.----VR..C........G..E..L...SP..........RCE.SFL...VHL..Q.AAL...RSRF.HLLLL...gVRQ...........................................----..---.RQP..LC....SE....LCDAWFATCESD.....VIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RSLLGD.ALPVA....--DPG................SVHCLN................................................................
A0A250XD00_9CHLO/29-204              ...........................sfkstraqsdhrtckpqglltldapypq-----....------.-----.....-----.........................-.-----Lqvleggl................pfcpqfpcTC....CNRSHITA..MHRSMAG...AF.DEPSSL..S........S..S..F...SS..........RCA.EML...KII..A.CRP...-CDP.MVGVG....LKE...........................................----..---.--K..VC....RH....TCKAWLSACRND.....YFGF...D...SI.....-S.G.AL.........................vPCSNA..AATSR..L..LIC........SRLNALV.PE..GAEqLC......-ALEGL.EVVD-....-AEAG................ATLC--yd..............................................................
F7C8X8_HORSE/36-211                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSRE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGF..NQCPV..E..AAC........HPFDFYF.PT..PEA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
U3IR18_ANAPP/35-217                  .......................................................RCLNG....TPPRRL.KKRDR.....RLLAPeapg................ggeamC.RGLYPR..............................lSC....CPRADTPG..LLHADTK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9EKS1_PHYMC/54-204              ......................................................a-C---....GGSHPL.PARSQ.....RHHRL.........................A.TNLGTS...............................QL....HLAEMNTP..EASDPGI...VS.----GR..C........G..E..L...SP..........RCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....IIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RTFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A3Q1NCZ3_BOVIN/84-202              .....................................qlgakalehpdlsvlsls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...MS..........RCE.SFL...VHL..Q.AAL...RSRF.HLVLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....VIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYRQTF.AD..GAE.LC......RSLLGD.ALPVA....--DPG................SGHCLN................................................................
A0A2K6AU51_MACNE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
F7BP54_MACMU/27-197                  .......................................................VCMNA....KQHKAQ.PSPED.....ELYG-.........................-.---QKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.CHF...IQD..T.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
F7DLZ1_XENTR/48-210                  ..............................................qcldyappf-----....------.KPP--.....AHLEF.........................C.SQYETF...............................GC....CDQDRDNA..IAEKYWS..iMD.YFD---..-........L..N..G...YH..........TCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQSS.....VTLL...T...E-.....--.-.--..........................DKQIR..ESC-N..K..GRD........LFCNLLN.LP..DED.YCf....pN-----.-----....-----................------vlhntdlnnnlgsvvedpegcmk.........................................
A0A2I3GPA3_NOMLE/47-113              .......................................................VCMDA....KHHKTK.PGPED.....KLHD-.........................-.QVWLEY...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACE.LFT...Q--..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lga.............................................................
A0A091F5K7_CORBR/21-188              ......................................................g-CLEG....DTQKPK.PSPEP.....NMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVS.NSFWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................NDTA..AIQ.GVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDESG.kNHC--..K..DKC........TPYSEIY.AN..GTD.MC......QSMWGE.SFKVS....---KS................SCLCLQ................................................................
A0A2K5Q8K8_CEBCA/37-193              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPRT...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2U1MUM5_ARTAN/54-202              ............................................tiqgkpprrvs-----....------.--KGP.....TDLTL.........................C.RLFRKN...............................TC....CDVTQTHP..ALLAIRR...LA.S-----..T........G..E..A...SD..........ECL.HLW...ELL..E.CSI...-CDP.HVG--....VQP...........................................----..---.GSP.vIC....AS....LCDRIYDACSNA.....YFAM...D...AK.....NQ.V.--..........................--LAP..CGI-S..D..TVC........GRASEWV.SN..GTE.LC......KAT-GF.SVKAS....SD---................------fkdsfcyg........................................................
A0A493T565_ANAPP/35-217              .......................................................RCLNG....TPPRRL.KKRDR.....RLLAPeapg................ggeamC.RGLYPR..............................lSC....CPRADTPG..LLHADTK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
M7BZS7_CHEMY/26-201                  .......................................................MCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.VLWKDN...............................AC....CTANTSME..AHQDQSY...LY.SFNWDH..C........G..V..M...PD..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCKDA.....ITCK...E...NW.....HK.G.WN..........................WTSGT..NQCPR..G..SMC........QPFKYVF.PQ..PAD.LC......EKIWSN.SYKYT....LEHRG................GGRCIQ................................................................
A0A096NJQ0_PAPAN/20-181              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FHHL...S...T-.....--.-.--..........................-DQEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
L5K4Y9_PTEAL/31-165                  .......................................................VCMDA....KHHKEK.PSPED.....KLHMQ.........................C.SPWKKN...............................AC....CSVNTSEE..AHKDISN...LY.KFNWDH..C........G..Q..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQSWWEDCRSS.....YTCK...S...NW.....HK.G.WN..........................WTSGS..NQC--..-..---........-------.--..---.--......------.-----....-----................------p...............................................................
F1PC15_CANLF/15-166                  ..................................agcppwrrprrpgcrgicvpr-----....------.-----.....-----.........................-.KQYSPF...............................GC....CTPERDAE..LARRFGA...LAaRVD---..-........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKFC--..-..---........-------.--..---.--......------.-----....-----................------rylslddadycfprllvnknlnsn........................................
A0A1L8HLT8_XENLA/38-218              .......................................................RCLNG....SPPSRV.KKRHR.....KLQTLdlgg.................agegC.GGFYPR..............................lSC....CPKPDIPG..MPMDNKI...LS.------..-........V..A..N...NT..........ECA.KLV...EEI..Q.CAH...-CSP.HAQNL....FHAsd.......................................ksETPE..KQL.FLP.aLC....KD....YCKEFYYTCRGH.....IPG-...-...-L.....IQ.T.SA..........................DEFCF.yHGIKD..S..GLCf.....pdFPRKQIR.GP..ASN.YL......NQMEDY.DKVEEi..sSKHKH................NCYCIQ................................................................
A0A2G2XX60_CAPAN/38-189              ..............................................rfsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RVFRGK...............................TC....CDVTQTHP..ALISIRR...LA.-----S..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSNA.....YFAI...D...AK.....-T.Q.VL..........................AP---..CAI-N..D..FVC........GRASEWI.SN..GTE.LC......HV-AGF.SVKSM....SDDPE................EASCY-g...............................................................
A0A3B4GM11_9CICH/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A2K6BLU8_MACNE/56-238              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVM.NAP..LC....QE....DCEEWWEDCRLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A0A3Q7XHD9_URSAR/1-120               .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2I2U806_FELCA/26-201              .......................................................VCMNT....KHHKRE.PGPED.....QLYDE.........................C.TPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLIH..C........G..L..M...MP..........GCE.KHF...IQA..I.CFY...ECSP.NLGPW....IRKmd.......................................laGPGE..RIL.DVP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WD..........................WSRGK..NRCPA..R..AVC........HPFPHYF.PT..PAD.LC......EKIWSN.SFKAS....PEGRN................SGRCLQ................................................................
H0XSY6_OTOGA/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KD....DCQQWWEACRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGV..NKCPA..G..TTC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A3Q2VNP5_HAPBU/23-175              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..T..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGG..AHTWK..-..---........-------.--..---.--......------.-----....-----................------skagmhvcacislinhs...............................................
F6WFD9_CIOIN/35-207                  .......................................................TCLSS....KHHKTQ.PGPED.....NLFK-.........................C.SAWLNN...............................SC....CTNYTAQY..VHGDGQP...LY.NLNFSH..C........A..P..M...SD..........KCR.NHF...TNN..N.CFY...ECSP.YLGPW....ITPqk.......................................lsYRHE..RMY.KVP..LC....AS....QCNAWWQDCKDE.....STCV...E...NW.....ST.G.FK..........................WDKSG..NHCPR..N..TVC........RPFTSVY.HN..ASH.FC......ETVWGPdDFVVT....---PD................HNYCM-k...............................................................
D7U9Y5_VITVI/37-188                  .............................................pfssegkppk-----....-----K.VSKGP.....KDLTL.........................C.RVFRRK...............................TC....CDVSQTHP..ALLSIRR...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.HVG--....VQP...........................................----..---.GPP.vIC....TS....LCDKVFQACSNA.....YFSM...D...AK.....-R.Q.VL..........................APCGV..----G..D..FVC........GRASEWI.SN..GTD.LC......HAV-GF.SVKPS....DAGME................ETSC--yg..............................................................
A0A383WEW0_TETOB/10-182              .....................scccwitatepvckqqgllmldephppyrvrlpf-----....------.-----.....-----.........................C.DKYR-C...............................SC....CNASHALA..IQRSVAP..lLA.D-----..-........E..E..L...GL..........ACK.AGL...VAL..A.CRL...-CDP.RVGVG....--N...........................................----..---.VTT..VC....ES....MCDRVYEACSED.....YFAF...D...ES.....-S.G.L-..........................VTPCT..GQQGG..S..LVC........SQLQQVV.PS..GAD.FC......RAA-GY.T----....-----................------psesssisssssssvgsvacfd..........................................
A0A2K5Y2E9_MANLE/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
M3W6W1_FELCA/36-211                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.TPWRKN...............................AC....CSHNTSQE..LHKDPSL...LY.NFNLDH..C........G..K..I...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGS..NKCPA..G..ATC........RTFETYF.PT..PAA.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A1W0A3G6_9STRA/3-151               ........................................crsvgtikfdpssvp-----....------.--MQQ.....RVMEH.........................C.SKYHKS...............................SC....CNATHNVP..LKRLILE..pIA.------..-........A..N..V...NV..........KCQ.QFH...EEL..A.CSA...-CHP.HVGTS...rIE-...........................................----..---.--R..IC....PD....LCDEWYDACKDE.....FYMS...G...N-.....--.H.HL..........................APCYG..NAL--..-..-IC........SRLKDIV.PT..GKG.FC......RMM-GY.T----....-----................------pgkatdtegidcfd..................................................
A0A2B4SL49_STYPI/31-197              ......................................................k-CIDG....PYHKQR.PTAEG.....ANYVE.........................C.HPWKEK...............................TC....CTADFTAQ..LNKSNVE..vLY.NFSWHH..C........G..N..L...SK..........ECE.RYI...KNE..E.CFY...SCEP.SLIKW....HT-...........................................-SKG..GVK.GVP..IC....AD....YCDKWFDACKND.....MTCA...E...DW.....LE.D.FN..........................FTSSQ..YSCRS..N..SQC........RKFSELY.KD..GKG.LC......NKMWGQ.SFTYE....----K................SDNCM-v...............................................................
C3Y1A9_BRAFL/1018-1187               ......................................................g-CLGD....RKHKRT.PGPEP.....DLQV-.........................C.SEYSMN...............................SC....CSAEFDQQ..LRMSPVV..kID.QFYMNR..C........G..T..M...SP..........RCE.QFR...LAM..N.CHY...HCDP.MIYRY....GKR...........................................GHPW..AVQ.NIP..IC....SS....FCDDFFDACRDD.....LTCA...E...SQ.....AT.D.WY..........................YSPEG.iNNCRP..D..SKC........RTFAEVY.VD..GRG.LC......NNIWSD.SYVYT....---ED................DDTCI-n...............................................................
A0A2K5VIZ1_MACFA/34-204              .......................................................VCMNA....KQHKAQ.PSPED.....ELYG-.........................-.---QKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.CHF...IQD..T.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A091HRR1_CALAN/31-206              .......................................................ICMDA....KHHKTK.PGPEG.....MLHDQ.........................C.SPWKDN...............................AC....CTANTTSE..AHRDQSN...LY.NFNWNH..C........G..L..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDC.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PH..PKD.LC......EKIWSN.SYRYT....TEHRG................SGRCIQ................................................................
A0A3Q7ST53_VULVU/31-206              .......................................................VCMDA....KHHKEK.PSPED.....GLHKQ.........................C.SPWKKN...............................SC....CFANTSRE..AHKDISY...LY.RFNWNH..C........G..S..M...TP..........ACK.KHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....KE....DCELWWQDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPE..G..AAC........HPFHFYF.PT..SAA.LC......SEIWSH.SYKVS....NYSXG................SGRCIQ................................................................
W5PV41_SHEEP/44-193                  ...........................................qcldyrppfqpl-----....------.-----.....QHLEF.........................C.SDYESF...............................GC....CDQGKDHR..IAARYWD...IM.DYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....IALL...T...ND.....RR.-.LQ..........................E----..-----..-..---........-------.--..---.--......------.-----....-----................------spgkdgarfchllnlpdkdycfpnilrsdhlnrn..............................
A0A452J254_9SAUR/5-158               ..........................hyfkesfcirqgsrscvhlslvcglqifs-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........V..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRGQ.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3B4TGF8_SERDU/84-247              ............................................qcldfeppfkp-----....------.--PW-.....-HLEF.........................C.TQYEQF...............................GC....CDQKMDNM..IAERYWD..iVE.QLE---..-........V..A..G...LE..........LCS.DML...KEI..M.CQQ...ECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHGKCRHV.....VRYL...T...E-.....-N.Q.LL..........................QDTAE..RDV--..S..TFC........SVAD---.LS..DQD.YCy....pNVLKSP.DLNTN....-----................------lgqvvedprgclq...................................................
A0A2K6M560_RHIBE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...QP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
G3H9G2_CRIGR/35-217                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................vSC....CLQSDSPG..LGRLENK..iFS.------..-........S..T..N...NT..........ECG.KLL...EEI..K.CAP...-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYSRKD..G..GSCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.EKVEEl..sRKHKH................NCFCVQ................................................................
A0A3M6UQR0_9CNID/23-165              ..............................................cfaqrqics-----....YYGSER.KPKEA.....YSLSN.........................C.TWYRES...............................SC....CTRTEVTS..SFLGMPH...LA.------..-........-..T..S...SD..........DCR.NRM...NYM..M.C-Y...FCSP.DQYKW....LKE...........................................----..--G.KVH..IC....KS....FCDDIYTHCKDA.....KYDG...N...SI.....GT.K.--..........................YSNGK..HFCEA..-..---........-------.--..---.--......------.-----....-----................------qffqvvdedcfefdeeifangslh........................................
G5C7E9_HETGA/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggevpC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECE.KLL...EEI..K.CAF...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.fLC....KD....YCKELFYTCRSH.....IPG-...-...-F.....LQ.T.TA..........................DEFCS.yYARKD..G..GLCf.....pdFPRKQMR.GP..ASN.SL......DQMEEY.NKVEEi..sRKHKH................NCFCVQ................................................................
F7GDT7_ORNAN/49-210                  ............................................cldygppfrps-----....------.-----.....VHLRF.........................C.SDYQTF...............................GC....CSPTKDQR..IAARYKE..iMD.SFD---..-........L..Q..G...SR..........LCG.GYI...KDI..L.C-Q...ECSP.FAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHHDCRSA.....ISLL...T...S-.....--.-.--..........................DRRLR..ESC-D..R..GGA........HFCHLLS.LP..DRD.YC......------.-----....-----................------fpnvlrntqlnrnlgavgedprgclq......................................
A0A2K5U044_MACFA/47-110              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrt...........................................................
A7RFR7_NEMVE/32-212                  .......................................................VCIDS....KHHKEK.PGPEV.....DYFHH.........................C.TPWKDH...............................AC....CKSNTTKH..IESDGTI..tLY.RMRWDQ..Cp.....qkR..A..M...SA..........KCK.RFF...EMD..T.CFY...ECSP.YLRPWi..eVDPhs.......................................kvTRRE..RFT.NVP..LC....SS....DCDAWFEACKFD.....YTCS...N...NWg...dME.T.WN..........................WTKNG..NDC--..K..MEC........KTFKDYF.GS..PAN.FC......NRLFNY.SFKYI....-SGKA................GEDCM-v...............................................................
A0A0A0LIV4_CUCSA/61-218              .....................................vciskggrfapfslegkp-----....----PS.KVSKV.....QDLTL.........................C.RVFRKR...............................TC....CGVAQTHP..ALLSVRR...LA.S-----..T........G..E..A...NH..........ECL.QLW...ELL..E.CSI...-CDP.QVG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVFKACSDA.....YFSV...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRASEWV.SN..GTD.LC......NAA-GF.TIKIS....-----................------deesscyg........................................................
A0A2K6AU68_MACNE/42-105              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrt...........................................................
A0A3B3BM95_ORYME/37-197              .............................................qcldfkppfr-----....------.-P--R.....RELQF.........................C.VMYKDF...............................GC....CDHQKDQE..LMAKFNR..iVD.NFD---..-........Y..H..G...YA..........GCA.GYV...MEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSTIWNKCRFA.....IPLL...S...ND.....SS.I.AD..........................IKD--..-----..-..NQT........RLCQHLQ.LD..DAD.YC......------.-----....-----................------yphllsnqrltkdlgrvqtdvdgcl.......................................
A0A1U7U5A7_TARSY/1-120               ......................................................m-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGN..NECPV..G..SAC........YSFHFYF.PT..PEA.LC......NEIWSH.SYKVS....NYSRG................SGRCI-e...............................................................
A0A2K6FL00_PROCO/44-200              ......................................................v-C---....AGSHPL.HARSR.....GHHGL.........................E.ADLGTSqlh.........................lagSC....CPSEMDTP..ETPGPGI...FP.----ER..C........G..A..S...SP..........GCE.SFL...GHL..Q.LAL...RSRF.RLLLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFAACEND.....VTC-...-...--.....GP.T.WL..........................PIPEK..RSC--..E..PSC........RTYGQTF.TD..GAN.LC......RSVLDH.TLPVA....--GPG................TRHCLN................................................................
A0A4D8YN41_SALSN/47-195              ................................................snvgkpp-----....----KK.ASKGP.....RDLTL.........................C.RVFRKK...............................TC....CDVTQTYP..ALLSIRR...LA.S-----..S........G..E..A...SQ..........ECL.NLW...EFL..E.CSV...-CDP.RVG--....VQR...........................................----..---.GPP.nIC....AS....FCDRIYEACSSA.....YFAM...D...GK.....-T.Q.VL..........................A-PCG..---QG..D..FVC........GRASEWV.SN..GTE.LC......SAA---.GFSVK...pLDEPG................EFPC--yg..............................................................
A0A3P8SEP0_AMPPE/35-196              ..............................................qcldfkppf-----....------.--RPR.....RDLEF.........................C.VMYKEF...............................GC....CDYEKDQE..LMTKYYQ..iMD.NFD---..-........Y..H..G...YA..........NCA.SFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSII.....IPLL...S...DD.....-P.H.I-..........................-----..AKI-R..E..NQT........HLCQYLE.LD..DVD.YCy....pHLLSNQ.KLSQHl..gRVQSD................SYGCL-q...............................................................
A0A0R0EQG0_SOYBN/26-187              ......................................vcvsqggrfppfksegg-----....-----A.PKNGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...TQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.-----....-----................------gfrvkpsdivdiaseetscyg...........................................
A0A2R8ZNL9_PANPA/59-197              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.--..---.--......------.-----....-----................------vqwrdlssm.......................................................
L8GFZ8_ACACA/30-205                  ......................................................q-CP--....YQNEEApHKPQP.....PIT-T.........................C.SSYADN...............................AC....CDHRDTND..LIRWLYV...-S.Q---KR..G........G..QdgT...NG..........ECL.SLL...HIM..R.CGL...LCSP.AQADF....VEKtnpmqs..............................ssklklaASPQ..MPY.TYR..LC....SS....FCDRLYAACSDE.....GMRE...V...EEa..eaGP.T.WDaa......................mtWDSEH..SSTAA..E..EFC........KS-----.--..---.--......------.-----....-----................------mapsdveivvvediptksgdgh..........................................
A0A445D0E6_ARAHY/64-227              ........................................dsrapftlnktlgfc-----....------.-----.....-----.........................-.-PYNGS...............................TC....CNSTQDAQ..IQKQFQA...MK.------..-........-..V..S...DT..........ACA.SVL...KSL..L.CAR...-CDP.FSAELy..tVQSsprsvp..............................vlcnstvPANS..SQS.KAA..AV....ED....FCSQVWDTCQTV.....YITN...S...PF.....AP.S.LQ..........................GQAGG..PQI--..K..ANA........TKLTNLW.QS..KTD.FC......SAFGGT.STNTS....-----................------vcfegep.........................................................
FOLR3_HUMAN/36-211                   .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..S.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........STFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
G3WEP7_SARHA/38-221                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQldsls...............gaeavC.GAFYPR..............................lSC....CSRIDSQS..LLHMESK...IF.S-----..-........V..T..N...NT..........ECM.KLL...EEI..R.CAH...-CSP.HSQNL....FHSpe.......................................rgEASE..RDL.ALP.lLC....ED....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.SA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..TSN.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A2K5HJX9_COLAP/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....RTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2R2MMB2_LINUN/30-196              .......................................schpqcldsrppfepg-----....------.-----.....SRLGF.........................C.PEYTDF...............................GC....CTPAQDKE..LGDFYKQ..vVQ.KLN---..-........N..N..G...LG..........ACV.DFA...KQI..L.C-Q...KCSP.YAAHL....YDA...........................................ETKL..IPR.SMP.gMC....TS....YCQQFYSKCRDS.....VKYL...T...SD.....KE.V.LA.........................tLDSAN..NFC-N..K..MSL........FDVD--Y.CY..PDL.LT......NSVLNS.DIVSA....FRNEE................DCLCL-e...............................................................
A0A1S4E7H0_DIACI/30-203              ......................................................w-CLDG....KFHKSL.PGPED.....ELHSQ.........................C.TPWKSF...............................SC....CTHNISKT..LH--YGN...LY.NFDLNH..Ca.....hiK..P..M...SM..........GCK.RHF...IQD..S.CFY...ECEP.NVRPW....AVRvn.......................................mtDRKE..RFY.KVP..LC....QS....DCEAWYRACEND.....YTCA...K...NW.....VT.D.FK..........................WGPGG..NKC-S..N..SKC........ITFREMFqNS..SKK.FC......EGIWDD.AWEET....---DD................TKPCM-r...............................................................
A0A091VTR1_NIPNI/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYETF...............................GC....CDQERDNS..IAAKYWD...IM.DYID--..-........P..Q..G...RK..........MCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCHSA.....ISLL...-...--.....--.-.-T..........................SDKHI..QECCK..T..NKT........RFCSLLH.LH..DED.YCf....pNVL---.-----....-----................------kntalnrnlglvledregclq...........................................
A0A493TNU4_ANAPP/26-142              .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQ...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------mwfdpakgnpnvvvakhpsshagapshlfscct...............................
A0A287BLX2_PIG/123-298               .......................................................VCMDA....KHHKPK.PSPED.....KLHDQ.........................C.SPWRKN...............................SC....CSVNTSLE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qkWRRE..RIL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPV..S..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SFEVS....SYSRG................SGRCIQ................................................................
A0A2Y9EA12_TRIMA/27-167              ....................................................acg-----....-GSPPI.RARPW.....GHHRL.........................A.ANLGTG...............................QL....HLAEIDTP..EASGPGT...VP.----ER..C........G..A..L...SP..........RCK.SFL...EHL..Q.DAL...RS--.---H-....---...........................................----..--F.LLP..LC....AE....LCEGWFTTCEAD.....ITC-...-...--.....GP.T.WL..........................S-LPE..RSC--..E..PGC........RTYAQTF.AD..GAD.LC......RSVLGH.TLPLA....--APG................SRHCLN................................................................
A0A3N7FTV4_POPTR/97-260              ....................................vclskggrfppytsegkpp-----....----KK.VSKGA.....KDLTL.........................C.RVFRKK...............................TC....CDVAQTYP..ALLSVRR...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACANA.....YFSM...D...AN.....--.-.--..........................KRVIA.pCGV-N..D..FVC........GQAAEWV.SN..GTE.LC......HAA-GY.AVKLS....D----................------dayvgaeeascy....................................................
E9PXB4_MOUSE/3-172                   ......sncretsvrlfslgkqliefplsghpqssvlpsypriqvpgsqtppvpv-----....------.-----.....-----.........................-.------...............................PC....CTAEIDRP..ES-----...--.--LLES..C........G..A..P...SP..........ECE.FFL...GQL..Q.GAL...RDRF.HPQLF...gARP...........................................----..---.VQP..LC....PE....LCQIWFTTCQAD.....FIC-...-...--.....GP.T.WL..........................QSSGE..RGC--..E..PSC........RTYGQTF.AN..ATD.LC......HSVLGH.VLRVA....--APG................SSHCLN................................................................
A0A3P9PHL6_POERE/26-201              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..sNK.NEPWDK..C........G..P..L...SA..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....ITCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A1S4CM70_TOBAC/41-192              ..............................................rfsnegkpp-----....----RK.VKKGP.....RELNL.........................C.RIFRGK...............................TC....CDVTQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRASQWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A2D0QV96_ICTPU/30-191              .................................................qcldyk-----....---PPF.QPQEP.....LR--F.........................C.KEYSKF...............................GC....CDLEQDKQ..ISYRFDQ...IM.DY-FDH..S........G..F..M...--..........ACG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....RD....YCSDFWHHCRYT.....LSLL...T...DN....nIT.A.II..........................EEDRE..KFC--..-..---........-------.--..---.--......------.-----....-----................------dhlelkdpeycypnvltsdelnanlgnvqaapkgciq...........................
A0A0E0K1U5_ORYPU/51-203              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RIFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTQ.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A096N631_PAPAN/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............agemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A067EYB3_CITSI/29-191              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A2K5JC57_COLAP/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPggslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WNQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A0A087WXL1_HUMAN/36-211              .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..S.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........STFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
F1N9X0_CHICK/32-207                  .......................................................VCMDA....KHHKTK.PGPEG.....MLYGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..M.CLY...ECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFTQVF.PS..PKD.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
S4RV82_PETMA/14-175                  .............................................qcldyrppfq-----....------.-PSS-.....-PLHL.........................C.TEYSSF...............................GC....CDAERDLQ..IYRRFWE..vMG.HMD---..-........G..G..G...YR..........LCA.SFI...KNL..L.C-Q...ECSP.YAAHL....FDA..........................................eDLST..PVR.TLP.gLC....PD....YCRSFYYQCGST.....LSLL...T...DD.....KE.V.RR..........................LETDG.eRLC--..-..---........---KRLV.LE..DED.YC......------.-----....-----................------ypavlespdlnaelgvvqagedgcmq......................................
C3Y0S5_BRAFL/9-176                   ..........................................cldfmppfepaep-----....------.-----.....--LSL.........................C.QEYSKF...............................GC....CTREQDHE..LKKQYDE..iLR.SL----..P........Q..N..S...RT..........KCE.KHV...MNI..L.C-Q...ECSP.YASHL....YDL...........................................ETTQvsVKK.PLP.gLC....PK....YCSSIPSECINA.....LLST...T...IDp..svRK.T.LS..........................PSDPQ..KFC--..-..---........---ESTK.IT..DMD.YCy....pDIITNE.QF---....-----................------sndiqkaiqgtggeeclcfk............................................
F7HEU3_MACMU/59-196                  ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQA-.--..---.--......------.-----....-----................------gvqwrdlgs.......................................................
A0A3Q1M7F5_BOVIN/1-167               .....................................................ml-----....------.PAPRC.....QQCCR.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.G.WA..........................WSRGK..PRCPE..W..EPC........RPFPHHF.PT..PAD.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A267FFW1_9PLAT/45-230              ......................................................l-CMMG....RLHKAE.PGPEP.....GLTTG........................pC.IGYSDS...............................SC....CTAEVGSR..LGSNDEF..aQA.AFRLDH..C........G.rR..L...SA..........ECE.KWF...ERS..R.CLY...ECSP.NLGPW....LVKvs......................................gysWRTE..RAY.GVP..LC....HS....QCQAWYAACAAD.....LSCV...P...NW.....SS.G.FRwi.....................rqaNGSGY.vNVCPD..GglAQC........RSIAQLHnHK..AEQ.FC......ETVWDG.EFKVV....---PD................GSPCFQ................................................................
A0A0R3VYB7_TAEAS/36-176              .......................................................MCPDS....HHLKDR.PSPEP.....DLEE-.........................C.REWKDR...............................AC....CPPETAVQ..IA--NAA...LH.GFSFEF..C........G..G..M...SK..........TCR.DYF...HHD..Y.CLI...KCSP.DLGPW....IVKlt.......................................ssRFKE..RAF.RVP..LC....ES....DCNAWYDACKSD.....KACS...T...NW.....RSgG.FD..........................WSEGE..K----..-..---........-------.--..---.--......------.-----....-----................------lsksafffeal.....................................................
A0A0E0DQT1_9ORYZ/69-169              ...........................................rfpafssevrkl-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.----AS..T........G..E..G...SL..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFAI...-...DV.....KK.Q.C-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------kylqelktrfhaminsgnigekrlicsvs...................................
D3ZWD2_RAT/27-208                    ......................................................t-C---....GGSHPL.QARSW.....GHPGL.........................A.ANVSTGqlqlaghpqssvppsypriqvpssqtpatpePC....CTADIDRP..EASNPES...LL.----AS..C........G..A..P...SP..........ECE.FFL...GHL..Q.RAL...RGRF.HPLLF...gVRR...........................................----..---.MQP..LC....ME....LCQIWFTTCQAD.....FIC-...-...--.....GP.T.WL..........................QSSGK..RGC--..E..PSC........RTYGQTF.AN..ATD.LC......HSALGH.ALRVA....--APG................SSHCFN................................................................
C3Z5S2_BRAFL/245-319                 ....................................ivavligfyrkfpdhvynd-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....--Sd........................................pnHNKW..QME.GMP..IR....AD....YCDAWFRACRYD.....RFCA...A...DS.....--.-.GS..........................YSSC-..-----..-..---........-------.--..---.--......------.-----....-----................------areyakvdntgdn...................................................
A0A2K5U025_MACFA/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A1I8HSL7_9PLAT/30-182              ...........................kaaqqeedqkthkstkskctffagtrys-----....------.-VPES.....SLVN-.........................C.YWYNRN...............................AC....CKRIEVTS..VFSSL--...LS.KL----..-........E..G..Q...SR..........RCY.DML...RYL..L.C-Y...FCSP.EQHFW....FRD...........................................----..--N.KVF..VC....KS....FCDDIYSHCRSA.....VMNG...L...EF.....GK.A.FK..........................N----..-----..-..---........-------.--..---.--......------.-----....-----................------gedfcrgnnfavqednvacfafdptqfdg...................................
A0A2K6BUN2_MACNE/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.VQ..WHN.LC......S-----.-----....-----................------lq..............................................................
A0A2K5MD83_CERAT/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9NAF4_DELLE/31-192              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEQDAA..LARRFGA..lAA.RV----..D........A..A..I...WA..........ECA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRGL.....FRHL...S...PD.....RE.L.WT..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A2I3GFZ2_NOMLE/22-183              ...............................................qcldfrpp-----....-----F.RPPQ-.....-PLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A3Q1AZX0_AMPOC/26-207              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.GLYADN...............................SC....CTEEHIQD..ISYVPSA..sSK.NEPWDK..C........G..R..L...SP..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigsegdgsrpcgclt..........................................
A0A3Q2X1N8_HAPBU/46-208              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FN....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SMV---D.LP..DQD.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
T1HFT3_RHOPR/43-223                  .......................................................ICLQS....TTHKEA.PGAEK.....NLTDE.........................C.SPWKDN...............................AC....CTPDTAIK..AL--SFT...LY.SLNYDM..Cp......qK..R..M...SE..........QCK.KHF...IRD..T.CFY...ECSP.NIGPW....KEQie.......................................saSRSQ..RFR.HVP..LC....KS....ECQDWFNACADD.....YTCS...D...NW.....SK.S.YDns.....................lvnNSTNG.tHICERdpS..ERC........KPFKDVF.ET..AEN.FC......EKIWDH.SWSVV....---DD................SEPCM-k...............................................................
A0A2K5J707_COLAP/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...QP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
I7MLY4_TETTS/44-200                  ......................................tntqnctansplhklky-----....---NTT.KVNDV.....KFADF.........................C.TDYSSR...............................TC....CTNDNFNQ..LRIQFYR..qVY.NN----..-........Q..D..L...SL..........DCQ.QVL...QKL..I.C-Y...DCDG.DVGLG....FRK...........................................----..---.--G..LC....AP....QCESIYEQCKND.....YFII...D...QN.....-T.Q.L-..........................---LK..VCSRQ..D..ILC........SKLHQIV.SQ..KTD.FC......KLL-GH.EV---....-----................------ndyqdyeewf......................................................
D4A700_RAT/43-205                    ...........................................qcldygppfrpp-----....------.-----.....LHLEF.........................C.SDYDSF...............................GC....CDRRKDRR..IAARYWD...IM.NYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHHNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGK..DGA--..-..---........RFCHLLN.LP..DED.YCf....pNVLRND.QLN--....-----................------rnlgvvaedhqgclq.................................................
A0A369RYD5_9METZ/32-204              .......................................................TCIAS....SYHKKV.PTPEQ.....DLVE-.........................C.KPWKAR...............................SC....CTPATVKE..LSLTANQ..vLY.NFRWDH..C........G..N..L...SS..........QCY.RYM...VQD..S.CFY...ECSP.NVGPW....IVNas.......................................ssRRSE..RFM.HVP..IC....AS....FCDNWFAACEND.....KTCS...G...DW.....RY.D.WK..........................WINRS..NHCKA..N..NTC........KTFGQIF.KT..SKG.FC......EGLWHY.SFKYQ....---SD................DKPCM-k...............................................................
M7B581_CHEMY/175-231                 ..............................................scsvfagea-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................--TGT..NRCPH..G..STC........QPFKYVF.PR..PAD.LC......EKIWSN.SYKYT....LEHRG................SGHCIQ................................................................
A0A226P2F6_COLVI/61-236              .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSY...LY.NFNWNH..C........G..V..M...PS..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....INQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFTQVF.PR..PKD.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A151PFV0_ALLMI/250-413             ...................................................vktk-----....------.-----.....QIWEK.........................C.TPWKVN...............................AC....YTGNTSTE..AHRDQSY...LY.RFNWNH..C........R..V..M...PH..........KCK.HHF...IQD..T.CLY...KCPP.NLGPW....IVKtd.......................................ssWRQE..RIL.HVP..LC....KE....DCEEWGEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGM..NHCPW..G..TVC........RPFKQVF.LR..AAD.LR......KKIWSD.SYKYT....TAPRG................SGRCMQ................................................................
A0A433SXA2_ELYCH/50-186              ..................................................kcsyf-----....-YNERS.PTNEG.....GLVN-.........................C.TWYKTK...............................AC....CKRTEVTS..VFAAMDP...LY.------..-........-..G..A...TK..........LCR.NYI...NYL..M.CFF...-CSP.DQGKF....YKS...........................................----..--N.KVN..VC....LD....YCESLYEECKNA.....GFSN...M...LI.....GE.A.YA..........................--NGT..SFCE-..-..---........-------.--..---.--......------.-----....-----................------aqnfevvenadcfkfdpnvfgssvk.......................................
A0A1L8GMA4_XENLA/21-187              .......................................................QCLGG....PHHKST.PSSET.....NFQE-.........................C.LLYAES...............................SC....CHANFTEK..LSRSPMI..eVN.NYYYNR..C........G..N..L...SK..........TCE.DYM...KKT..E.CFY...HCSP.LASHW....IHP...........................................NFSE..AIQ.HVP..VC....QS....FCDNWFDACHSD.....LTCT...Y...NW.....IS.D.WE..........................FDETG..NHC--..K..NDC........IPFHKMY.AN..GTD.LC......LNAWGV.SFVTS....---SS................PCRCL-d...............................................................
A0A2K6V1S4_SAIBB/2-158               ...................................................rppf-----....------.--RPQ.....QLLAL.........................C.SRYSVF...............................GC....CDEKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRHL...S...T-.....--.-.--..........................-DKEL..RAL-E..D..NRD........KFCHHLS.LD..DTD.YCy....pNLMVNK.SLNSDl..gHMVAD................ATGCLQ................................................................
A0A2I3G994_NOMLE/47-159              .......................................................VCMDA....KHHKTK.PGPED.....KLHD-.........................-.QVWTPP...............................AC....TTLTGITV..ARW----...--.------..-........-..-..-...SP..........PAS.ATS...SRD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTS--..-----..-..---........-------.--..---.--......------.-----....-----................------aa..............................................................
A0A444SGI4_ARMVU/28-213              ......................................................w-CIDS....KHHKTE.PGPEG.....ALFGQ.........................C.TPWKER...............................AC....CTSNTTKN..IHENKEA...IY.NFDFNH..C........S..E..MkplSA..........ECL.KHF...NQD..H.CFY...ECSP.NIGPW....VVKee.......................................rsWRKE..RYF.KVP..LC....AS....DCDVWYEACKND.....FTCT...D...NW.....SQ.N.FDwktv.................eceqgGGTCK.rNVCPA..D..SEC........QTFQRIF.GN..AKN.FC......ERVWDH.AWEYT....---SS................ETYCM-r...............................................................
A0A2I4B6U9_9TELE/23-198              .......................................................MCMDG....KHHKTE.PGPEG.....QLYSQ.........................C.TPWRDN...............................AC....CTANTTEE..AHEDNSY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...IQD..T.CFY...ECEP.HLGPW....IQLad.......................................esWRKE..RML.DVP..LC....KE....DCEQWWNDCKDD.....LTCK...T...NW.....HK.G.WD..........................WTSGT..NKCPK..D..SKC........RKWTEVF.PT..PKS.MC......EQIWSQ.SYMYT....TYTKG................SGRCMQ................................................................
A0A2I0MGT7_COLLI/32-165              ..............................................veapkkils-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
F6TAH8_HORSE/47-209                  ...........................................qcldygppfkpp-----....------.-----.....LHLQF.........................C.SDYESF...............................GC....CDQRKDHR..IAARYQD...IM.DYFD--..-........L..K..G...HE..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.R.LQ..........................ESHEK..NGA--..-..---........HFCHLLN.LP..DKD.YC......------.-----....-----................------fpnilrndhlnrnlglvtedrqgclq......................................
A0A093ICM0_DRYPU/34-213              ......................................................r-CLNGtpprRLKKRG.LSPEPp...gGGEAM.........................C.RGLYPR..............................lSC....CSRTDAQG..LLHAEAK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DVFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A087WYI3_HUMAN/36-178              .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..S.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........STF----.--..---.--......------.-----....-----................------................................................................
A0A3Q1HYP2_ANATE/38-208              ......................................chpqcldykppfgprqp-----....------.-----.....--LAF.........................C.KEYSKF...............................GC....CDLKKDGE..ISVKFDT..iME.NFD---..-........Y..S..G...YI..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSEYWQHCRYT.....L---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------sllledlgsppqfanltagieedrrkfcdflelkdkqycypnvlsneelnanlgvvsedptgc.
A0A401PDQ3_SCYTO/118-173             .......................................................TCPAT....GSHKAV.PSPEP.....ELYD-.........................C.PLYLKN...............................AC....CTVNIKDK..VNTSPEA...E-.--PWNR..C........G..H..L...ST..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------k...............................................................
F6U317_XENTR/38-218                  .......................................................RCLNG....SPPRRV.KKRHR.....KLQTLdlgg.................agegC.RGLYPR..............................lSC....CPKPDIPG..LPMDNKI...IS.------..-........V..T..N...NT..........ECA.KLV...EEI..R.CAQ...-CSP.HAQNL....FHAse.......................................rsETSE..KQL.FLP.aLC....KD....YCKEFYYTCRGQ.....IPG-...-...-L.....LQ.T.SA..........................DEFCF.yHGMKD..S..GLCf.....pdFPRKQMR.GP..ASN.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
T1F9I2_HELRO/85-230                  ...............................................fcsffnnr-----....-----A.-PQEQ.....LALKN.........................C.TWYSKN...............................SC....CLQHEIDV..SFSRVKS...LI.------..-........-..G..A...SE..........DCQ.KYT...NYL..M.C-Y...VCSP.DQNLF....YKK...........................................----..--E.RLT..VC....EP....FCDLLYEACKFA.....YLKG...Y...QI.....AD.L.YStg.....................kefCLSRR..FLVEY..R..HDC........FNMHDVN.FE..AMK.FS......------.-----....-----................------sssssspin.......................................................
L9JAA1_TUPCH/41-180                  ....................................mtvhvrpgqpsgrsvrvhi-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.-----H..P........G..Q..P...SA..........RCR.FKThlpERL..L.YRQ...ECSP.YAAHL....YDA..........................................eDAAT..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEHNR.aKFC--..-..---........---HYVS.LD..DTD.YCf....pRLLVNE.NLNLNl..gRVVAD................AQGCLQ................................................................
A0A078G1F5_BRANA/41-174              ...................................................vcii-----....--SKKG.KLPKP.....SDLNM.........................C.NAFHGK...............................TR....CSASSALQ..N------...LA.TY----..-........G..E..A...SK..........DCL.YLF...ELL..E.CS-...----.DVGP-....---...........................................----..---.-LR..IC....AS....FCDRVFEACSDA.....YFST...S...G-.....--.-.AS..........................NQVIV.pCGASN..G..IIC........VKVSKWG.TN..GTS.FC......EAVGFT.VVQ--....-----................------taddsacyg.......................................................
A0A287DAZ0_ICTTR/26-163              .......................................................VCMNA....QHHKRE.PGPED.....ELYVE.........................C.IPWKDN...............................AC....CTATTSWE..AHLEVSP...LH.NFTLVH..C........G..L..L...TP..........SCQ.KHF...IQA..I.CFY...QCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....WE....DCEEWWADCRTS.....YTCK...S...NW.....YS.S.WH..........................WSQVG..N----..-..---........-------.--..---.--......------.-----....-----................------ligtir..........................................................
A0A402FJS7_9SAUR/51-226              .......................................................VCMNA....KHQKAK.PGPED.....ALHRQ.........................C.SPWKDN...............................AC....CTANTSQA..AHESQSY...LY.NFSWDH..C........G..S..M...SQ..........KCK.EHF...IQD..T.CLY...ECSP.NLGPW....INPad.......................................tsWRKE..RIL.NVP..LC....RE....DCEQWWEDCKED.....ITCK...E...NW.....HK.G.WD..........................WSTGT..NRCPH..G..ASC........LPWSLVF.PH..PKD.LC......EKIWSN.SYQYT....TFSRG................SGRCIQ................................................................
A0A3B3QLY5_9TELE/23-179              .......................................................MCMDA....KHHKTE.PGPEG.....LLYKQ.........................C.SPWKDN...............................AC....CTANTSEQ..AHSDNSY...LY.NFEWNH..C........G..I..M...SE..........ACK.KHF...IQD..T.CFY...ECSP.HLGPW....VQMvd.......................................qsWRKE..RIL.NVP..LC....RE....DCETWWEDCKDD.....FTCK...E...NW.....HV.G.WD..........................WTTGS..-LCWH..S..FKCq......nDSHKSVF.PN..---.--......------.-----....-----................------pvlsdpq.........................................................
G3GRC1_CRIGR/155-317                 ...........................................qcldygppfrpp-----....------.-----.....LHLEF.........................C.SDYDSF...............................GC....CDQRKDHR..IAARYWD...IM.NFFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHHSCHSA.....ISLL...T...SD.....RS.-.--..........................----L..HESQE..K..DGA........RFCHLLN.LP..DED.YCf....pNVLRNS.QLNRNl..gVVAED................HKGCL-q...............................................................
A0A226NM25_CALSU/21-80               ......................................................g-CLEG....DTHKEK.PSPEP.....NMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVS.NSYWNR..C........G..Q..L...SK..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------s...............................................................
A0A2R6Q6Z9_ACTCH/41-189              ................................................asegkpp-----....----RK.VSKGP.....KDLTL.........................C.RLFRKK...............................TC....CDVAQTHL..ALLSVRR...LA.I-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.HIG--....VQP...........................................----..---.GPP.lIC....DS....LCDRVYKACSNA.....YFSM...-...DV.....KT.Q.VL..........................AP---..CGV-S..D..FVC........GRASEWT.SN..GTE.LC......RAA---.GFAVE...pSHHIE................ETSC--yg..............................................................
A0A0W8DQ05_PHYNI/33-184              ..........................................tcrsagvlkfdpe-----....----TH.PMQRT.....KGMEV.........................C.SKYRKS...............................TC....CNATHAHA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ALT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...-G.....GA.G.TL..........................APCYG..NAL--..-..-VC........SPLKSIA.NS..GAD.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
A0A2I3GJ26_NOMLE/36-182              .......................................................ICMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQ...........................................----..---.---..VC....MA....SCR-------YK.....-TYG...S...VW.....--.V.WN..........................W----..-NCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3D819_ORYME/58-220              ............................................qcldfqppfkp-----....------.---Q-.....WHLEF.........................C.GQYEQF...............................GC....CDQGTDNT..IAERYWN...II.EL-LE-..-........A..A..G...QD..........LCE.DLL...KEV..M.C-Q...ECSP.YAAHL....YDA..........................................eDPHT..PVR.ELP.gLC....FG....YCSEFHGKCRHV.....LKY-...-...LT.....GS.R.VL..........................LDTSE..RDV--..S..TFC........SMIDL--.-P..DQD.YCy....pNVLSSP.DLNSN....-----................------lgqvledprgclq...................................................
A0A3Q7UL67_VULVU/38-220              .......................................................RCLNG....NPPKRL.KRRER.....RLMSQlells...............ggealC.GGFYPR..............................lSC....CLRSDSAG..LGRPDTK...IF.S-----..-........M..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....IQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A433T103_ELYCH/56-152              ....................................drerwkefvaaliangkkg-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........S..K..P...RK..........RCL.APF...PAL..T.CQI...----.KLLQD....VRK...........................................IRRE..RFK.EVP..LC....KP....VCDNWYEACKDD.....LTCT...D...EW.....AE.N.FD..........................WSSD-..-----..-..---........-------.--..---.--......------.-----....-----................------iveedelrli......................................................
A0A0D9QVZ8_CHLSB/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..G.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGVWSH.SFKVS....NYSGG................SGRCIQ................................................................
I3JZH8_ORENI/53-214                  .............................................qcldfkppfr-----....------.---PQ.....RELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YA..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....SE....YCFQFWNKCSFT.....IPFL...S...GD.....-P.H.I-..........................----A..NVR--..E..NQT........SLCHYLE.LQ..DKD.YC......------.-----....-----................------ypyllnnqrltqnlggiqvnsngclq......................................
A0A2Y9DWW6_TRIMA/35-210              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EL..........DCK.RHF...IQD..T.CFY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WSSGI..NECPV..K..AAC........HTFEFYF.PT..PAD.LC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A2G9IAB8_9LAMI/30-190              ......................................vcisqggrfppfanegk-----....--PPKK.ASKGP.....RDLTL.........................C.RVFRRR...............................TC....CDVSQTHP..ALLTIRR...LA.S-----..S........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQR...........................................----..---.GPP.rIC....AS....FCDRVYEACSAA.....YFAM...D...AK.....-T.Q.VL..........................APCG-..--L-A..D..FVC........GRASEWI.SN..GTE.LC......HAAGFS.VTQFE....--DPE................EAQC--yg..............................................................
H2Y7Z2_CIOSA/28-200                  .......................................................TCLDG....KHHKTQ.PGPED.....NLFQ-.........................C.NAYVNN...............................SC....CTNYTAKY..LHGDGHS...LY.NFNYSH..C........A..P..M...SD..........KCR.QHF...TMN..N.CFY...ECSP.NLGPW....VKTqk.......................................isYRSE..RIY.KVP..LC....AS....ECQSWWNDCRDE.....RTCV...E...NW.....SF.G.FV..........................WNKNG..NHCPK..N..SRC........KYFHEVY.HN..STY.FC......EKLWGPdDFMVV....---DD................ADYCM-k...............................................................
K7F9U1_PELSI/34-216                  ......................................................k-CLNG....NPPRRL.KKRDR.....RMMFLepas................egemmC.RGFYPR..............................lSC....CSRTDSQG..LLHFENK...IF.S-----..-........V..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRGQ.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYTRKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A452R4D9_URSAM/2-160               .............................................dfrppfrppq-----....------.-----.....-PLRF.........................C.AQYSAF...............................GC....CTPEQDAA..LARRFGA...LAaRVD---..-........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A1S3JEC0_LINUN/32-206              ...............................................kcvtlpve-----....GASKTR.PSPEP.....GLE--.........................C.PSFRKR...............................SC....CNVNAVAN..LLENHVW...NG.IVTYLH..Cp.....qkP..R..L...SP..........ECE.RLT...FEQ..S.CFY...ACSP.NLGPW....IYR..........................................yLYLD..VGY.NVP..LC....AS....QCNKWWEACKEE.....YTCH...R...NW.....LA.D.MD..........................WSPEG.lNTCKE..G..SVC........RKYTEVY.NS..SID.FC......STVFNG.AYKVV....---PD................SEPCI-v...............................................................
A0A3Q1IZL8_ANATE/4-165               .............................................cldfeppfkp-----....------.---Q-.....WHLEF.........................C.EQYEEF...............................GC....CDQKTDNM..IAERYWD..iID.QLE---..-........V..A..G...YE..........LCT.DLL...KEI..M.C-Q...ECSP.YAAHL....FDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHSKCRHV.....VKY-...-...LT.....RN.K.LL..........................QDTAE..RDM--..S..TFC........SMVE---.LS..DRD.YCy....pDVLKNT.DLNSNl..gQVVED................PEGCL-q...............................................................
A0A3B1ILS7_ASTMX/7-179               .......................................................ACLQD....GRHKAT.PSPEP.....YLKE-.........................C.TMYMEN...............................AC....CSEQDITD..LTAPPAG...DD.GTPWDR..C........G..T..L...SP..........VCD.AFL...KRV..V.CFY...RCSP.HAAHW....PHP...........................................QRNS..FLK.AVP..LC....TS....FCRDWYEACKSD.....LTC-...-...--.....AR.D.WA..........................GDPRG..LNC--..T..GSC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEAGeedg........veghGCGCL-t...............................................................
A0A2K5NV62_CERAT/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.MQ..WHN.LC......S-----.-----....-----................------lq..............................................................
M3XXW1_MUSPF/44-206                  ...........................................qcldygppfqpp-----....------.-----.....VHLEF.........................C.SDYESF...............................GC....CDQHKDRR..LAARYKD...IM.DYFD--..-........L..R..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSSCHSA.....ISLL...T...ND.....-R.H.LQ..........................GSH--..----E..K..DGA........HFCHLLN.LP..DED.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedqqgclq.........................................
A0A452DRC1_CAPHI/39-221              .......................................................RCLNG....NPPKRL.KKKDR.....RMMSQpells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAA...-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9KGJ5_ENHLU/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3Q0GJ09_ALLSI/26-189              .......................................................TCLPG....GKHKAR.PSPE-.....SSLGL.........................C.QAYAHN...............................AC....CSPETAAE..ISTTGAR...--.DVAWDC..C........G..P..L...SS..........SCA.RYL...QQL..E.CFY...RCSP.GAAHW....LHP...........................................ERPA..ALH.RAP..LC....RD....FCQQWYDACRDD.....LTCA...R...DW.....VR.D.WR..........................WGPEG..NNC--..T..GGC........TPYSQMY.RD..GQD.LC......ETIWGD.AFVTE....---DP................PCPCL-t...............................................................
C0PIQ9_MAIZE/45-197                  ..............................................fssegkppg-----....------.RAPKG....rRDLAL.........................C.RIFRQK...............................TC....CDVMQTFP..ALVSVRN...LA.-----L..A........G..E..G...SQ..........ECI.HLW...ELL..E.CSI...-CDP.RVG--....IRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSES.....YFS-...-...--.....ID.T.KT..........................QALSP..CGL-D..D..ILC........GKTHKWV.SN..GTE.LC......RLA-GF.SVQI-....-----................------setssggvghtfcy..................................................
A0A2K5XL08_MANLE/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..APC........RTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGCCIQ................................................................
C3XUF6_BRAFL/6-176                   .......................................................RCMDG....RHHKTQ.PGPEG.....SLYNQ.........................C.APWKDR...............................AC....CRASTTEQ..LHQPL--...WL.NFDWHH..C........G..Q..L...SE..........SCE.RHF...KQD..L.CFY...ECSP.NVGPW....LVPvn.......................................mqIRNE..RFA.GVP..LC....AT....DCNRWWTACKDD.....MTCS...G...NW.....GV.S.WN..........................WTSGQ..NTCPH..G..AEC........RTFQDYF.GT..PSN.FC......RNIWNG.SFEVV....---DD................SAPC--ft..............................................................
I3JBR0_ORENI/37-208                  .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDVEKDEE..ISGRFYT..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRYT.....LGL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcl..
A0A3P8Y484_ESOLU/29-207              .......................................................ACLQD....GRPKAT.PSPEP.....HLKE-.........................C.TIYAEN...............................AC....CSESDIQD..LGPTANE...KS.-NPWDK..C........G..K..L...SP..........TCE.SYL...KRL..A.CFY...RCSP.DAARW....PHP...........................................RRQS..SMQ.AVP..LC....HS....FCRDWYEACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VLYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEED................------eregsegnshgsggrpcgclt...........................................
G3VZT1_SARHA/24-186                  ...........................................qcldygppfkpp-----....------.-----.....VHLEF.........................C.SDYETF...............................GC....CDQSKDRR..IAARYWD...IM.EYL-D-..-........L..R..G...PE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNSQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....RH.I.WA.........................sQEKNG.aHFC--..-..---........---HLLN.LP..DQD.YC......------.-----....-----................------fpnvlrndhlnrnlgavvedrkgclq......................................
P79388_PIG/30-205                    .......................................................VCMDA....KHHKVE.PGPED.....ELHDQ.........................C.VPWKKN...............................AC....CSARVSHE..LHRDKSS...LY.NFSWEH..C........G..R..M...EP..........ACK.RHF...IQN..N.CLY...ECSP.NLGPW....FQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCLDWWEDCRTS.....YTCK...S...SW.....HK.G.WN..........................WSSGS..NQCPT..G..TTC........DTFESFF.PT..PAA.LC......EGIWNH.DYKFT....NYSRG................SGRCIQ................................................................
A0A166I3N8_DAUCS/42-190              ...........................................tikgkpprrvnk-----....------.---GP.....KDLTL.........................C.RMFRKR...............................TC....CDVTQTHP..AFLTIRK...LA.S-----..T........G..E..A...SE..........DCL.QLW...ELL..E.CSV...-CDP.EVG--....VRS...........................................----..---.GPP.lVC....ST....FCDRVYEACSNA.....YFSM...-...DV.....ST.Q.VL..........................APCGV..NDF--..-..-VC........GRASEWI.SN..GSE.LC......RAS---.GFSVK...pLYDKQ................ERSC--yg..............................................................
F6VRR1_CALJA/3-164                   .................................................paatev-----....------.-----.....----Q.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A091FGB2_9AVES/29-204              .......................................................ICMDA....KHHKTK.PGPEG.....NLHDQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSY...LY.KFNWNH..C........G..R..M...PL..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NLCPW..G..AMC........RPFSQVF.PR..PKD.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A2U3WRC2_ODORO/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9MH67_DELLE/34-209              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSLNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...KP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...I...NW.....HK.G.WN..........................WTSGY..NQCPV..R..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
C1EEA4_MICCC/25-217                  .......................................................VCHLH....YYHKDV.SHAEIw...gSDVSI.........................C.KEYEHE...............................AC....CTKDTVKK..IDVNSKL...YG.DYDLDA..C........G..-..L...SS..........SCK.KFF...IEE..S.CFY...ECDR.NVGKW....RKHvdcd...................................dageDNGW..EIK.GMP..VK....AS....YWDAWYEACKDQ.....YFAW...G...PG.....GS.Y.WDipkft...............tdsyrgT--GH.rGQRTA..Y..TSC........SKFSDTY.KN..GTM.VA......EVMWGG.AFTYE....KDES-................------kayvmtfpd.......................................................
F1MI35_BOVIN/31-192                  ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.SQYSAF...............................GC....CTPEQDAA..LARRFGA..vAA.RVD---..-........A..A..M...WA..........ECA.GYA...LDL..L.C-Q...ECSP.YVAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR..A----..-..KLC........RSLSL--.-D..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
D3YZI1_MOUSE/26-143                  .......................................................VCMNS....KRHKQE.PGPED.....ELYQE.........................C.RPWEDN...............................AC....CTRSTSWE..AHLEEPL...LF.NFSMMH..C........G..L..L...TP..........ACR.KHF...IQA..I.CFH...ECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHSS.....LTC-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A287A7L0_PIG/29-204                .......................................................ICMNA....KPHKPE.PSPED.....KLYEE.........................C.IPWKHN...............................AC....CTADTSWE..AHLDVAL...LY.NFSLVH..C........G..L..M...MP..........GCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQQvr.......................................gaGWGE..RIL.DAP..LC....QE....DCEEWWADCRTS.....YTCK...S...NW.....LG.G.WT..........................WSRGK..HRCPA..R..ALC........HPFPHYF.PT..PAD.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
A0A452STC7_URSAM/31-206              .......................................................VCMDA....KHHKEK.PSPED.....ELHKQ.........................C.SPWKKN...............................SC....CFTNTSEE..AHKDISY...LY.KFNWNH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGY..NRCPA..G..AAC........LPFHFYF.PT..SAA.LC......GEIWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A218VFA8_9PASE/21-188              ......................................................g-CLEG....DTQKLK.PGPEP.....NMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVS.DSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.DAARW....IHP...........................................NDTA..AIR.AVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDESG.eNHC--..N..NKC........IPYREMY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K6LAI1_RHIBE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1B0GSV4_MOUSE/29-177              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..LHKADSR...LY.-FNWDH..C........G..K..M...EP..........ACK.SHF...IQD..S.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCHQWWEACRTS.....FTCK...R...DW.....HK.G.WD..........................WSSGI..NKCPN..T..APC........HTFEYYF.PT..P--.--......------.-----....-----................------................................................................
A0A091CNP1_FUKDA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggempC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECE.KLL...EEV..K.CAF...-CSP.HSQSL....FHSp........................................erEVVE..RDL.LLP.fLC....KD....YCKELFYTCRSH.....IPG-...-...-F.....LQ.T.TA..........................DEFCS.yYVRKD..G..GLCf.....pdFPRKQMR.GP..ASN.SL......DQMEEY.DKVEEi..sRKHKH................NCFCVQ................................................................
M7AZZ7_CHEMY/7-169                   ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYETF...............................GC....CDQDKDNS..IAAKYWE...IM.DYID--..-........P..Q..G...HQ..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.IQ..DQD.YCy....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
E2QXC4_CANLF/31-206                  .......................................................VCMDA....KHHKEK.PSPED.....GLHKQ.........................C.SPWKKN...............................SC....CFANTSRE..AHKDISY...LY.RFNWNH..C........G..S..M...TP..........ACK.KHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....KE....DCEQWWQDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPE..G..AAC........HPFHFYF.PT..SAA.LC......SEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
G3V8M6_RAT/34-209                    .......................................................VCMDA....KHHKEK.PGPED.....KLHDQ.........................C.SPWKTN...............................AC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..T..M...TP..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCVLWWEDCKSS.....FTCK...S...NW.....HK.G.WN..........................WTSGH..NECPV..G..ASC........HPFTFYF.PT..PAV.LC......EKIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2K6BUN5_MACNE/27-183              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
U3IEN3_ANAPP/21-188                  ......................................................g-CLEG....DTHKLK.PSPEP.....DMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................SYTA..AIQ.SVP..LC....KS....FCDDWFEACKDD.....STCV...H...NW.....LT.D.WE..........................WNESG.eNRC--..K..NKC........IPYSEMY.AN..GTD.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
C3Y1A9_BRAFL/1229-1397               ......................................................a-CVRHd..dPHHKEY.PTPEP.....DLQV-.........................C.SPYAYG...............................SC....CTVEHDHH..LAVRPVP..gVH.NFSWNR..C........G..T..L...SP..........QCE.NFM...IDL..E.CFN...SCSP.DIRRL....SIP...........................................--TD..SGS.AIP..VC....AS....FCDRWFSACRND.....VTCV...A...NW.....RS.D.WD..........................MDDNN.rNNCPE..G..SSC........KTFDEMY.GD..AQT.LC......ETFFGS.EFQYN....S----................------tdkcvd..........................................................
G1LZN7_AILME/31-206                  .......................................................VCMNT....KHHKRE.PGPED.....KLYEE.........................C.IPWQDN...............................AC....CTASTSWE..AHLDASL...LY.TFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..I.CFY...ECSP.NLGPW....IQKmd.......................................ssGPGE..RIL.DAP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WN..........................RSGGK..NRCPA..R..AIC........HPFPHYF.PT..PAD.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A452DRC4_CAPHI/39-221              .......................................................RCLNG....NPPKRL.KKKDR.....RMMSQpells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAA...-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3M0KHC3_HIRRU/30-205              .......................................................VCMDA....KHHKTE.PGPEG.....QLYGQ.........................C.VLWKDN...............................AC....CTANTSLE..AHQDQSY...LY.NFNWDH..C........G..V..M...PE..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IEQad.......................................tsWRKE..RIR.DVP..LC....QE....DCEQWWEDCQDA.....VTCK...V...NW.....HK.G.WN..........................WTTGT..NQCPK..G..AMC........QKFKFVF.PT..AAV.LC......KQIWSG.SYRYT....SYHRG................SGRCIQ................................................................
A0A455C822_PHYMC/44-219              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTAGY..NQCPV..R..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A2K6UFM4_SAIBB/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1D5R4Y4_MACMU/47-115              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrtpvsms......................................................
A0A452QBA6_URSAM/27-202              .......................................................VCMNT....KHHKRE.PGPED.....KLYEE.........................C.IPWQDN...............................AC....CTAGTSWE..AHLDASL...LY.TFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..I.CFY...ECSP.NLGPW....IQKvd.......................................ssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WD..........................RSGGK..NRCPA..R..AVC........HPFPHYF.PT..PAD.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A452HYW3_9SAUR/63-225              ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYETF...............................GC....CDQDKDNS..IAAKYWE...IM.DYI-D-..-........L..Q..G...HE..........LCG.EYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.IQ..DQD.YCy....pNVLKNT.DLNSNl..gSVVED................PKGCLQ................................................................
W4YAJ7_STRPU/312-484                 .......................................................RCLDG....KFHKDK.PGPES.....ALFSQ.........................C.SAWKNR...............................SC....CTEEITED..LHIQPI-...WH.DFKWNH..C.......dT..P..L...ST..........TCE.QWM...RQD..L.CFY...ECSP.NVGPW....LVPhn.......................................isIRNE..RFM.HVP..LC....ES....ECNVWWEACRYD.....FTCK...D...NW.....AK.G.WD..........................WSSGE..NECPS..D..ATC........DTFEAKF.GN..ASN.MC......QTIWNK.SYTVV....---PD................SESCM-v...............................................................
C3YZN7_BRAFL/18-189                  ......................................................s-CLDG....MHHKQV.PGPEG.....SLYQQ.........................C.TPWKDR...............................AC....CRGNVTEK..MHQDQLF...PY.NFQWHH..C........G..Q..L...SP..........ACE.RHF...MQD..M.CFY...ECSP.NLGPW....LVKiq.......................................mkIRNE..RFV.NVP..LC....AS....DCNQWWQACKDD.....MTCS...G...NW.....GK.G.WN..........................WT-SV..NECPR..G..NQC........KTFKKYF.GD..ATN.FC......QKIWDG.SFTVV....---AD................TEPCM-t...............................................................
A0A287D157_ICTTR/26-201              .......................................................VCMNA....QHHKRE.PGPED.....ELYVE.........................C.IPWKDN...............................AC....CTATTSWE..AHLEVSP...LH.NFTLVH..C........G..L..L...TP..........SCQ.KHF...IQA..I.CFY...QCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....WE....DCEEWWADCRTS.....YTCK...S...NW.....YS.S.WH..........................WSQGK..NRCPA..G..DIC........HPFPHYF.PT..PTD.LC......EKIWSN.SFKAS....PEHRN................SGRCLQ................................................................
I3MG93_ICTTR/34-209                  .......................................................VCMDA....KHHKEK.PSPED.....KLHEQ.........................C.SPWKKN...............................SC....CSFNTSQE..AHKDISY...LY.GFNWDH..C........G..K..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCQTS.....FTCK...S...NW.....HK.G.WN..........................WTLGY..NQCPV..G..TAC........HPFHFYF.PT..PAA.LC......EEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
F6UZU3_CALJA/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
F5GZ45_HUMAN/41-180                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........-------.--..---.--......------.-----....-----................------................................................................
G3NYD9_GASAC/25-200                  .......................................................MCMDG....KHHKVN.PGPEG.....KLYLQ.........................C.APWREN...............................AC....CTANTSTE..AHDDASY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRRE..RIL.DVP..LC....NE....DCHSWWEDCKND.....FTCK...T...DW.....HK.G.WD..........................WSSGT..NRCPE..G..SKC........RKWTEVY.PT..AKS.MC......EQIWSN.SYLYT....THPKT................SGRCMQ................................................................
K7EN64_HUMAN/27-130                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....I---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
R0JTG2_ANAPL/1-98                    .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FRYL...S...SD.....PE.L.VA..........................L---E..NNM--..A..KLC........RYLSL--.-E..DTD.YCf....pHLLTNE.NLNQNl..gLVTAD................AEGCL-q...............................................................
A0A2G5DM75_AQUCA/36-190              .............................................sfssegkppr-----....-----K.VNKGP.....KDLTL.........................C.RVFRRS...............................TC....CDVTQTHQ..ALLTIRR...LA.SV----..-........G..E..A...NQ..........ECL.QLW...ELL..E.CSI...-CDP.LVG--....VQR...........................................----..---.GPP.lIC....SS....LCDRIFQSCSSA.....YFSM...D...A-.....KT.Q.VL..........................SPCG-..--L-S..D..FVC........GRASEWV.SN..GTE.LC......QHA-GF.SVKSS...gNG---................------hkgmeetfcyg.....................................................
A0A2K6M558_RHIBE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...QP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........RTFESYF.PT..PAT.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
C1EAB4_MICCC/27-183                  ........................................vcvnhqgvpsfalag-----....-----K.PPAKG.....KGLTF.........................C.EEYREE...............................TC....CDAKTTDN..VRRVAAH...MQ.------..L........G..G..F...KI..........QCR.EAW...TQL..E.CSI...-CDP.RAG--....ITS...........................................----..---.KTK..VC....AH....QCDAIYRACKDD.....YFTE...D...KL.....--.-.--..........................QR-LT..PCRSS..D..TIC........TKLSEWA.DDmgGGQ.MC......EDA-GY.EVVSA...gKSKAD................GGWCF-d...............................................................
G3Q9P9_GASAC/34-195                  ..........................................qcldfkppfrplr-----....------.-----.....-ELEF.........................C.VMYKEF...............................GC....CDYQRDQE..LMANYYH...VM.---GGS..D........Y..S..G...YV..........RCA.GFV...LEL..L.C-Q...QCSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSEFWKKCSST.....IPLL...S...ND.....--.T.-L..........................IAK--..--L-K..E..DQT........RLCQYLK.LD..DDD.YCy....pHLLSNQ.KLTQNl..gTVQSD................SEGCLQ................................................................
A0A3B3Y5F4_9TELE/26-204              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..rNK.NEPWDK..C........G..P..L...SS..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeageag...engaegrP-----cgclt...........................................................
K7G8A6_PELSI/63-225                  ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.TAYETF...............................GC....CDQEKDNS..IGAKYWE...IM.DYID--..-........P..Q..G...HK..........LCG.GYI...KDI..L.CQV...-CSP.YAAHL....YDA..........................................eNLQT..PLR.NLP.gLC....FD....YCSEFHFYCRSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..K..NKT........RFCNLLN.IQ..DQD.YCy....pDVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
A0A3Q4GF04_NEOBR/57-219              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.KQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SM---VD.LP..DQD.YCy....pNVLKSS.DLNSNl..gQVVED................PRGCL-q...............................................................
A0A267EHC0_9PLAT/23-164              .................................................yctffg-----....---NRA.PAPQP.....TLHN-.........................C.TWYRQH...............................SC....CRGEEINI..TFASVRP...LQ.------..-........-..G..A...SR..........SCL.RYF...NSL..M.C-Y...ICSP.SQWVF....YRG...........................................----..--E.SLT..VC....RD....FCDKWYQACGSA.....FIKG...Q...TV.....AS.L.FE..........................--NGY..KLC--..-..---........DSRQFKV.ST..GKD.DC......------.-----....-----................------fryvaeegevfaeasgpp..............................................
A0A2K6ALM9_MACNE/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LS..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A3Q2KTY9_HORSE/7-170               ................................................lsysalp-----....------.-----.....---PS.........................C.IPWKDS...............................AC....CTANTSWK..AHLNVSL...LY.NFSLVH..C........G..L..M...MP..........GCQ.RHF...IQA..V.CFY...ECSP.NLGPW....IQQvd.......................................lsGQGE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSGGK..NRCPA..R..ARC........HPFPHYF.PT..PAD.LC......ERIWSN.SFKAS....PEHRN................SGRCLQ................................................................
K7F9T5_PELSI/35-217                  ......................................................k-CLNG....NPPRRL.KKRDR.....RMMFLepas................egemmC.RGFYPR..............................lSC....CSRTDSQG..LLHFENK...IF.S-----..-........V..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRGQ.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYTRKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A3B1J8J3_ASTMX/36-197              .............................................qcldfkppfq-----....------.--PQQ.....EL-QF.........................C.VMYKRF...............................GC....CDYARDQE..LMSRFYK..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..DLR.SIP.gLC....PD....YCSQFYSKCRST.....IPLL...S...DD.....PQ.L.LE..........................LQHD-..----Q..S..RLC........QRLGL--.-D..DLD.YCy....pHLLSNE.QLTKNl..gRVTSD................SEGCL-q...............................................................
A0A3P9CAW3_9CICH/36-208              .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDVEKDEE..ISGRFYN..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDADT..PMR.ALP.gLC....GD....YCSDYWRQCRYT.....LSLL...L...ED.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle.....
F5H5L8_HUMAN/76-148                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...E---.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A3M7R1L6_BRAPC/55-197              .................................................pclyfs-----....--ENRY.SQPES.....SLIN-.........................C.TWYKAN...............................AC....CKRTEVAS..VFENMFT...LN.------..-........-..R..A...SE..........VCM.NMM...NYM..M.CFF...-CSP.NQYIW....YRE...........................................----..--M.QIF..VC....LR....FCEELVEKCKEA.....EYNG...N...TI.....GE.I.YKdga....................sfcR----..-----..-..---........-------.--..---.--......------.-----....-----................------aqdfkvipsnhqcfdfdsspfstsnqvsana.................................
A0A3Q4GHF8_NEOBR/11-184              ...........................................lekcvkghlqiq-----....------.---EF.....VHYYF.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....ITCK...D...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDFF.PT..PKS.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A337S7S7_FELCA/48-207              ......................................................f-C---....GGSRPL.PALSR.....RHHRL.........................A.TDFGTVqlhl......................ypspwSC....CPSEMDTP..EASDPGA...VP.----ER..C........G..E..P...SP..........GCE.SFL...GHL..Q.AAL...QSRF.RLLLL...gIRQ...........................................----..---.TQP..LC....SE....LCDVWFATCESD.....ITC-...-...--.....GP.T.WL..........................PFPEK..RGC--..E..PGC........ATYEQTF.AD..GAD.LC......RSVLGY.VLPVA....--APG................ADHCLN................................................................
A0A0E0CMR2_9ORYZ/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A452GGX8_9SAUR/41-195              .......................................................VCMDA....KHHKTK.PGPEG.....ALHGQ.........................C.ALWKDN...............................AC....CTAETSTG..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........MCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKDA.....VTCK...E...NW.....HK.G.WN..........................WTS--..-----..-..---........-------.--..-AD.LC......EKIWSN.SYKYT....TEHWG................SGRCI-q...............................................................
A0A0L8HL22_OCTBM/38-170              ...................................................ycsf-----....-FSNRA.PSPQP.....TLKN-.........................C.TWFQSN...............................SC....CMQEEIAA..TFGNVKP...LP.------..-........-..G..A...NE..........KCQ.NYL...NYL..M.C-Y...ICAP.NQNVF....YLR...........................................----..--E.RLT..VC....KE....FCNNFYEACRYA.....ILKG...S...I-.....-V.G.NL..........................YSNGS..EFC--..-..---........-------.--..---.--......------.-----....-----................------lsrsfkvddagngkcfnhdfqee.........................................
A0A091VRV6_OPIHO/31-206              .......................................................ICMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSN...LY.NFNWNH..C........G..Q..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRQE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSHVF.PR..PKD.LC......EKIWSN.SYKYT....TEPRG................SGRCIQ................................................................
A0A1A6GQV6_NEOLE/38-138              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................vSC....CLQSDSPG..LGRLENK...IF.S-----..-........A..T..N...NT..........ECG.KLL...EEI..K.CAP...-CSP.HSQSL...fYSP...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------erdvldgdlevv....................................................
A0A0L9TY98_PHAAN/26-186              ...........................................vcvsqggrfppf-----....KSEGSV.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CGVTHTHP..ALMSVRK...LA.TT----..-........G..E..A...NP..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VAA---.-----....-----................------gfrvsssdigfiaseeascy............................................
A0A1V4KC84_PATFA/8-144               ................................................rcldstf-----....------.-----.....-----.........................-.------...............................--....--------..-HKASKR...FY.RLSARL..D........G..A..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCRQVWQKCRSI.....FRYL...S...TD.....QE.L.IA..........................LENNM.aKFC--..-..---........RYLS---.LE..DTD.YC......------.-----....-----................------fphllanqnlnqnlgfvtadaegclq......................................
A0A3S1A5C9_ELYCH/35-126              .......................................................ICMLG....EHHKGS.PGPEK.....GLTSK........................iC.SPWAAR...............................SC....CTEETALD..IHTNSTW...L-.NFDWNH..C........A..P..L...SA..........QCR.EYF...IMD..S.CFY...SCSP.NVGPW....LVE...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vsvilrac........................................................
A0A3Q3FZF7_9LABR/27-200              ..............................................cchpqcldy-----....--KPPF.EPRQP.....LVF--.........................C.KEYSKF...............................GC....CDLEKDGE..ISVRFYN..iMA.--NFDH..S........G..Y..M...--..........TCG.KYL...RSI..L.C-Q...ECSP.YSAHL....YDA..........................................eDANT..HMR.MLP.gLC....PD....YCSEYWNQCRYT.....LSLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledfggpqqfanltatieedsrrfcdflelkdkqycypnvltntelnanlgfvsedptgcle..
A0A402EZX3_9SAUR/41-202              ....................................................qcl-----....DFKPPF.KPPRP.....LAF--.........................C.TQYSDF...............................GC....CEAQRDSA..LLERFYR...VT.E-HLD-..-........H..A..A...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVK.TVP.gLC....PD....YCVQVWQNCRSM.....FKLL...S...ED.....RE.L.LA..........................LENNM.aKFC--..-..---........-------.--..---.--......------.-----....-----................------rylaledadycfphlltnkrltqnlglvtadtegclq...........................
FOLR2_MOUSE/29-203                   .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..LHKADSR...LY.-FNWDH..C........G..K..M...EP..........ACK.SHF...IQD..S.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCHQWWEACRTS.....FTCK...R...DW.....HK.G.WD..........................WSSGI..NKCPN..T..APC........HTFEYYF.PT..PAS.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3BC65_ORYME/36-214              .......................................................RCYDG....SLPKRL.KKRER.....KVLLDggss.................sgelC.HMLYSR..............................vSC....CPTRRAAY..QI-----...LH.RMDARI..F........S..T..N...NT..........ECA.HLL...DEI..K.CA-...RCSP.NAQVL....FHSld.......................................idRQPH..REP.DLP.rLC....LD....FCRKFYYTCRGH.....IPEL...-...-F.....QA.D.V-..........................DEFCQ.yYGRRG..A..GLCf.....pdFQRRQLL.GQ..DSN.YL......EDE---.KIDEI...nRRHKH................NCYCA-q...............................................................
K7F2T8_PELSI/26-195                  .......................................................VCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.APWKDN...............................AC....CTAQTSTE..AHKDQSY...LY.SFNWHH..C........G..V..M...PE..........KCR.QHF...IQD..K.CLY...ECSP.NLGPW....IQQad.......................................ssWRRQ..RIL.HVP..LC....KE....DCEQWWEDCKDA.....RTCK...E...NW.....HK.G.WN..........................WTTGT..NRCPR..G..SRC........RPFWSVF.PR..PAD.LC......EKIWSN.SYKYT....QEHR-................------g...............................................................
D7L3W2_ARALL/34-192                  .........................................vciskggrflpyet-----....------.PMPSSl..efKDLNL.........................C.NVFHGK...............................TC....CSASTMHS..ASLALEN...LA.TY----..-........G..E..A...TK..........DCL.DLF...ELL..E.CSI...-YQP.DVG--....IQS...........................................----..--E.PLR..IC....AS....FCDRVFEACSDA.....YFRR...N...AS.....-N.Q.VI..........................VPCGA..SEG--..T..IIC........GKASKWE.SS..GTA.FC......YAL---.-----....-----................------gftvqtagdlteepcyg...............................................
A0A2R8MSW7_CALJA/36-211              .......................................................VCMDA....KHHKAH.PGPED.....NLYGQ.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A452FHW0_CAPHI/30-205              .......................................................VCMNA....RYHKEK.PGPED.....KLHGQ.........................C.SPWKNN...............................AC....CFVNTSIE..AHKDISS...LY.RFDWDH..C........G..K..M...EP..........ACK.RHF...IQD..I.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPV..K..VAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYRAS....NYSRG................SGRCIQ................................................................
A0A0A0AII1_CHAVO/31-206              .......................................................ICMDA....KHHKTK.PGPEG.....KLHDQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSN...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....LTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSNVF.PR..PKD.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A091IPD0_EGRGA/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYENF...............................GC....CDQQKDNS..IAAKYWD...IM.DYIDP-..-........-..R..G...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ISL-...-...--.....--.-.LT..........................SDKHV..QECCE..T..NKT........RFCNLLH.LH..DED.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A1S3JNN2_LINUN/79-248              ......................................................k-CLEG....PHHKDK.PSPEG.....DGYVE.........................C.LSWKQS...............................SC....CLANVTQE..IATHKAK..nLY.NYHWDR..C........G..T..L...SQ..........ACE.LYI...KDE..E.CFY...QCEP.ALVRF....PAA...........................................-KKG..YVK.GIP..IC....AK....YCNDWFEACKND.....LTCV...V...DW.....LA.D.FN..........................YTTGE..NHCPT..G..SQC........RTFTEVY.KN..GQG.LC......ERMWGE.AFTYE....----T................SNNCM-vmk.............................................................
A0A1D1UEU9_RAMVA/47-164              ...................................................fsif-----....------.-----.....-----.........................-.----QN...............................SC....CRQVELDA..IFKDIKP...IL.------..-........-..G..A...DE..........KCT.KML...NYM..I.CWV...-CDP.NQHLF....YSS...........................................----..QRQ.ELT..FC....ES....FCDAILSACQTA.....I-QK...G...EL.....MA.H.F-..........................YQDGR..QFCKN..-..---........-------.--..---.--......------.-----....-----................------hnfhvpesssnetcfpsrtlwqq.........................................
A0A3Q3RTD1_9TELE/33-207              .......................................................MCMDA....KHHKTE.PGPEG.....QLYSQ.........................C.APWRDN...............................AC....CTANTTEE..AHNDNSY...LY.SFNWNH..C........G..V..M...SP..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qnWRKE..RIL.DVP..LC....VE....DCHNWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGD..CKNMQ..T..ETF........FTFSYIT.TE..RNN.TF......TSICIH.K----....-----................------ktlkfmrntmqhsl..................................................
M3YEQ8_MUSPF/43-111                  .......................................................ICMDV....KPRKEK.PRPEN.....KLHK-.........................-.---RKN...............................PC....CFANITWE..AQKGISH...LY.RLNWDH..C........G..Q..T...AP..........ACS.T--...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ssrtptsmsap.....................................................
A0A3Q7R261_VULVU/27-177              ......................................................a-C---....GGSRPL.PALSR.....RHHRL.........................A.ADLGTG...............................QL....HLAEMDTP..EASGPGM...VS.----EN..C........G..E..P...SP..........GCE.SFL...GHL..Q.VAL...HNRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDIWFASCESD.....ITC-...-...--.....GP.T.WL..........................PLLEK..RGC--..E..PRC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................ADHCLN................................................................
F4K5P7_ARATH/38-198                  ..................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKK...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................KRVIG.pCGVND..D..IIC........IKASNWE.SN..GTS.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A1S4CHA6_TOBAC/41-192              .............................................rfsnegkppk-----....-----K.VKKGP.....RDLNL.........................C.RIFRGK...............................TC....CDVTQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSNA.....YFSM...D...AK.....-T.Q.VL..........................AP---..CGV-S..D..FVC........GRASQWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
G1PPC4_MYOLU/31-206                  .......................................................ICMNA....KHHKEK.PSPED.....KLHEQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDVSY...LY.RFNWDH..C........G..P..M...KP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCESWWEDCRTS.....YTCK...A...NW.....HK.G.WN..........................WTSGS..NKCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
G5AVT7_HETGA/132-307                 .......................................................VCMDA....KHHKVK.PGPED.....KLHEQ.........................C.SPWKKN...............................SC....CYANTSEE..AHKNISN...LY.RFNWNH..C........G..E..M...EP..........TCK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCKTS.....LTCK...S...NW.....HK.G.WN..........................WEKGY..NECPT..N..AAC........HPFHFYF.PT..PAD.LC......QEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A087WWY2_HUMAN/47-129              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACS.ATS...S--..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------rtpvsmsahqpgaldpa...............................................
A0A2C9LYG6_BIOGL/68-214              ..........................................kyhqrekhkctyf-----....-YNNRY.PNAEG.....GLIN-.........................C.TWYTAN...............................SC....CKRTEVTS..VFSAMDP...LY.------..-........-..G..A...TV..........LCR.NYI...NYL..M.CFF...-CSP.DQYKF....YRA...........................................----..-NK.KVS..VC....LD....YCESLYEECKTA.....GFNK...S...LI.....GE.A.YGng.....................tafC----..-----..-..---........-------.--..---.--......------.-----....-----................------aaqnfevvdsadcfkfdpkvfgssnrl.....................................
A0A1U8CEV7_MESAU/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RVMSQlells...............ggeilC.GGFYPR..............................vSC....CLQSDSPG..LGRLENK..iFS.------..-........S..T..N...NT..........ECD.RLL...EEI..K.CAP...-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYTRKD..G..GACf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.EKVEEl..sRKHKH................SCFCVQ................................................................
A0A452DRI5_CAPHI/39-221              .......................................................RCLNG....NPPKRL.KKKDR.....RMMSQpells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAA...-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A287A261_PIG/21-193                .......................................................ICMNA....KPHKPE.PSPED.....KLYEE.........................C.IPWKHN...............................AC....CTADTSWE..AHLDVAL...LY.NFSLVH..C........G..L..M...MP..........GCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQQ..........................................vRGAE..RIL.DAP..LC....QE....DCEEWWADCRTS.....YTCK...S...NW.....LG.G.WT..........................WSRGK..HRCPA..R..ALC........HPFPHYF.PT..PAD.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
A0A401RF46_CHIPU/9-170               ............................................qcldykppfkp-----....------.--TKP.....--LAF.........................C.TAYSSF...............................GC....CDARADSS..LARRYQH...IV.SYLHP-..-........-..P..G...VS..........VCG.KYI...QEL..L.C-Q...KCSP.YAAHL....YDA..........................................eDADT..PVR.VLP.gLC....SD....YCAEFWKRCRST.....LSLL...T...GD.....TR.T.VD..........................LETDR.gKFC--..-..---........---SYLE.LQ..DPD.YCf....pNVLSSE.RLQTN....-----................------lgrvqadaegclq...................................................
A0A2K5RKE5_CEBCA/36-211              .......................................................VCMDA....KHHKEK.PGPED.....KLHEQ.........................C.SPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.NFDWNH..C........G..E..M...AP..........ACR.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCSTS.....YTCK...S...NW.....HK.G.WN..........................WTSGS..NKCPV..G..AAC........LSFHFYF.PT..PTD.LC......NEIWSH.SFKVS....NYRRG................SGRCIQ................................................................
M7B581_CHEMY/56-153                  .......................................................VCMDA....KHHKTR.PGPEG.....ALHGQ.........................C.APWKDN...............................AC....CTAETSTG..AHQDQSY...LY.SFNWAH..C........R..V..M...PD..........KCK.WHF...IQD..T.CLY...ECSP.NLGPW....IHQ...........................................DPRE..PGT.NAQ..LC....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------gm..............................................................
C3Y1A9_BRAFL/34-203                  ......................................................g-CLQG....EKHKDA.PSPES.....GLGV-.........................C.KDYSDS...............................SC....CSADIGQQ..LSVTPIV..kVD.GFRWDN..C........G..T..L...SK..........RCQ.DFM...VNV..E.CFY...RCSP.SLPTW....AAP...........................................-YPS..AVR.GVP..VC....MQ....FCDDWMEACRED.....MTCA...D...NW.....IT.G.WK..........................IEDGE.lNKCRS..E..ERC........RTFAQVF.RN..GRG.LC......ESIWGQ.SFTYE....--STP................DTPCL-d...............................................................
V4KLW5_EUTSA/37-198                  ....................................vcvskggrfqpyesegkpp-----....------.---KSvgrgsKDLTL.........................C.RVFRKR...............................TC....CSSAQTNS..AFVAVRN...LA.TY----..-........G..E..A...SQ..........DCL.HLF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCNKVFEACKDA.....YFAS...N...AL.....--.-.-T..........................QMIGP..CGVND..D..IIC........VKASNWE.SN..GTA.FC......EAA-GF.SVQTN....-DDSR................EEPC--yg..............................................................
J3KR13_HUMAN/3-164                   .................................................paatev-----....------.-----.....----Q.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A091IFN5_CALAN/21-188              ......................................................g-CLEG....DTHKPK.PSPEP.....NLHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.QASRW....INP...........................................NDAA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICV...H...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........TPYSEMY.AN..GTD.LC......QSMWGE.SFKVR....---ES................SCLCLQ................................................................
A0A2R8ZPX1_PANPA/37-193              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A1U7UUD1_TARSY/44-206              ..............................................qcldykppf-----....------.QPP--.....LHLEF.........................C.SDYESF...............................GC....CDQYKDRR..IAARYWD..iME.YFD---..-........L..K..S...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPHT..PLR.NLP.gLC....SD....YCSAFHSSCHSA.....ISLL...T...ND.....-R.G.L-..........................QEFQG..K----..-..DGA........RFCHLLN.LP..DKD.YCf....pN-----.-----....-----................------vlrndylnrnlgvvakdhqgclq.........................................
A0A3P8X980_ESOLU/34-195              ..............................................qcldfkppf-----....------.KPQ--.....EDLQF.........................C.TMYGTF...............................GC....CDSVKDQE..LMTKFYN..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PTR.TIP.gLC....PD....YCSQFWSKCRST.....ITLL...S...DQ.....PQ.H.AE..........................TEQDQ.vRFC--..-..---........---QN--.--..---.--......------.-----....-----................------lqledpdycyphilrneqltqnlgrvvanpegclq.............................
K8EY55_9CHLO/29-238                  .......................................................VCHVN....YYHKHV.STPTFm...pSDVNV.........................C.REYQYE...............................AC....CSLDTVRK..VPTQMIS..dLY.GDEYNHglCvdivgggfT..A..M...ST..........GCQ.AYF...DAE..N.CFY...ECDK.NVGKW....RKHsdcnee...............................dadvsnHNAW..QIE.AMP..IR....AS....TADAMYEACKDD.....FFPD...S...KG.....MW.G.TEagnwad.............awstrvnVDA--..NGVNT.gT..GTC........KKGSEIW.TN..GQD.MV......ENVWGT.AFKYE....SDAT-................------ksyvwgfn........................................................
A0A2I3LU31_PAPAN/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A7SH49_NEMVE/214-341                 ......................................................y-CP--....YFKNRG.PSRQD.....NLRN-.........................C.TWYTEN...............................SC....CHDSEIEF..AFAQLTP...IP.------..-........-..K..A...GE..........SCV.KQL...NYL..Y.C-Y...ICAP.NQNTF....FRR...........................................----..--S.TLT..VC....EE....FCNRIYSACKKA.....YLKG...M...MI.....GD.M.--..........................YSNGR..EFC--..-..---........-------.--..---.--......------.-----....-----................------egrrfevsdknskqgcfd..............................................
F2U311_SALR5/18-154                  .....................................yfgnrgteplmrpgigdr-----....------.-----.....-NL-N.........................C.SWYHDN...............................AC....CRANEVYD..IFQTQRA...LP.------..-........-..G..A...DF..........GCQ.IAM...SRL..M.CWV...-CDP.DQALF....YYN...........................................----..--E.QLH..IC....QS....MCDYVFAACQDA.....LFQG...R...TL.....RE.Q.F-..........................---GTsrALC--..-..-EA........RRFKVVQ.DG..GDE.--......------.-----....-----................------acfdgalslt......................................................
A0A3B5AU80_9TELE/41-202              ..........................................qcldfkppfrplr-----....------.-----.....-ELQF.........................C.VMYKEF...............................GC....CDYEKDQK..LMAKYYQ..iME.NFD---..-........Y..Y..G...YA..........NCA.SSV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQLWGKCRFV.....IPLL...S...D-.....--.-.--..........................-DPHI..AKV-K..E..NQT........HLCQHLA.LD..DVD.YCy....pHLLSNQ.KLTQNl..gRVQSD................SDGCLQ................................................................
A0A3B3QN53_9TELE/56-218              ................................................slyyyrl-----....------.-----.....----Q.........................C.SPWKDN...............................AC....CTANTSEQ..AHSDNSY...LY.NFEWNH..C........G..I..M...SE..........ACK.KHF...IQD..T.CFY...ECSP.HLGPW....VQMvd.......................................qsWRKE..RIL.NVP..LC....RE....DCETWWEDCKDD.....FTCK...E...NW.....HV.G.WD..........................WTTGR..NRCPS..A..STC........QLFSTVF.PT..AQN.LC......EKIWSN.SYKYT....TYAKS................SGRCMQ................................................................
A0A3M0KM39_HIRRU/35-226              .......................................................RCLNG....TPPRRL.KKRDR.....RVLSPeapg................ggeamC.RGLYPR..............................lSC....CSRSEAQG..LPHAEAK..vLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRAH.....IPVQ...A...GL.....AA.K.TE..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tcyhgtgavcqreetrewliresgkvefaeggigreiqceeqlaantsgerrkhkhncfciq..
A0A3Q3FCG3_9LABR/28-170              .......................................................VCLQD....GKHKAT.PGPEP.....HLRE-.........................C.GLYADN...............................SC....CTDENIQD..ISHVPAD..tNK.NEPWDK..C........G..S..L...SS..........QCE.GFL...KRV..A.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRVD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQVG.LN..PNH.--......------.-----....-----................------l...............................................................
E9PXL5_MOUSE/34-160                  .......................................................VCMDA....KHHKEK.PGPED.....NLHDQ.........................C.SPWKTN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..T..M...TS..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCQSS.....FTCK...S...NW.....HK.G.WN..........................W----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A091G6J4_9AVES/21-188              ......................................................g-CLEG....DTHKPK.PSPEP.....DLHE-.........................C.TLYSES...............................SC....CHADFTAQ..LAPSPVI..kVQ.NSYWNR..C........G..Q..L...SE..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....MHR...........................................NRTA..AVQ.SVP..LC....QS....FCDDWYEACKDD.....SICV...H...NW.....LT.D.WE..........................WDESG.eNRC--..K..DKC........IPYSKMY.AN..GTD.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A060WNV0_ONCMY/1-143               ......................................................m-----....------.-----.....-----.........................-.--YRNF...............................GC....CDSAKDKE..LMGKFYK..iMD.NFD---..-........Y..Y..G...YA..........SCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRST.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ.dRFC--..-..---........-------.--..---.--......------.-----....-----................------qhleledpdycyphllsneqltqnlgrvradpegclq...........................
A0A2C9VH51_MANES/29-193              ...................................qciskggrfppfstegkppk-----....-----K.VSKGS.....KDLTL.........................C.RVFRQK...............................TC....CDVAQTHP..ALLSIRR...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.KIG--....VQP...........................................----..---.GLP.lIC....TS....FCDRVYQACADA.....YFSM...D...AK.....-T.Q.VV..........................A-P--..CGV-N..D..FVC........GKASQWV.SN..GTE.LCl....sAGFTVK.SYEAA....EGGTE................EASC--yg..............................................................
A0C2I4_PARTE/29-192                  ............................................ecnfknrivyg-----....------.---QQ.....KLHHLsg....................iyfC.DSYAKR...............................TC....CSQQNLEE..LKFKWYR...--.--EQQQ..A........V..E..L...TQ..........QCQ.EIF...IKT..I.CSD...-CDG.DIG--....-QQ...........................................----..--I.RVG..FC....PK....YCSQMYHACQND.....LFQY...D...EK.....TQ.K.--..........................LRLCY..---QN..D..VFC........SELRNIV.NS..GDQ.FC......TSL-GY.K----....-----................------vnsysnidewlenkylnlstnplcw.......................................
A0A2K6UFL6_SAIBB/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1S3WI24_ERIEU/4-133               .................................................ehkifs-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........G..T..N...NT..........ECG.KLL...EEI..R.CAL...-CSP.NSQSL....FHSp........................................ekEALE..REL.LFP.lLC....KD....YCKEFFYTCRGQ.....IAG-...-...-F.....LQ.T.TA..........................DEFCF.yHARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEDY.DKGEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9QCS1_DELLE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6LAH7_RHIBE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1S3W8Y0_ERIEU/35-149              .........................................qcldygppfrsplp-----....------.-----.....--LDF.........................C.SDYESF...............................GC....CDQHGDQR..VAARYRD...IM.SYLDP-..-........-..Q..G...RE..........LCG.GYI...RDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.SLP.gLC....PD....YCAAFQASCG--.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------paarllaprldga...................................................
A0A402F1K4_9SAUR/20-181              .......................................................RCLPG....GKHKAS.PSPEG.....HLGT-.........................C.NLYREN...............................AC....CSPDVILD..LSKANDI...--.--YWNR..C........G..G..L...SS..........RCE.EYL...QRV..E.CFY...RCSP.IAAQW....PHP...........................................QRPT..AVL.AVP..LC....QN....FCEQWYDACKED.....LTCA...R...NW.....LT.D.WH..........................WGPDG..NNC--..S..QEC........ISYGQMY.KD..GKE.LC......ETIWDD.SFVAS....---TD................PCECL-t...............................................................
A0A2P6R7B4_ROSCH/26-188              .....................................vcisqgsrfppfssegkp-----....------.--PKRvskgpKDLTL.........................C.RVFRKK...............................TC....CDVAQTHP..ALLAIRK...LA.L-----..A........G..E..A...NS..........ECL.QLW...ELL..E.CSI...-CDP.RIG--....VQP...........................................----..---.GPP.vIC....AS....FCDRVFSACSGA.....YYST...-...DA.....IT.Q.VL..........................APCGV..NDY--..-..-VC........GRASEWI.LN..GTE.FC......HAA---.GFAV-....-----................------kgdtsesleetfcyg.................................................
H9KWL0_CALJA/45-205                  ...........................................cldygppfrplp-----....------.-----.....-HLAF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYRD..iME.YFD---..-........L..K..R...HE..........LCG.HYI...KDI..L.C-Q...ECSP.HAAHL....YDA..........................................eHPQP..RPR.SVP.gLC....SD....YCAAFHSNCPSA.....ISL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ltsdrgpqeppgtdgarfcrllalpdkdycfpnvlrndylhrnlgvvaqdprgcl.........
A0A2U3VBB8_ODORO/31-206              .......................................................VCMDA....KHHKEK.PSPED.....QLHKQ.........................C.SPWKKN...............................SC....CFANTSEE..AHKDISY...LY.KFNWDH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPA..G..AAC........LPFHFYF.PT..SAA.LC......REIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A445IMT1_GLYSO/40-203              ...........................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
S4REP9_PETMA/28-195                  ......................................................g-CMAG....SKSKPR.PGPEP.....GLQA-.........................C.SQYNQN...............................AC....CTPESVRQ..LSQSPVV..rVD.ELLWDR..C........G..N..L...TP..........SCE.SFL...KRV..E.CYS...RCSP.LASRW....AHR...........................................AHPS..LLH.HVP..VC....SH....FCDSWFDACRED.....FTCV...R...NW.....IY.D.WD..........................WSVEG..NFC--..P..GAC........VPFSQMF.RD..GRD.LC......EGFWGL.AL---....-----................------lpvahgvepcis....................................................
Q7ZWL5_XENLA/38-218                  .......................................................RCLNG....SSPRRV.KKRHR.....KLQTLdlgg.................agegC.RGLYPR..............................lSC....CPKTDIPG..MPMDSKI...LS.------..-........V..A..N...NT..........ECA.KLV...EEI..R.CAH...-CSP.HAQNL....FHAse.......................................rsETSE..RQL.FLP.vLC....KD....YCKEFYYTCRGQ.....IPG-...-...-L.....LQ.T.SA..........................DEFCF.yHGMRD..S..GLCf.....pdFPRKQMR.GP..ASN.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
A0A2K5RJT0_CEBCA/3-164               .................................................paatev-----....------.-----.....----Q.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWEH..C........G..R..M...KP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGI..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A398AQG5_BRACM/10-157              ...............................................vciskrgr-----....PYELEG.KLPKP.....GDLNL.........................C.NASHDK...............................TC....WSASLALQ..N------...--.---LAT..H........G..E..A...SK..........DCF.YFY...DLL..E.CSI...-CHP.DVG--....VQS...........................................----..--E.RLR..IC....AS....FCDRVFEACSDA.....YFST...S...DA.....SN.Q.VI..........................V-P--..CGASN..G..IIC........VKVFKWG.TN..GTS.FC......EAV---.-----....-----................------gftvdqtadvsacyg.................................................
A0A3L8RUH4_CHLGU/28-185              .......................................................VCMDA....KHHKSE.PGPEG.....RLYEQ.........................C.SPWKDN...............................AC....CTANTSLE..AHKDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.S--...----.----W....---...........................................-RRE..RIL.HVP..LC....RE....DCEEWWEDCKDA.....LTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PR..PKD.LC......EKIWSN.SFRYS....REPRG................SGRCIQ................................................................
A0A383ZAD1_BALAS/27-177              ......................................................a-C---....GGSHPL.PVRSQ.....RHHRL.........................A.TNLGTS...............................QL....HLAEMNTP..EALDPGI...VS.----VR..C........G..E..L...SP..........GCE.SFL...EHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....IIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A3Q2HQY6_HORSE/47-181              .......................................................VCMDA....KHHKAK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSRE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRTS.....YTCK...S...NW.....HK.G.WD..........................WTSGG..-----..-..---........-------.--..---.--......------.-----....-----................------glae............................................................
F7CKM1_MONDO/29-205                  .......................................................VCMDA....KHHKYK.PSQED.....YLHQQ.........................C.SPWKKR...............................AC....CTASTSIA..AHEDASH...SY.GFNFNH..C........G..T..M...TP..........ACK.RHF...VQD..T.CLY...ECSP.NLGPW....IQPvn.......................................ssWRKE..RVM.NIP..LC....KE....DCNMWWEDCKTS.....YTCK...E...NW.....QK.G.WN..........................WSSGI..NECPV..K..AAC........HPFSFYF.PT..PTS.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
L8Y6R5_TUPCH/159-321                 ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQHKDER..IAARYWD...IM.DYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCYAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESQGK..DGS--..-..---........RFCHLLN.LP..DKD.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedhqgclq.........................................
A0A099YTJ8_TINGU/21-188              ......................................................s-CLDG....ETHKLN.GKEN-.....PYCTI.........................F.VSFLTA...............................SC....CYANFTEQ..LAHSPVI..kIN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................NYSA..AIR.SVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDESG.vNHC--..K..NKC........VPYSEVY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A384DKN2_URSMA/2-161               .....................................................vf-----....------.-----.....--PTQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
F6TB36_CIOIN/101-235                 .......................................................YCADG....KYPQEV.KLSTE.....NHGVM.........................CgKEYPTL...............................SC....CSQHDLTM..ELFGARL...VE.N-----..-........-..I..P...EV..........NCA.KLL...MKL..R.CAH...-CSP.RSWWL....FHAp........................................dkMTPP..HKR.MVP.iLC....PK....FCRQFHQACRET.....VAG-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lqmenycdyhttdeegpcfpdyevr.......................................
A0A452GAF9_CAPHI/26-201              .......................................................VCMNA....KPHKPE.PSPEA.....ELYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQKvg.......................................phWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...DW.....LG.S.WA..........................WSRGK..PRCPE..R..APC........RPFPHYF.PT..PAD.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
R0LWV5_ANAPL/5-131                   ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2U9B5E4_SCOMX/23-198              .......................................................MCMDG....KHHKVE.PGREG.....DLYKQ.........................C.SPWRDN...............................AC....CTANTSTE..AHNDNSY...LY.NFNWDH..C........G..A..M...SP..........KCK.NHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qsWRRE..RIV.NVP..LC....ME....DCHDWWEDCKND.....TTCK...T...DW.....HT.G.WD..........................WSSGN..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EQIWSN.SYLYT....TDSKT................SGRCMQ................................................................
A0A096MER3_POEFO/51-213              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.SQYEQF...............................GC....CDQRTDNV..IAERYWD..vIE.QLE---..-........T..A..G...YD..........LCE.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHRKCRHV.....LRYL...T...D-.....-N.Q.LL..........................LDTSG..RDM--..A..TFC........SLVD---.LS..DQD.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
A0A2Y9M7R2_DELLE/26-201              .......................................................ICVNA....KPHKPA.PSPEA.....KLHEE.........................C.IPWKDN...............................AC....CTANTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQRld.......................................prGQAE..RIL.DAP..LC....RE....DCEQWWADCRTS.....YTCK...S...NW.....HG.G.WT..........................WSRGK..PRCPA..R..ALC........HPFLHYF.PT..PAD.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
W5P256_SHEEP/30-205                  .......................................................VCMNA....RYHKEK.PGPED.....KLHGQ.........................C.SPWKNN...............................AC....CFVNTSIE..AHKDISS...LY.RFDWDH..C........G..K..M...EP..........ACK.RHF...IQD..I.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPV..K..VAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYRAS....NYSRG................SGRCIQ................................................................
A0A0L0DUQ8_THETB/85-215              ......................................................g-CAPD....SSHSEP.FKPRR.....KL-SF.........................C.KEFSQF...............................GC....CDAKDAKA..IKATVDE...LV.---DPK..C........-..-..-...-S..........ACH.AII...AQM..K.C-S...ECHP.EAGKF....WLE...........................................----..RFS.SVR..LC....AG....FCRSLFALCAD-.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------iplfrdarnddgtsaamfinggdidvdtfcephva.............................
A0A498MI10_LABRO/33-194              ......................................................q-CL--....DYKPPF.QPPEP.....LLF--.........................C.KEYAKF...............................GC....CDLDRDNQ..ISQRFYQ...IM.DY-FDH..T........G..F..M...--..........ACG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....GN....YCNDFWLHCRYT.....LSLL...I...NN.....NE.T.YG..........................IEEDQ.sKFC--..-..---........---K---.--..---.--......------.-----....-----................------ylelkdpeycypnvlsnddlnanlgdvkadpqgciq............................
A0A3Q7WLE2_URSAR/30-205              .......................................................VCMDA....KHHKAK.PGPED.....KLHDQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2Y9T990_PHYMC/26-210              .......................................................ICMNA....KPHKPE.PSPEA.....KLYEE.........................C.IPWKDS...............................AC....CTANTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQRvgrsgr..............................gweldprGQAE..RIL.DAP..LC....RE....DCEQWWADCRTS.....YTCK...S...NW.....HG.G.WT..........................WRRGK..PRCPA..R..ALC........HPFLHYF.PT..PAD.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
J3LEC8_ORYBR/50-202                  .........................................fssegkppgraakg-----....------.----R.....RDLAL.........................C.RIFRQK...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...DV.....KS.Q.A-..........................LSP--..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......HSA---.G----....-----................------fsvqaseinsggvddtfcy.............................................
A0A1S2XY02_CICAR/50-210              .....................................vcvsqggrfppfkseglp-----....------.PKSGP.....KDLTL.........................C.RVFRKK...............................TC....CDVSHTHP..ALLSVRK...LA.S-----..A........G..E..A...SQ..........ECL.HLW...ELL..E.CAI...-CDP.HMG--....TRP...........................................----..---.GPP.lIC....ES....LCERIYDACSNA.....YFSM...-...DV.....KT.Q.ML..........................APCGG..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.-----....-----................------gfrvkqsdvidiaseeifcy............................................
A0A059B6W0_EUCGR/107-259             ............................................asegkppgkvg-----....------.--RGS.....KGLTL.........................C.RVFRKK...............................TC....CDVSQTHP..ALIATRR...LT.L-----..K........G..E..A...SE..........ECV.QLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....LCDKIFQACSNA.....YFSM...D...PK.....-T.Q.VL..........................APCGV..NEV--..-..-IC........ARASECV.SN..GTE.LC......LAA---.-----....-----................------gfsvkldddryvgseeahcyg...........................................
A0A1S3JEV8_LINUN/34-211              ...............................................mcvilpme-----....GASKTA.PSPEP.....DLE--.........................C.PSFREK...............................SC....CNTNVTAD..FLENHVW...GT.VVNYVH..Cp.....ekP..R..L...SP..........KCE.RLT...HQE..M.CFF...ACSP.NLGPW....IAKpy.......................................kyPDIN..HLD.QAP..IC....AS....QCKKWWNACKEE.....YTCH...K...DW.....IA.D.MD..........................WNVPE.iNSCKE..G..SVC........RKYKEFY.SS..ATD.FC......NTIWHG.AYKVV....---PD................SEPCM-v...............................................................
G3T5H0_LOXAF/38-220                  .......................................................RCLNG....NPPRRL.KRRDR.....RMMPQldlls...............ggemlC.GAFYPR..............................lSC....CLRSDSPG..LGRVDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEV..K.CAH...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKAEEi..sRKHKH................NCFCIQ................................................................
A0A090N3T5_OSTTA/66-215              ......................................tckskraheafaregsa-----....------.PGRG-.....KGMTF.........................C.DAHRAK...............................TC....CGRAQTDA..VRAKVVH...MQ.------..L........N..G..F...SE..........TCR.DAW...AAV..E.CSV...-CDG.RVGTA....--D...........................................----..---.GTP..IC....AS....ACDALYGACRND.....FFSE...D...GA.....QR.L.VP..........................CRPGD..VIC--..T..KLS........EWIGDVK.DK..GAE.MC......SA----.-----....-----................------agwdpvkpger.....................................................
HHIP_HUMAN/38-220                    .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
#=GR HHIP_HUMAN/38-220         SS    .......................................................XXXXX....XXXXXX.XXXXX.....XXXXXXXXXX...............XXXXXX.XXXXXX..............................XXX....XXXXXXXX..XXXXXXX...XX.X-----..-........X..X..X...XX..........XXX.XXX...XXX..X.XXX...-XXX.XXXXX....XXXX........................................XXXXXX..XXX.XXX.XXX....XX....XXXXXXXXXXXX.....XXX-...-...-X.....XX.X.XX..........................XXXXX.XXXXXX..X..XXXX.....XXXXXXXXX.XX..XXX.XX......XXXXXX.XXXXXX..XXXXX-................-BBEEE................................................................
A0A3P8UW36_CYNSE/30-191              ............................................qcldfkppfka-----....------.----H.....KQLEF.........................C.AMYKDF...............................GC....CDYHRDQQ..LMTEFYR..iMN.NFD---..-........Y..Y..G...HA..........NCA.GFV...MEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PD....YCFKFWDRCKET.....IPLL...S...ED.....--.-.--..........................--SFI..SKI-K..V..NRT........DFCQHVE.PD..DMD.YCy....pHLLSNQ.NLNMNl..gKVQSN................SDGCLQ................................................................
M3XV43_MUSPF/2-158                   ..............................................rppfrppqp-----....------.-----.....--LRF.........................C.AQYSAF...............................GC....CTPEQDAA..LAGRFGA...LAaRV----..D........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKFC--..-..---........-------.--..---.--......------.-----....-----................------rylslddvdycfpyllvnenlnsnlgrvvadakgclq...........................
A0A3Q3KT30_9TELE/57-219              ..........................................qcldfeppfklqw-----....------.-----.....-HLEF.........................C.TQYEQF...............................GC....CDQKTDNM..IAERYWG..iID.QLE---..-........A..A..G...YE..........LCL.DML...KEI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FG....YCSEFHGKCQHV.....VKYL...T...--.....EN.K.LL..........................LDSSE..KDV--..S..TFC........RMVDL--.-S..DQD.YCy....pNVLESP.DLNSNl..gQVLKD................PRGCLQ................................................................
A0A1U8BVG3_MESAU/28-189              ....................................................qcl-----....DFRPPF.RPPQP.....LSF--.........................C.VQYSSF...............................GC....CTAEQDAA..LARRFRA...LE.T---RL..D........A..G..M...WA..........TCA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LESNR..AKL--..-..--C........RYLS---.LD..DTD.YCf....pSLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2I2YAE8_GORGO/47-123              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------pdchppqslqgdgcq.................................................
A0A1U7SJ35_ALLSI/26-201              .......................................................VCMDA....KHHKTK.PGPEG.....ELHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.RHF...IQD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
A0A2K5U042_MACFA/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q0FMJ2_ALLSI/1-118               ......................................................m-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A0P7UWH9_SCLFO/36-215              .......................................................RCFDG....SLPKRL.KKRER.....RVSLDggg..................spevC.HALYPR..............................vSC....CPTRKAAY..QILQRRD...TR.IF----..-........S..T..N...NT..........ECG.RLL...EEI..K.CA-...RCSP.HSQVL....FHPpt.......................................teDASH..HES.GLP.rLC....HD....YCREFYYTCRGH.....VPEL...-...-F.....QA.D.V-..........................DEFCQ.yYGRRD..S..GLCf.....pdFHRKQTR.GP..ATN.YL......DLEDEN.MENIN....RKHKH................NCYCV-r...............................................................
A0A2I0LYY8_COLLI/21-188              ......................................................g-CLEG....DTHKLE.PSPEP.....KMHE-.........................C.TLYFKX...............................SC....CYADFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....INR...........................................NNTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....STCV...R...NW.....LT.D.WE..........................WDESG.eNIC--..K..NKC........IPYSEMY.AN..GTD.MC......QSMWGQ.SFKVS....---ES................SCLCLQ................................................................
J3KNP7_HUMAN/26-208                  .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A0G4E8A7_VITBC/54-214              ..............................................lcsksmdfa-----....---LDV.PRDRR.....GLLSF.........................C.PEHEAR...............................TC....CQRIHTDR..ILSKLVA..aF-.----GD..E........G..T..A...SD..........LCK.DAT...SRV..W.CAV...-CDG.DVGTE....VKT...........................................----..-RN.RVP.lLC....AS....LCDEWYTSCRDD.....YFSP...A...P-.....--.S.GS..........................AEKLM..PCGPH..H..SVC........SPLQEIT.ST..SDD.FCr....lSGFEVH.-----....-----................------ssrvrdedsilaal..................................................
W2MJ21_PHYPR/33-184                  ..........................................tcrsagvlkfdpe-----....----TH.PMQRT.....KGMEV.........................C.SKYRKS...............................TC....CNATHAHA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ALT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...-G.....GA.G.TL..........................APCYG..NAL--..-..-VC........SPLKSIA.NS..GAD.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
A0A3P8TN64_AMPPE/23-198              .......................................................MCMDA....KHHKEE.PGPEG.....QLYLQ.........................C.APWRDN...............................AC....CKANTTEE..AHNDNSY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...VQD..T.CFY...ECSP.HLGPW....IQLad.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGV..NRCPA..N..TKC........QKWTEVF.PT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGHCMQ................................................................
A0A2K5J2T1_COLAP/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3B4YF19_SERLL/23-198              .......................................................MCMDA....KHHKVE.PGPEG.....KLYLQ.........................C.SPWRDN...............................AC....CTANTTAE..AHNDNSY...LY.NFNWNH..C........G..I..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qsWRKE..RIL.DVP..LC....ME....DCHNWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGV..NKCPE..S..SKC........RKWTEVY.PT..PKS.MC......EQIWSN.SYLYT....THSNS................SGRCMQ................................................................
V4TAS2_9ROSI/29-191                  .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDTAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A0D3AFH3_BRAOL/41-180              ....................................................vcv-----....-ISKKG.KLPKP.....GDLNM.........................C.NAFHGK...............................TR....CSASRMLS..ASLALQN...LA.TH----..-........G..E..A...SK..........DCL.YLF...ELL..E.CS-...----.DVGP-....---...........................................----..---.-LR..IC....AS....FCDRVFEACSDA.....YFST...S...GA.....--.-.-S..........................NQVMV.pCGASN..G..IIC........VKVSKWG.TN..GTA.FC......EAVGFT.VVQ--....-----................------taddsacyg.......................................................
U3DHV8_CALJA/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
D2H3P9_AILME/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9KWZ6_ENHLU/36-216              .......................................................ICMDA....KHHKTK.PGPED.....KLHGQ.........................C.TPWKEK...............................AC....CSVSTSQE..LHKDTSL...LY.NFTWEH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....TQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRTStpartYTCK...N...NW.....HR.G.WD..........................WTSGI..NKCPA..G..TTC........RTFETYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2I0LJU9_COLLI/25-165              .......................................................VCMDA....KHHKTE.PGPEG.....QLYGQ.........................C.SPWRDN...............................AC....CTANTSLE..AHRDQSY...LY.NFNWDH..C........G..A..M...SP..........KCK.RHF...IQD..T.CLY...ECDP.NLGPW....IDQsd.......................................tsWRRE..RIL.HVP..LC....RE....DCEQWWDDCQDS.....ATCK...V...NW.....HK.G.WN..........................WTSGQ..RGA--..-..---........-------.--..---.--......------.-----....-----................------rghphlg.........................................................
A0A0P1A6E2_PLAHL/31-166              ..........................................tcrsagilkfdps-----....----TR.PIQHR.....KRLEV.........................C.SKFQKR...............................TC....CNATHTVA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ELT...EEM..I.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWFDVCKDE.....YYAH...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ggsssltpcygnalvcsplnelnvngiecfdgsv..............................
A0A2I3SDD1_PANTR/59-197              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.--..---.--......------.-----....-----................------vqwrdlssm.......................................................
A0A0E0CMR1_9ORYZ/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A091WNI0_OPIHO/3-129               ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DELCF.yYSRKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A1U7RC80_MESAU/26-200              .......................................................VCMKA....KHHKQE.PGPED.....KLFLE.........................C.SPWKDN...............................AC....CTFSTSWE..AHLDELS...SF.NFSMMH..C........G..L..L...TP..........GCH.KHF...IQA..V.CLH...ECSP.NLGPW....IQLvv.......................................pnRQEE..RVW.RVP..LC....WE....DCEEWWEDCSSS.....YTCK...S...DW.....LS.G.P-..........................DSSRE..KSCPV..P..APC........RPFSDYF.PT..PAD.LC......EKIWSN.TFKAS....PERRN................SGRCLQ................................................................
A0A1D1UWU8_RAMVA/1-120               ....................................................mqp-----....------.-----.....-DLRN.........................C.TWYRER...............................SC....CRQAELES..IFKKVKP...LQ.------..-........-..G..A...SE..........NCM.RHL...NYM..I.CWV...-CDP.LQYNF....YSN...........................................----..GWR.RLK..MC....AS....FCDAVLNACKDA.....KLKG...-...-D.....YV.G.VL..........................YPTGA..EFC--..-..---........-------.--..---.--......------.-----....-----................------ksrrfdvalndkdcfsyng.............................................
A0A2K5PVM9_CEBCA/26-208              .......................................................TCMDA....KHHKGR.PGPED.....KLYDE.........................C.IPWKDN...............................AC....CTFRTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weaapsGQGE..RVV.NAP..LC....QE....DCGEWWEDCRTS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A3Q4MBA7_NEOBR/4-188               ..............................ccsikkfkllkimpncktlsnktsv-----....------.-----.....TLLCF.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....ITCK...D...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDFF.PT..PKS.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A2K6RR38_RHIRO/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3VSB5_9TELE/35-196              ..............................................qcldfkppf-----....------.--RPD.....RDLEF.........................C.IMYQEF...............................GC....CDRQKDQE..LMARYYR..iME.NFT---..-........E..R..G...HK..........SCA.GFV...LEL..L.C-Q...ECSP.FAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNQCRSI.....IPFL...S...DY.....TP.L.--..........................-----..NQA-K..D..DQN........RFCKLLE.LD..DAD.YCy....pHLLSNH.KLNQNl..gRVQKD................SDGCLQ................................................................
D4A4S5_RAT/29-204                    .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKRN...............................AC....CSVNTSQE..LHKDNSR...LY.NFNWDH..C........G..E..M...TP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IQQag.......................................qsWRKE..RFL.DVP..LC....KE....DCQEWWEACRTS.....FTCK...R...DW.....HK.G.WD..........................WTSGI..NKCPD..T..APC........RTFQYYF.PT..PAS.LC......EGLWSH.SYKVS....NYSRG................SGQCIQ................................................................
A0A452ST55_URSAM/1-159               ...................................................alpg-----....------.-----.....-----.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A452HZQ9_9SAUR/33-208              .......................................................MCMDA....KHHKTE.PGPEE.....ALHGQ.........................C.VLWKDN...............................AC....CTANTSTE..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCQDA.....ITCK...E...NW.....HK.G.WN..........................WTSGT..NRCPR..G..FMC........QPFKYVF.PR..PAD.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
G3TSN2_LOXAF/26-201                  .......................................................VCMNT....KHHKTE.PSPED.....KLYEE.........................C.TPWKDN...............................AC....CTANTSWE..AHLDMSL...LY.NFSLTH..C........G..L..L...TP..........SCQ.KHF...IQA..F.CFY...ECSP.NLGPW....IQQvd.......................................prGQEE..GIV.GVP..LC....WE....DCEQWWDDCRSS.....YTCK...S...NW.....QG.G.WD..........................WRRGK..VRCPA..G..AHC........LPFPDYF.PT..PAD.LC......DKIWSN.SYKAS....PERRS................SGRCMQ................................................................
F7CR90_MACMU/47-222                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
H2QFH1_PANTR/59-215                  ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
F5H4Z6_HUMAN/30-171                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RT-----.--..---.--......------.-----....-----................------................................................................
H2Q4K3_PANTR/26-208                  .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A383ZAP8_BALAS/44-203              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYETF...............................GC....CDQRKDHR..IAARYWD..iME.YFD---..-........L..K..G...HE..........RCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....RR.L.QE..........................-----..--SHD..K..DGA........RFCHLLN.VP..DKD.YC......------.-----....-----................------fpnvlrsdhlnrnlgvvaedprgclq......................................
A0A2K5WWK8_MACFA/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRVD---..-........T..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
H3CCK2_TETNG/24-200                  .......................................................MCMDA....KHHKTV.PGPEG.....QLYLQ.........................C.APWKEN...............................AC....CTANTSAE..AHEDNSY...LY.NFNWNH..C........G..A..M...SN..........RCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQEva......................................nhnWRKE..RIV.DVP..LS....QE....DCHDWWEDCKKE.....FTCK...S...NW.....HT.G.WD..........................WSSGI..NKCPA..D..KKC........RKWTDVY.PT..PKD.MC......EQIWSN.SYAYT....SYSKA................SGRCMQ................................................................
A0A445BKX0_ARAHY/45-206              .....................................vcvsqggrfpafksegyp-----....------.PRKGP.....KDLTL.........................C.RVFHKI...............................TC....CDISHTHP..ALLAVRK...LA.ST----..-........G..E..A...GH..........ECL.HLW...EML..E.CAI...-CDP.HVG--....TQP...........................................----..---.GPP.lIC....AS....FCERIYKACSNA.....YFSM...-...DV.....KT.Q.LL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VAA---.-----....-----................------gfrvkpsdmihaaseetlcyg...........................................
V3YZA4_LOTGI/28-191                  ................................................qcldfkp-----....----PF.KPKTN.....HD--F.........................C.NQYSNF...............................GC....CSKSKDDN..IQNTFNS...LR.SL---V..S........E..G..T...WN..........KCQ.GTL...KDL..M.C-Q...ECSP.YAAHI....YGV...........................................EDTM..GDN.PFP.gLC....KN....YCETLFDSGCME.....ITKL...I...DV.....--.-.-N..........................I---T..AKVDL..N..DKT........KFCNHVK.LS..DVD.YCypellqNDMLNG.NISNV....QITSK................GCL---cle.............................................................
G1KAA7_ANOCA/44-206                  ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYETF...............................GC....CDQDKDNT..IAAKYWE...IM.DYV---..D........P..Q..A...YK..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHLYCRSA.....ITLL...-...--.....--.-.-T..........................DDKNI..QECCE..K..NKT........RFCNFLN.IQ..DED.YCf....pDVLKNT.DLNRNl..gSVVAD................RKGCL-q...............................................................
A0A3B3HVB9_ORYLA/28-206              .......................................................ACLQD....GKHKAK.PSPEP.....YLTE-.........................C.GLYADN...............................SC....CTSDDIQD..ISHVPSV..sNK.NEPWDK..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..HNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPQeqgeag...esevegrP-----cgclt...........................................................
A0A340XV58_LIPVE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1S3JE46_LINUN/5-93                ..................................................geypy-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................--SD..RFN.KLP..VC....AS....QCDKWWNACKED.....YTCH...K...NW.....FT.D.PA..........................WDGNG.mNICPK..D..AVC........KKYTEVY.TS..AAD.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A3S1A7A7_ELYCH/1-138               .......................................................-----....------.-----.....-----.........................-.------...............................--....CSSVNDQR..LQDEYNY...I-.--RSKA..N........S..R..L...WG..........RCE.GFV...KEI..L.C-Q...RCSP.HAADI....YGA...........................................GTSS..EPR.SFP.gLC....RG....YCNEFYDKCRSF.....LWFL...D...PQ.....LA.G.SQ..........................ILSTK.tKFC--..-..---........---NSVS.LD..DSS.YC......------.-----....-----................------ypdvktnypevaddtqgqvtaapgclclq...................................
C6T7F8_SOYBN/40-203                  ...........................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
A0A3B3T0T9_9TELE/34-162              .............................................qcldfkppfr-----....------.-P--Q.....EELTF.........................C.LMYKDF...............................GC....CDTEKDQE..LMTKFYR..iMD.NFD---..-........N..Y..G...YA..........TCA.SYV...QDL..I.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TLP.gLC....RD....YCANFWTRCGAT.....I---...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------pflssdsrlaaaerdqvrfcellg........................................
A0A2K5QH49_CEBCA/34-199              ...................................................rnyf-----....KLKKTT.HQTES.....HLLSQ.........................C.HPWREN...............................AC....CSTNTSQE..AHKDISY...LY.NFNWNH..W........R..E..M...AP..........AYK.RHF...IQD..T.CLY...ECSP.NLD-W....-HK...........................................---E..RVL.DVP..LC....KE....DCEQWWKDCGTS.....YTCK...S...NW.....HK.G.WN..........................WTSGS..NKCPV..E..AAC........LPFHFYF.PT..PTA.LC......NEIWSH.SFKVS....NYRRG................SGRCIQ................................................................
A0A340Y7G3_LIPVE/27-183              ......................................................a-C---....GGSHPL.PARSQ.....RHHRL.........................A.TNLGTSqlh.........................lagPS....CLSEMNTP..EASDPGI...VS.----GR..C........G..V..L...SP..........GCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESA.....IIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A3B4FST5_9CICH/21-183              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gIC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SMV---D.LP..DQD.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
A0A2K5WWK3_MACFA/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRVD---..-........T..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A3B3IIT4_ORYLA/37-218              .......................................................RCYDG....SLPKRL.KKRER.....KVLHDggsss..............snsgelC.HMLYSR..............................vSC....CPTRRAAY..QI-----...LH.RMDARI..F........S..T..N...NT..........ECA.HLL...DEI..K.CA-...RCSP.NAQVL....FHSld.......................................idRQPH..REP.DLP.rLC....LD....FCHKFYYTCRGH.....IPEL...-...-F.....QA.D.V-..........................DEFCQ.yYGRRG..A..GLCf.....pdFQRRQLL.GQ..DSN.YL......EDEKID.GLNRR....--HKH................NCYCA-q...............................................................
A0A2Y9KUE2_ENHLU/13-188              .......................................................VCMDA....KHHKAK.PGPED.....KLHGQ.........................C.TPWKEK...............................AC....CSVSTSQE..LHKDTSL...LY.NFTWEH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRTS.....YTCK...N...NW.....QR.G.WD..........................WTSGI..NKCPA..G..TTC........RTFETYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2K6KIA1_RHIBE/47-110              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrt...........................................................
A0A2K6MFR4_RHIBE/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrnlgmvaqdprgclq......................................
A0A2K6UA21_SAIBB/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CTANTSRE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RSFEFYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q1M762_BOVIN/201-256             ...............................................gyrssilp-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................--TGY..NQCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A1S3JE36_LINUN/50-146              .........................................enhvwelmyehpdf-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................---D..HLD.QAP..IC....AS....QCEEWWDACKEE.....YTCH...R...NW.....IT.D.MD..........................WGGEE.iNSCKE..G..SVC........KKYKEFY.SS..AAD.FC......NTIWHN.AYKVV....---PD................SEPCM-v...............................................................
A0A2R9ABR9_PANPA/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I3RVZ9_PANTR/47-201              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WT---..-----..-..---........-------.--..SAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
M4FHF9_BRARP/205-369                 .......................................vcvskggrshqpyele-----....-----G.KLPESadlefRDLNM.........................C.SMFHEK...............................TC....CSASRMLS..SSLALQN...LA.TH----..-........G..E..A...SK..........DCL.FWF...ELL..E.CSI...-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSDA.....YFNT...S...DS.....TN.Q.VI..........................V---P..CVASN..D..TIC........EKASKLE.TN..GTA.FC......EAV---.-----....-----................------gftvvqpagdsveepcyg..............................................
A0A3B4X2Y0_SERLL/37-209              ..............................................schpqcldy-----....--KPPF.EPRQP.....LVF--.........................C.KEYSKF...............................GC....CDLEKDEE..VSAKFYT..iME.NF--DH..S........G..-..-...FA..........TCG.KYI...RTI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....RD....YCSNYWHQCRYT.....LSL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llentgspqqfanltaaieddrrrfcdylelkdiqycypnvltnaelnanlglvredpkgcl..
A0A3Q2H8S4_HORSE/29-160              .......................................................VCMNT....QHHKRE.PGPED.....KLHKE.........................C.IPWKDS...............................AC....CTANTSWK..AHLNVSL...LY.NFSLVH..C........G..L..M...MP..........GCQ.RHF...IQA..V.CFY...ECSP.NLGPW....IQQvd.......................................lsGQGE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSG--..-----..-..---........-------.--..---.--......------.-----....-----................------gew.............................................................
A0A2R6RGD4_ACTCH/41-190              ...........................................fasegkpprkvs-----....------.--KGL.....KDLTL.........................C.RLFRKK...............................TC....CDVAQTHL..ALLSVRR...LA.V-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.HVG--....VQP...........................................----..---.GPP.lIC....ES....LCNRVYKACSNA.....YFSM...-...DV.....KT.Q.VL..........................A----..PCGAS..D..FVC........GSLSEWT.SN..GSE.LC......RAA-GF.SVQSS....H-DVQ................ETSC--yg..............................................................
A0A4D9DVA7_9SAUR/26-226              .......................................................MCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.APWKDN...............................AC....CTAETSTG..AHQDQSY...LY.DFNWNH..C........G..A..M...PE..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCKDA.....ITCK...E...NW.....HK.G.WNwtsardgegwle.gvqpqlahcrplsPSPGT..NRCPR..G..FIC........QPFKYVF.PR..PGD.LC......EKIWSN.SYKYT....TEHRG................GGRCIQ................................................................
A0A2I3MYB7_PAPAN/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............agemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6NI78_RHIRO/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A1V4J5R4_PATFA/108-283             .......................................................VCMDA....KHHKTT.PGPEG.....LLYKQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSS...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..M.CLY...ECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDA.....VTCK...D...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSEVF.PH..PKD.LC......EKIWSN.SFKYT....TERRG................SGRCIQ................................................................
A0A1A6FXD0_NEOLE/1-103               ....................................................lls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.-LQ...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LESNR..AKL--..-..--C........RYLS---.LD..DTD.YCf....pSLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2I3LNK9_PAPAN/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.VQ..WHN.LC......S-----.-----....-----................------lq..............................................................
K7EB72_ORNAN/22-189                  .......................................................TCLPG....KYHKPS.PGPEP.....NMKA-.........................C.TLYLKN...............................SC....CPANFTEL..LAQSPVI..gVS.DTYWNR..C........G..T..L...SK..........KCE.EYM...KKL..E.CFY...QCSP.AAAHW....KDP...........................................KNNL..GMK.FVP..LC....QN....FCDDWFEACKLD.....HTCS...R...DW.....LT.D.WA..........................VDEKG.kKIC--..Q..SQC........LPYSEVY.KN..GTD.LC......ESMWGQ.SFRAI....---SR................SCRCL-e...............................................................
A0A3B3SB10_9TELE/32-203              .......................................................ACLQD....GKHKAT.PSPEP.....YLRD-.........................C.TLYAEN...............................AC....CSENDIQV..PTASSGR..lVQ.DLFWDG..C........G..P..V...SQ..........GCR.AFL...KRV..A.CFH...LCSP.DIARW....PHP...........................................RLPG..SFQ.GVP..LC....HS....FCRDWFDACKVD.....RMCS...G...D-.....-E.G.W-..........................-LSQR..NNC--..T..GDC........VTYQQMY.QD..GRG.LC......GHIGAG.SFTPV...eDDDREee...........nspSCGCL-t...............................................................
L9LDL7_TUPCH/163-317                 ......................................................e-----....------.-----.....-----.........................-.SPWKNN...............................AC....CSINTSHE..AHRNISY...LY.NFNWDH..C........G..K..M...EP..........ACK.QHF...IQD..T.CLY...ECSP.NLGPW....IQKvd.......................................qsWRRE..RIL.NVP..LC....KE....DCERWWEDCRSS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NTCPV..K..EAC........HPFPFYF.PT..PAH.LC......NEIWTH.SYKVS....NYSRG................SGR---wiq.............................................................
F1STK4_PIG/26-201                    .......................................................ICMNA....KPHKPE.PSPED.....KLYEE.........................C.IPWKHN...............................AC....CTADTSWE..AHLDVAL...LY.NFSLVH..C........G..L..M...MP..........GCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQQtd.......................................phGQAE..RIL.DAP..LC....QE....DCEEWWADCRTS.....YTCK...S...NW.....LG.G.WT..........................WSRGK..HRCPA..R..ALC........HPFPHYF.PT..PAD.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
A0A2I0VYK1_9ASPA/46-197              ...............................................ltegkppr-----....-----K.VTKGP.....RDLAV.........................C.RVFRQN...............................TC....CDVVQTYR..VLEFVRR...LA.SF----..-........G..E..A...SQ..........ECL.HAW...ELL..E.CSV...-CDP.LIG--....VQP...........................................----..---.GPP.lIC....AS....FCNMILQDCSSA.....YFSI...D...PR.....-N.K.VL..........................S---P..CGL-G..D..IIC........GRASEWA.SN..GTE.LC......HLA---.-----....-----................------gfavkqdvfgnhdvdkqycy............................................
A0A091JJM0_EGRGA/3-129               ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCY.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A0R3UJB2_9CEST/36-228              ......................................................i-CQES....EHRKER.PTPEY.....GLTS-.........................C.TAWKEN...............................SC....CTAATATM..ILSNNMH...--.GFNYHV..C........G..N..L...SK..........ACH.DFF...NDE..H.CFV...KCSP.NLGPW....LVKls.......................................ssRFKE..RAF.RVP..LC....ES....DCKSWYDACKDD.....LTCA...M...NW.....RS.G.GFdwgsgrs............clksktrLDECE..NACRK..G..FHC........LKISEIY.RS..AVS.FC......ERVWDH.AYTVV....PDTPV................------gnwtskephcmh....................................................
C3YF31_BRAFL/56-188                  ...................................................ycsl-----....-FTNRA.PHPEH.....KLVK-.........................C.SWFHND...............................AC....CYQEEVDR..IFPTVVP...-P.------..-........R..G..A...NQ..........NCT.DHL...YYL..M.C-Y...ICSP.RQHLF....YRD...........................................----..--E.VVT..IC....EE....LCNRLFEACANA.....TLKG...Q...RI.....GE.Q.Y-..........................-SSGR..DYC--..-..---........-------.--..---.--......------.-----....-----................------vsrkfrvdrqssgscyshnfsiv.........................................
A0A1S3KCF9_LINUN/33-205              .......................................................TCMDA....QSHKSK.PGPED.....SLHAE.........................C.TPWKNR...............................AC....CHKKTTEE..LHQNA-T...WY.KFTWGH..C........E..P..L...SD..........MCK.RYF...VRD..L.CFY...ECSP.NVGPW...lVQEs........................................rtWRKE..RMY.HAP..LC....ET....DCNTWYNECKNE.....KTCL...D...NW....sNG.G.FN..........................FSSGV..NTCPT..G..KPC........KPFHEIF.GN..ATN.FC......ETIWDG.SWKVT....---PD................DKPCM-k...............................................................
A0A1V4JX64_PATFA/158-325             ......................................................g-CLEG....DTHKLK.PSPEP.....KMHE-.........................C.TLYSKS...............................SC....CHADFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....INR...........................................NNAA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....STCV...R...NW.....LT.D.WE..........................WDESG.eNIC--..K..NKC........IPYSEMY.AN..GTD.MC......QNMWGQ.SFKVS....---ES................SCLCLQ................................................................
H2M6E9_ORYLA/23-198                  .......................................................MCMDA....KHHKVE.PGPEG.....QLYSQ.........................C.SPWREN...............................AC....CTANTSEE..AHNDNSY...LY.KFNWNH..C........G..A..M...SD..........ACK.KHF...IQD..T.CFY...ECSP.HLGPW....IQEad.......................................qsWRKE..RII.DVP..LC....KE....DCESWWSDCKND.....TTCK...T...DW.....HK.G.WD..........................WSSGT..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EQIWSQ.SYVYT....TYTKS................SGRCMQ................................................................
A0A087XS24_POEFO/23-198              .......................................................MCMNA....KHHKVE.PGPEG.....ALHRQ.........................C.APWREN...............................AC....CTANTSEE..AHNDNSY...LY.YFNWNH..C........G..A..M...SS..........KCK.QHF...IQD..T.CFY...ECSP.HLGPW....IQSad.......................................enWRKE..RIL.NVP..LC....KE....DCEQWWEDCKDD.....FTCK...T...NW.....HE.G.WD..........................WSSGT..NKCPA..G..SQC........RKWTDVY.PT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A091CNE7_FUKDA/43-193              ...................................................acgg-----....--SHPP.QARSQ.....SGHGL.........................A.AEPGTE...............................QL....HLEKVDRP..QAWGPGA...--.--APER..C........G..T..L...SP..........RCR.SFL...GHL..Q.RVL...HHRL.RLLLL...gLR-...........................................----..---.GAP.sLC....AE....LCEAWFTNCKAD.....ITC-...-...--.....GP.T.WP..........................PTSED..RGC--..A..PSC........PTYGQTF.SD..GVD.LC......RSVFGD.ALPVA....--APG................SCHCLN................................................................
L8GFZ8_ACACA/320-468                 ......................................................k-CLVP....KTNRRA.QRPEP.....QLKR-.........................C.KWYNEK...............................AC....CTADKDRS..VDQWMAK..aI-.----NP..L........F..K..H...KP..........NCQ.ALF...EDL..W.CGY...ECSP.HRPHF....LDP..........................................yDTIN..EEQ.GMR..IC....SS....FCKSLYGECKDT.....PIMG...L...T-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------iravyarhqdfcmantpnnflrvtvtdthcfngtkae...........................
U3JIW3_FICAL/7-168                   ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYAEF...............................GC....CDPRRDRA..LLQRFYR...LS.---AGL..D........E..R..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCVQVWQNCRSI.....FRSL...S...AD.....PE.L.IA..........................LENNV.aKF---..-..--C........RYLS---.LE..DTD.YCf....pQLLANQ.NLNQNl..gRVTAD................AEGCL-q...............................................................
F7CGN2_XENTR/29-204                  .......................................................VCMDG....KHQKVE.PGKED.....ALHGQ.........................C.TPWKDK...............................SC....CTANTSQE..AHNDQSY...LY.NFNWDH..C........G..I..M...AP..........ACK.THF...IQD..T.CFY...ECSP.NLGPW....IQKvd.......................................ssWRKE..RIL.DVP..LC....RE....DCDGWYNDCKLE.....YTCM...E...NW.....HK.G.WN..........................WTSGT..NQCPN..G..TKC........RRVFEVF.PS..AAD.FC......EKIWSN.SYKYS....DERRG................SGRCMQ................................................................
A0A1S3BYL2_CUCME/33-190              .......................................vcisqggrfapfsseg-----....--KPPS.KVSKA.....QDLTL.........................C.RVFRKR...............................TC....CGVAQTHP..ALLSVRK...LA.S-----..A........G..E..A...NH..........ECL.QLW...ELL..E.CSI...-CDP.QVG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVFKACSDA.....YFSV...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRASKWV.SN..GTD.LC......NAA-GF.SVKIS....-----................------deetscyg........................................................
A0A3Q1MRP4_BOVIN/30-205              .......................................................VCMNA....RYHKEK.PGPED.....KLHGQ.........................C.SPWKKN...............................AC....CFVNTSIE..AHKDISS...LY.RFDWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IREvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
G1LGF8_AILME/44-124                  .......................................................VCMDA....KHHKAK.PGPED.....KLHDQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACA.T--...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ssrttvstsahptwgpgs..............................................
A0A1R3JTK2_COCAP/42-205              ....................................vcisqggrfppfssegkpp-----....----KK.VGKGQ.....KDLTL.........................C.RLFRKR...............................TC....CDAAQTYP..ALLSIRR...LT.V-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACSTA.....YFSM...D...AK.....TQ.A.L-..........................A----..PCGAS..D..FVC........GRASEWV.SN..GTE.LC......RAA---.-----....-----................------gflveqtdvmrngvedrfcy............................................
G1LY46_AILME/1-102                   ....................................................lsl-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.--Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
H3CIM9_TETNG/5-160                   .............................................qcldfkppfr-----....------.---PS.....RELEL.........................C.VMYSDF...............................GC....CDYQKDQE..LLAKYYR..iMD.NFD---..-........Y..D..G...YS..........RCA.GFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDAQT..PVR.TLP.gLC....PD....YCEEFWSKCDST.....IPL-...-...--.....LS.G.-K..........................PDVGS..YHC--..-..---........---QDLV.LD..DAD.YCy....pRLLSNK.KLNQNl..gRVQAS................SDGCL-q...............................................................
A0A2K6AU50_MACNE/42-217              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A124SAH4_CYNCS/279-427             .............................................siqgkpprrv-----....------.-SKGP.....NDLTL.........................C.RVFRKK...............................TC....CDVTQTHP..ALLSIRR...LA.S-----..T........G..E..A...TD..........ECL.HLW...ELL..E.CSI...-CDP.HVG--....VQA...........................................----..---.GSP.iVC....AS....LCDRIYGACSNA.....YFAM...D...AK.....N-.-.--..........................QVLAP..CGM-S..D..TVC........GRASEWV.SN..GTE.LC......KAS-GF.SV---....-----................------kpsndfketfcyg...................................................
A0A2Y9E1U1_TRIMA/26-201              .......................................................VCMNT....KHHKRE.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLEESL...LY.NFSLTH..C........G..L..L...TP..........SCQ.KHF...IQA..F.CFY...ECSP.NLGPW....IRQvd.......................................prGQGQ..RIV.GVP..LC....RE....DCEQWWADCRSS.....YTCK...S...NW.....QG.G.WD..........................WSRGK..NRCPA..G..AHC........LPFPDYF.PT..PAD.LC......EKIWSN.SYKAS....PERRG................SGRCIQ................................................................
A0A3Q2CIF1_CYPVA/60-221              ............................................cldfappfkpq-----....------.-----.....WHLEF.........................C.SQYEDF...............................GC....CDQRTDNV..IAERYWD...II.EL-LE-..-........A..A..G...YD..........LCE.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHSKCRHV.....LKYL...T...E-.....-N.Q.LL..........................LDTSG..RDM--..T..TFC........SLID---.LS..DQD.YCy....pNVLKST.DLNSNl..gQVVED................PRGCL-q...............................................................
A0A2K5D9K7_AOTNA/47-201              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CTADTSQE..LHKDTSR...LY.NFNWEH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WT---..-----..-..---........-------.--..SAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I0J249_PUNGR/24-199              ...................................vcvskggrfppyssegrppr-----....-----K.VSKGP.....KDLTL.........................C.RVFRRK...............................TC....CDVAQTHA..ALVTVRK...LA.L-----..T........G..D..A...TD..........ECV.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.rIC....AS....FCDRVFQACSSA.....YFST...D...AI.....-T.Q.GE..........................SPQCS.eRRRRY..P..PVAillpvmsiGWATEWV.SN..GTD.LC......QAA---.-----....-----................------gfavkvplypgeeetscyg.............................................
J9NX36_CANLF/1-147                   .......................................................-----....------.-----.....----Q.........................C.SPWK-N...............................SC....CFANTSQE..AH-----...KY.RFNWNH..C........G..S..M...TP..........ACK.KHF...IQD..T.W--...-CSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....RE....DCEQWWQDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPE..G..AAC........HPFHFYF.PT..SAA.LC......SEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
G3Q9Q0_GASAC/1-143                   ......................................................m-----....------.-----.....-----.........................-.--YKEF...............................GC....CDYQRDQE..LMANYYH...VM.---GGS..D........Y..S..G...YV..........RCA.GFV...LEL..L.C-Q...QCSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSEFWKKCSST.....IPLL...S...ND.....--.T.-L..........................IAK--..--L-K..E..DQT........RLCQYLK.LD..DDD.YCy....pHLLSNQ.KLTQNl..gTVQSD................SEGCLQ................................................................
G1TPC2_RABIT/10-130                  ............................................alaarveaalw-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TLP.gLC....QD....YCQDMWHTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNQ.aKFC--..-..---........RYLS---.LD..DVD.YCf....pR-----.-----....-----................------llvnqnlnsnlgrvvadargclq.........................................
G3WWL1_SARHA/29-194                  ..................................sahpqcldfkppfrpprplpf-----....------.-----.....-----.........................C.EQDSAF...............................GC....CDAEQDAA..LSRRYWA..vTS.RLE---..-........P..D..T...FA..........VCA.AYV...RGL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCVDVWHNCRTI.....FRHL...S...PD.....PE.L.WA..........................LETNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A383ZEX0_BALAS/30-205              .......................................................VCMDA....KHHKIK.PGPED.....KLHDQ.........................C.IPWKKN...............................AC....CSAKVSQE..LHRDTSS...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....QK.G.WN..........................WTSGS..NKCPT..G..TTC........GTFEFYF.PT..PAA.LC......EGLWSH.SYKLS....NYSQG................SGRCIQ................................................................
A0A099YZJ2_TINGU/4-129               .....................................................sv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.ALP.yLC....KD....YCKELYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..nRKHKH................NCFCIQ................................................................
W5NUZ8_SHEEP/20-195                  .......................................................VCMNA....KPHKPK.PSPEA.....ELYEE.........................C.IPWKDN...............................AC....CTASTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.RHF...LQA..I.CFY...QCSP.NLGPW....IQKvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRTS.....HTCK...S...NW.....LG.S.WA..........................WSRGK..PRCPE..R..APC........RPFPHYF.PT..PAN.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A1S3F111_DIPOR/29-204              .......................................................ACLDA....KHHKTK.PGPED.....KLHEQ.........................C.SPWRRN...............................SC....CSFNTTQE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.CHF...IQD..S.CLY...ECSP.NLGPW....IQEvn.......................................qnWRKE..RFL.DVP..LC....KE....DCQRWWEDCRTS.....STCK...T...NW.....HK.G.WD..........................WSSGV..NKCPA..K..AVC........HTFEFYF.PT..PAS.FC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A2Y9F7K9_PHYMC/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A401PDB6_SCYTO/37-133              ................................................klykqvd-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....--Q..........................................tWRNE..RIM.HVP..IC....KT....DCEEWWADCRED.....HTCK...V...NW.....HK.G.WD..........................WSSGI..NKCPT..N..SKC........QKFSQVF.PT..PQD.LC......EKLWSN.SYQYT....QHDRG................SGECI-v...............................................................
A0A2K6U9X6_SAIBB/1-174               .......................................................--MDA....KHHKAQ.PGXED.....NLYGQ.........................C.SPWRKN...............................AC....CTANTSRE..LHKDTSR...LY.NFNWDH..C........G..R..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RSFEFYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
H0YWX7_TAEGU/34-216                  .......................................................RCLNG....TPPRRL.KKRDR.....RVLSPeapg................ggeamC.RGLYPR..............................lSC....CSRSEAQG..LPHAEAK..vLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.AA..........................DEFCY.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A3P9Q3Q5_POERE/23-198              .......................................................MCMDA....KHHKVE.PGPEG.....ALHRQ.........................C.APWREN...............................AC....CTANTSEE..AHNDNSY...LY.YFNWNH..C........G..A..M...SS..........KCK.QHL...IQD..T.CFY...ECSP.HLGPW....IQSad.......................................enWRKE..RIL.NVP..LC....KE....DCEQWWEDCKDD.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPA..G..SHC........RKWTDVY.AT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A0D9VHR3_9ORYZ/41-193              .........................................fssegkppgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRH...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqaldsssgglddtfcy............................................
A0A329S9C2_9STRA/33-184              ..........................................tcrsagvlkfepe-----....----TH.PMQRT.....KGMEV.........................C.SKYRKS...............................TC....CNATHAHA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ALT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...-G.....GA.G.TL..........................APCYG..NAL--..-..-VC........SPLKSIA.KS..GSD.FC......VHMGFH.VGGVA....-----................------daegidcfd.......................................................
A0A2K6Q6I5_RHIRO/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGTGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAR.VQ..WHH.LC......S-----.-----....-----................------lq..............................................................
A0A093Q978_9PASS/1-139               .......................................................-----....------.-----.....----Q.........................C.VLWKDN...............................AC....CTANTSQE..AHEDQSY...LY.NFNWDH..C........G..A..M...PQ..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ntWRKE..RIR.DVP..LC....QE....DCEQWWEDCQDA.....VTCK...V...NW.....HK.G.WN..........................WTSGT..NQCPQ..G..AMC........QKFKFVF.PT..AAA.PC......ETIW--.-----....-----................------a...............................................................
A0A1S3JP76_LINUN/35-178              ..................................................tctyy-----....-GGTHV.PSPEN.....GLVN-.........................C.SWYSTN...............................AC....CKRTEVTS..VFGGMYK...LA.------..-........-..R..A...SK..........KCQ.NRV...NYL..M.C-Y...FCSP.EQHLW....YQD...........................................----..---.QLH..VC....AD....FCDSIHFYCKTA.....MFSG...E...KI.....GT.S.YKngk....................eicEGQKF..KYVES..N..TNC........FKFD---.--..---.--......------.-----....-----................------ptvfdtgcslksslit................................................
W5P1W2_SHEEP/35-210                  .......................................................VCMDA....KHHKAK.PGPED.....SLHEQ.........................C.SPWRKN...............................AC....CSVNTSIE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IREvn.......................................qkWRKE..RVL.GVP..LC....KE....DCQIWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WSAGY..NQCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A226MGQ3_CALSU/59-234              .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSY...LY.NFNWNH..C........G..V..M...PS..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFTQVF.PR..PKD.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A2K6GD42_PROCO/36-211              .......................................................VCMDA....KHHKEK.PGPED.....NLHEQ.........................C.TPWKKN...............................AC....CTADTSEE..AHKDISN...LY.RFNWDH..C........G..K..M...AP..........ACK.RHF...IQD..T.CFY...ECSP.NLGPW....IKQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRSS.....YTCK...G...NW.....HK.G.WN..........................WTSGY..NQCPV..K..AAC........HPFPFYF.PT..PAD.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2U9CRZ8_SCOMX/28-203              .......................................................MCLQD....GKHKAA.PGPEP.....HLRD-.........................C.ALYADN...............................SC....CTDEDIQD..ISHVPSA..sNK.NEPWDK..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GSC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPEdggea......gdggrPCGCL-t...............................................................
A0A2T7F8G7_9POAL/45-196              ..............................................fssegkppg-----....------.RAPKG....rRDLAL.........................C.RIFRQN...............................TC....CDLTQTFP..ALISVRN...LA.L-----..T........G..E..G...SQ..........ECI.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.aIC....AS....FCDMVFKACSES.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......HLA-GF.S----....-----................------vqvsgtssglvddifc................................................
H3ASX4_LATCH/39-187                  .............................................qcldfkppfk-----....------.--PQ-.....KELAF.........................C.VMHKDF...............................GC....CDSLKDAA..LITRFYS..iVE.HLD---..-........T..E..R...YA..........TCA.GYV...QDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPTT..PMR.TIP.gLC....KD....YCSVLWQKCRPI.....FGL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------isedshlatlennveklcdylaledldycfphllsnekltqn......................
A0A1D5QAK3_MACMU/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRVD---..-........T..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....--.-.--..........................--QEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A340XVA8_LIPVE/30-205              .......................................................VCMDA....KHHKIK.PGPED.....KLHDQ.........................C.IPWKKN...............................AC....CSAKVSQE..LHRDTSS...LY.NFNWEH..C........G..K..M...KP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQNWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGS..NKCPT..G..ATC........GTFEFYF.PT..PAA.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A078GMG4_BRANA/3-101               ................................savqnlstygeapkdclylfell-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................---E..CSK.TLP..IC....AS....FCDRVFEACSDA.....YFTS...D...AS.....--.-.--..........................DQVIV.pCGASE..S..IIC........GKASKWE.TN..GTA.FC......YAL---.GFTVQ....-----................------sadeepcyg.......................................................
A0A226MRY7_COLVI/2-92                ....................................................dss-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................WRRE..RIL.HVP..LC....RE....DCEQWWEDCQDS.....STCK...V...NW.....HK.G.WN..........................WSTGT..NQCPH..G..AMC........QKFKYVF.PT..PAD.LC......EKVWSQ.SYKYT....TERRG................SGRCIQ................................................................
A0A0K9PKS2_ZOSMR/44-193              .........................................segnppgkvakgpr-----....------.-----.....-DLVF.........................C.GVFRKY...............................TC....CDVAQTYP..ALVSVRK...LA.S-----..T........G..Q..A...NH..........ECL.HLW...ELL..E.CSI...-CDP.RVGTQ....IGP...........................................----..---.--P.vIC....TS....FCDSLWKACYDA.....FFSF...D...S-.....KT.Q.IL..........................SP---..CGL-E..D..ILC........GAAGQWV.SN..GTE.LC......RSA---.-----....-----................------gfivqpseynvvekqfcyg.............................................
A0A2U3VKW6_ODORO/27-188              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CTPEQDEA..LARRFGA...LAaRVD---..-........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....EV....YCLDMWQTCRGV.....FRHL...S...PD.....RE.L.WA..........................LEGNQ.aKF---..-..--C........RYLS---.LD..DTD.YCf....pHLLVNK.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A452HZT4_9SAUR/26-208              .......................................................MCMDA....KHHKTE.PGPEE.....ALHGQ.........................C.VLWKDN...............................AC....CTANTSTE..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IDQvrgls................................lppgtgWRRE..RIL.NVP..LC....KE....DCELWWEDCQDA.....ITCK...E...NW.....HK.G.WN..........................WTSGT..NRCPR..G..FMC........QPFKYVF.PR..PAD.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
A0A2K6GLL0_PROCO/22-183              .................................................rcldfr-----....---PPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEQDAA..LARRFGA...LAaRV----..D........A..A..V...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLDMWQTCRGL.....FRHF...S...PD.....--.R.VL..........................WSLEG..NRA--..-..---........KFCHYLS.LD..DAD.YCf....pHLLVNE.NLNANl..gRVVAD................AKGCLQ................................................................
A0A061F3A3_THECC/42-205              ........................................vcvsqggrfppfsse-----....-----G.KPPKRvgkghKDLTL.........................C.RVFRKM...............................TC....CDAAQTHP..ALLSIRK...LA.L-----..T........G..E..A...SP..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.lIC....TS....FCDRVFQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRASEWT.SN..GTE.LC......RAA---.-----....-----................------gfavkqsdvvhggveetscy............................................
R4GC40_ANOCA/31-192                  .........................................qcldfkppfkpsrp-----....------.-----.....-L-AF.........................C.VQYSDF...............................GC....CEAERDAA..LLRRYYS...VS.---THL..D........Q..G..A...YA..........ACA.SHL...QNL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PER.TLP.gLC....RD....YCTQVWQNCRSM.....FRHL...T...SD.....EE.L.LS..........................LENNQ.aK----..-..-FC........RYLS---.LD..DTD.YCf....pQLLVNE.NLNQNl..gLVTAD................SEGCLQ................................................................
A0A286Y3Q3_CAVPO/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggevlC.GGFYPR..............................lSC....CLRGDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECE.KLL...EEI..K.CAF...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....LQ.T.TA..........................DEFCS.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.SL......DQMEEY.DKVEEi..nRKHKH................NCFCVQ................................................................
A0A397XQY0_BRACM/38-198              ..................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDLTM.........................C.RVFRKR...............................TC....CSPAQTTP..AFVAVRN...LA.TH----..-........G..E..A...TQ..........DCL.HLF...ELL..E.CSI...-CNP.DVG--....TQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKDA.....YFAS...N...AL.....--.-.-T..........................QTIGP..CGVND..D..IIC........VKASNWE.SN..GTS.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
A4S053_OSTLU/1-131                   .....................................................mt-----....------.-----.....----F.........................C.DAHRGS...............................TC....CGKEQTDA..ARVRAVH...MQ.------..L........N..G..F...GE..........RCR.DAW...GAL..E.CSV...-CDA.RVG--....VSE...........................................----..---.GVP..VC....AA....ACDGVYRACADE.....FFAE...D...GS.....RR.L.VP..........................CRPSD..TIC--..T..KLS........EWIGDVR.DK..GKE.MC......EAA---.-----....-----................------gwdyvapgerwcfd..................................................
A0A1S3F1E4_DIPOR/45-206              ..............................................cldygppfr-----....------.---PS.....QHLEF.........................C.SDYQSF...............................GC....CDQHKDHR..IAARYWD...IM.NYFD--..-........L..R..S...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPKT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...G-.....--.-.--..........................-DHGL..QDSHD..K..DGA........RFCHLLN.LP..DQD.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedrqgclq.........................................
A0A384BWL5_URSMA/27-202              .......................................................VCMNT....KHHKRE.PGPED.....KLYEE.........................C.IPWQDN...............................AC....CTAGTSWE..AHLDASL...LY.TFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..I.CFY...ECSP.NLGPW....IQKvd.......................................ssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.D.WD..........................RSGGK..NRCPA..R..AVC........HPFPHYF.PT..PAD.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A3B3T6P1_9TELE/41-215              .......................................................RCYDG....SLPKRP.KKRDN.....GGMGL.........................C.PRLYPR..............................lSC....CPSKRSAFrmLHRRNGM...VL.------..-........S..S..N...NT..........DCT.KLL...EEL..Q.CA-...RCSP.HAQLL....YHTas.......................................pgRAPR..GQP.HLP.iLC....QD....YCKRLYYTCRGH.....IPEL...-...-F.....QA.D.V-..........................DEFCQ.yYGTGG..N..SLCf.....pdFHRRQTR.GP..SSN.YL......DLTDDY.EQKEDf..nRKHKD................SCYC--am..............................................................
A0A2R9CTI8_PANPA/37-208              .......................................................VCMNA....KYHKTQ.PSPED.....ELYG-.........................-.--QKKN...............................AC....CMTNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.GLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NKCPA..W..ALC........HTFEPYF.PT..PAA.LC......EGLWSH.SFKMW...fDSA--................------qgnhnee.........................................................
A0A2K5RGP9_CEBCA/20-181              ..............................................qcldfrppf-----....------.--RPQ.....RLLAL.........................C.SRYSVF...............................GC....CDEKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRHL...S...TD.....KK.L.WA..........................LEDNR.dKFC--..-..---........---HYLS.LD..DMD.YCy....pNLMVN-.-----....-----................------knlssdlghmvadatgclq.............................................
A0A200PWQ4_9MAGN/26-189              .................................vcisqggrfapfssegkppsia-----....------.-TKGA.....KDLTL.........................C.RVFRKS...............................TC....CDVAQTHP..ALLTIRR...LA.-----S..A........G..E..A...NQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACSNA.....YFSE...D...A-.....KT.Q.VL..........................SPCGF..GD---..-..FVC........GRVSEWA.SN..GTE.LC......QLA-GF.ATKSS....-----................------ednsevgiepscy...................................................
A0A096MMB1_PAPAN/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWDDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PIV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
M1CAU9_SOLTU/41-192                  ..............................................rfsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RVFRGK...............................TC....CDVTQTHP..AFMSIRR...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSNA.....YFSV...D...AK.....-T.Q.VL..........................AP---..CAV-N..D..FVC........GRASEWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A3Q0RMK5_AMPCI/30-205              .......................................................MCMDA....KHHKTE.PGSEG.....ELYKQ.........................C.SPWREN...............................AC....CTANTTEE..AHEDTSY...LY.NFNWNH..C........G..A..M...SQ..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KX....DCESWWEDCKND.....FTCK...T...DW.....HK.G.WD..........................WSSGI..NKCPE..S..SKC........RKWTDVF.PT..PKS.MC......EQIWSN.SYMYT....TFTKT................SGRCMQ................................................................
F6Z059_XENTR/53-214                  ....................................................qcl-----....DFKPPF.RPPQE.....LS--F.........................C.VQYKDF...............................GC....CDSVRDGE..IMQNFYR..vLS.HFD---..-........Q..S..G...YE..........SCA.AHV...QDI..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIA.gLC....ED....YCWGVWQTCRSI.....FQYL...T...TD.....KE.L.LA..........................LESNK.aKFC--..-..---........---RHLA.LE..DTD.YC......------.-----....-----................------fprllansnlnqnlglvtadaegclq......................................
A0A0L0FZI6_9EUKA/26-177              ...........................vvghplcqdftapaianpslqwcdepey-----....------.-----.....-----.........................-.-----Rf............................neSC....CTVESENV..LRVAHEA...AA.------..L........T..I..V...NP..........ECQ.SYL...KQI..L.CSS...-CDQ.YSAHL....FGT...........................................-ETF..EDR.KVP.mLC....EA....YCSMVYEACKNE.....SIVS...L...RS.....LV.G.SN..........................Y----..-----..T..GNG........TTLAEAY.PT..GND.FC......------.-----....-----................------gvaaadvssycysg..................................................
F7IF74_CALJA/59-215                  ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
C0HAY9_SALSA/29-207                  .......................................................ACLQD....GRQKAT.PSQEP.....HLKE-.........................C.TIYAEN...............................AC....CSEDDIQD..LHPMTSE...-K.NSPWDK..C........G..K..L...SP..........KCE.DFL...KRV..T.CFY...RCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEEE................------ereggegisndnggrpcgclt...........................................
A0A3B6QER5_WHEAT/44-197              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A2K5LBG7_CERAT/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q2WVY0_HAPBU/36-208              .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDVEKDEE..ISGRFYN..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ALP.gLC....GD....YCSDYWQQCRYT.....LSLL...L...ED.....LG.N.SQ..........................QFANL..TATIE..E..DHR........RFCEFLV.LK..DKE.YC......------.-----....-----................------ypsvltnaelnanlgllnedpegcle......................................
K3YUK0_SETIT/45-198                  ..............................................fssegkppg-----....------.RAPKG....rRDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALVSVRN...LA.L-----..T........G..E..G...GQ..........ECI.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSES.....YFSV...-...-D.....MK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......HLA-GF.SVQVS....E----................------tnsglvddtfcyg...................................................
A0A2Y9K9W1_ENHLU/27-201              .......................................................VCMNT....KYHKQE.PGPED.....QLYEE.........................C.SPWRGN...............................AC....CRAGTSLD..AHLDLPL...LS.NFSLHH..C........G..V..M...LP..........GCE.KHF...LQA..V.CFY...QCSP.NLGPW....IQKld.......................................sgGPGE..RIL.EVP..LC....WE....DCEQWWEDCRTS.....YTCK...A...DW.....-R.S.WD..........................WSGGK..NLCPA..Q..AFC........HPFPHYF.PT..PVD.LC......EKIWSH.SFKAS....PEHRN................SGLCLQ................................................................
A0A2K6AU36_MACNE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGHCIQ................................................................
G3TYX8_LOXAF/28-189                  ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.TQYSGF...............................GC....CAAERDEV..LARRFGA...LA.A---SL..D........A..A..V...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....IRHL...S...PD.....RE.L.WA..........................LEGNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCL-q...............................................................
Q5CX08_CRYPI/39-218                  ......................................................f-CLEI....YDNKND.EKHLP....yYFLNEf......................piC.KEHERR...............................TC....CKKSHSEA..ISRLFST..lVA.R-----..-........S..S..L...ST..........RCS.NFY...QKS..L.CSY...-CDA.DIGVG....-K-...........................................---K..VIQ.KSP.iLC....QS....YCNLWYDACYED.....YFDN...I...QNs...yIR.N.IEdi......................sfIRLNL.iPCTDS..S..AIC........SPLHAIT.LD..PTE.FCs....lNGFSTHqDFHSSs..gP---Asl...........teyNTECF-n...............................................................
A0A2U3XGN1_LEPWE/27-177              .....................................................ac-----....GGSRLL.PAMSR.....RHHRL.........................A.ADLGTG...............................QL....HLAEMDTP..EASDPGM...VP.----ER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VVL...HSRF.RLLLL....GRR...........................................----..--Q.AQP..LC....SE....LCDVWFATCEND.....ITC-...-...--.....GP.T.WL..........................PLLEK..RGC--..E..PGC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2U3VBC3_ODORO/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDTSL...LY.NFTWDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IWEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGF..NKCPA..G..TTC........RTFETYF.PT..PAA.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A1A6FW57_NEOLE/34-218              .......................................................VCMDA....KHHKEK.PGPED.....NLHNQ.........................C.SPWKKN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...TP..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQptgqlcapnisyrlclqlqfysgcisevpelktffvnsqvdqsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....FTCK...S...NW.....HM.G.WD..........................WTSGK..ERVGW..E..GAC........N------.--..---.--......------.-----....-----................------vsgle...........................................................
A0A1U8D644_ALLSI/22-189              ......................................................s-CLEG....DTHKEK.PSPEP.....DMHE-.........................C.TLYSKS...............................SC....CDADLTAQ..LDHSPVI..kVN.NSYWNR..C........G..N..L...SK..........SCE.DYT...KKI..E.CFY...RCSP.YAAHW....INP...........................................NYTA..AIE.FVP..LC....QN....FCDDWYEACKED.....LTCV...R...NW.....LT.D.WE..........................WDDNG.vNHC--..K..SDC........SPYSEVF.AN..GTE.LC......QTLWGH.SFKVS....---ES................SCLCLQ................................................................
A0A1S3JMU8_LINUN/25-193              ......................................................e-CLPG....NNHKRT.PGPEE.....GTFGA.........................C.HEYKNN...............................SC....CTAAFTQT..LSASPIV..kVE.DTYWNR..C........G..N..L...SR..........SCE.QYK...LSV..E.CFY...RCSP.NAIYW....KNP...........................................DHPS..AAL.HVP..VC....AE....DCDAWFEACKDD.....MTCA...T...NW.....LT.D.WN..........................FTKPG.eNHC--..K..MPC........KSFTEIY.KD..GKG.LC......EKMWGS.TFLYE....---GN................ADKCI-k...............................................................
A0A2K5U027_MACFA/47-222              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
I3LDJ1_PIG/192-248                   ..............................................rgqkpcilp-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................--TGY..NQCPV..S..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SFEVS....SYSRG................SGRCIQ................................................................
A0A2K5LBK9_CERAT/47-110              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...DA..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlsrt...........................................................
C3XSA1_BRAFL/90-235                  ......................................................l-CHLR....YLHKDT.PGPEP.....DTFAE.........................C.HPWKER...............................SC....CTEDTVNS..VQKLKES..yGP.EWHWDR..C........G..P..L...SP..........ACE.RFF...IQE..A.CFY...ECEP.NAGLF....RKYpdsdy................................nasdpsHNQW..QMS.GMP..IW....SD....YCDAWHRACRND.....QFCA...H...DD.....GN.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ffscaaiyeevqtmd.................................................
G1M0Y2_AILME/27-208                  ......................................................a-C---....GGSHPL.PSMSQ.....RHQRL.........................A.TDLGTGqlhltgdhqalvpqsylriqdpnsqespspwSC....CPSEMDTP..EASDPAM...VP.----ER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCESD.....ITC-...-...--.....GP.T.WL..........................PLLEK..RGC--..E..PGC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K5UR81_MACFA/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLIH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A7T9S3_NEMVE/40-169                  ......................................................y-CP--....YFNNRA.PSPQP.....NLRN-.........................C.TWYKEN...............................AC....CLPHELDS..ILEAIAP...LT.------..-........-..G..A...NN..........RCL.RAF...NYL..M.C-Y...VCAP.YQNMF....YKN...........................................----..--E.RLT..VC....RD....FCDTIFQSCGDA.....FLKG...S...RI.....SS.A.--..........................YKSGE..EFCE-..-..---........-------.--..---.--......------.-----....-----................------srkfivadgkskncftsiq.............................................
G3WEP6_SARHA/39-222                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQldsls...............gaeavC.GAFYPR..............................lSC....CSRIDSQS..LLHMESK...IF.S-----..-........V..T..N...NT..........ECM.KLL...EEI..R.CAH...-CSP.HSQNL....FHSpe.......................................rgEASE..RDL.ALP.lLC....ED....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.SA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..TSN.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A3B6NQI2_WHEAT/47-198              ............................................fegkppgkaak-----....------.---GR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...D-.....MK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....-----................------daglsevdetfcyg..................................................
A0A093PCA7_9PASS/3-129               ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETAE..REL.TLP.yLC....RD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCY.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..nRKHKH................NCFCIQ................................................................
A0A2K6ESG4_PROCO/44-206              ..........................................qcldygppfqlpl-----....------.-----.....-HLEF.........................C.SDYKSF...............................GC....CDQHKDRR..IAARYQD...IL.EYLD--..-........P..K..S...HE..........LCG.GYI...KDI..L.CQV...-CSP.YAAHL....YGA..........................................qDART..PLR.PLP.gLC....AD....YCSAFLSRCPAA.....TSLL...-...--.....-T.-.--..........................GDHGL..RATRG..Q..DSA........TFCHLLR.LP..DQD.YCf....pNVLRSH.RLARTp..gAAATG................PRGC--lr..............................................................
A0A2K5D9H1_AOTNA/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CTADTSQE..LHKDTSR...LY.NFNWEH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFEFYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
G1RQQ9_NOMLE/17-170                  ............................mswdptasvpkpylniqdpgsqrsplp-----....------.-----.....-----.........................-.-----G...............................PC....CPSEMDTT..ETLGLGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..K..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3B4X2V9_SERLL/37-209              ..............................................schpqcldy-----....--KPPF.EPRQP.....LVF--.........................C.KEYSKF...............................GC....CDLEKDEE..VSAKFYT..iME.NF--DH..S........G..-..-...FA..........TCG.KYI...RTI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....RD....YCSNYWHQCRYT.....LSL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llentgspqqfanltaaieddrrrfcdylelkdiqycypnvltnaelnanlglvredpkgcl..
A0A3Q4HYE0_NEOBR/5-166               ..............................................qcldfkppf-----....------.R--PR.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.HFD---..-........Y..S..G...YA..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycyphllsnqqltqnlggiqvnsdgclq.........
A0A087R786_APTFO/31-206              .......................................................ICMDA....KHHKTK.PGPEG.....MLHDQ.........................C.APWKDN...............................AC....CTANTSLE..AHKDQSN...LY.NFNWNH..C........G..L..M...PP..........KCK.SHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEAWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSHVF.PQ..PKD.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A0E0NH61_ORYRU/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
A0A2I4BP03_9TELE/38-210              ..........................................chpqcldykppfg-----....------.--PQQ.....PLVF-.........................C.KEYTKF...............................GC....CDLNKDAE..ISTRFYK..iMD.NF--DH..-........-..S..G...FT..........TCG.KYI...RTI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWRECRYT.....LSLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledlgnpqqfanxtsaleedhkrfcdflelkdkqycypnvltdaelnanlglvredpkgcle..
G3QHP1_GORGO/59-215                  ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ESSGPGN...--.--HPER..C........G..V..P...SP..........QCK.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFVNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A384AQ25_BALAS/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6A9J8_MANLE/34-196              .......................................................VCMNA....KQHKAQ.PSPED.....ELHG-.........................-.------...............................QS....CVFPTHQE..LHKDTSH...LY.NFNWDH..C........G..K..M...EP..........ACK.CHF...IQD..T.CLY...ECSP.NLGPW....ICW...........................................-RKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
H2QZT5_PANTR/22-183                  ...............................................qcldfrpp-----....-----F.RPPQ-.....-PLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A340X670_LIPVE/23-112              ......................................................a-C---....GGSHPL.PARSQ.....STIGL.........................A.TNLGTS...............................QL....HLAEMNTP..EASDPGI...VS.----GR..C........G..V..L...SP..........GCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAW-------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A2H5PYP7_CITUN/19-195              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...AK.....TQ.F.FVpvcw.................ycnlsMQVLA.pCGV-N..D..FVC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A2P6NF93_9MYCE/60-205              ..................................................gtcin-----....----KV.RTQAP.....RSNSN.........................C.GWYNDY...............................AC....CTQYDTLG..YDY----...-N.NVRDSG..C.......aG..P..I...DG..........RCT.DYI...ILT..D.CAL...ACSP.NITST....MVG...........................................----..TTP.QIQ..IC....SS....LADTIWKKCKYS.....SVK-...-...EW.....TK.G.V-..........................-----..-----..-..--C........VALNTVF.DN..STD.FV......ENS---.-----....-----................------lnmiyyngtdttqcwnaavla...........................................
A0A096MUB4_PAPAN/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A3Q3MUQ5_9TELE/35-196              ..........................................qcldfkppfrplr-----....------.-----.....-ELEF.........................C.VMYKEF...............................GC....CDYQKDQE..LMTKFYQ..vMR.NFD---..-........Y..Y..G...YA..........NCA.GFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSQFWKKCSST.....IPFL...T...D-.....NP.H.VA..........................-----..-KI-K..E..DHT........RLCQYLE.LD..DMD.YCy....pHLLSNQ.NLTQNl..gRVQSD................SDGCLQ................................................................
E2QXF0_CANLF/30-205                  .......................................................VCMDA....KHHKAK.PGPED.....KLHAQ.........................C.TPWRKK...............................AC....CTVSTSQE..LHKDTSR...LY.NFTWDH..C........S..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.QVP..LC....RE....DCEQWWQDCRTS.....YTCK...S...NW.....HR.G.WN..........................WTSGV..NKCPA..R..TTC........RTFEAYF.PT..PAA.LC......EGIWDH.SYKAT....NYRRG................SGRCIQ................................................................
A0A2Y9DVM5_TRIMA/36-211              .......................................................VCMDA....KHHKEK.PSPED.....ELHDQ.........................C.GPWKKN...............................SC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQNWWEDCRTS.....YTCK...I...NW.....HK.G.WN..........................WTSGH..NQCPA..E..AQC........APFDVYF.PT..PDV.LC......NEIWSH.SYKAS....NYTRG................SGRCIQ................................................................
A0A3Q1C9Y7_AMPOC/26-199              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....LGLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledsespqqfanltatieedrrkfcdflelkdqqycypnvltntelnanlglvredpkgcle..
A0A2Y9JXW6_ENHLU/44-206              ...........................................qcldygppfqpp-----....------.-----.....VHLEF.........................C.SDYESF...............................GC....CDQHKDRR..LAARYRD...IM.DYFD--..-........L..R..G...HE..........LCG.GYV...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSSCHSA.....ISLL...T...ND.....-R.H.LQ..........................GSH--..----E..K..DGA........HFCHLLN.LP..DED.YCf....pNVLRND.HLNRNl..gVVAKD................QQGCL-q...............................................................
RTBDN_CANLF/27-177                   ......................................................a-C---....GGSRPL.PALSR.....RHHRL.........................A.ADLGTG...............................QL....HLAEMDTP..EASGPGM...VS.----EH..C........G..K..P...SP..........GCE.SFL...GHL..Q.VAL...HNRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDIWFATCESD.....ITC-...-...--.....GP.T.WL..........................PLLEK..RGC--..E..PRC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................ADHCLN................................................................
A0A2G3AXK6_CAPCH/39-189              ...............................................fsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RVFRGK...............................TC....CDVTQTHP..ALISIRR...LA.-----S..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSNA.....YFAI...D...A-.....KT.Q.VL..........................AP---..CAV-N..D..FVC........GRASEWI.SN..GTE.LC......HV-AGF.SVKSM....SDDPE................EVSCY-g...............................................................
A0A267GXH9_9PLAT/30-181              ...........................kaaqqeedqkthkatkskctffagtrys-----....------.-VPES.....SLVN-.........................C.YWYNRN...............................AC....CKRIEVTS..VFSSL--...LS.KL----..-........E..G..Q...SR..........RCY.DML...RYL..L.C-Y...FCSP.EQHFW....FRD...........................................----..--N.KVF..VC....KS....FCDDIYSHCRSA.....VMNG...L...EF.....GK.A.FK..........................N----..-----..-..---........-------.--..---.--......------.-----....-----................------gedfcrgnnfavqednvacfafdptqfd....................................
A0A3B4G400_9CICH/30-205              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A402E919_9SAUR/36-218              .......................................................RCLNG....SPPRRL.KKRDR.....RLLLLepph................gveltC.RGFYPR..............................lSC....CPRAQSQS..WLQLSEN..kIF.------..S........V..T..N...NT..........ECV.KLL...QEI..K.CAH...-CSP.NAQNL....FHSt........................................ekEALE..REL.VLP.fLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TV..........................DEFCF.yYARKD..G..GSCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.GKVEEi..sRKHKH................NCFCI-h...............................................................
A0A493SVL6_ANAPP/26-124              .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQ...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ghlhlsywvwtglcl.................................................
A0A384BNF0_URSMA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9MWE7_DELLE/30-205              .......................................................VCMDA....KHHKIK.PGPED.....KLHDQ.........................C.IPWKKN...............................AC....CSAKVSQE..LHRDTSS...LY.NFNWEH..C........G..K..M...KP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQSWWEDCRTS.....YTCK...T...NW.....QK.G.WN..........................WTSGS..NKCPT..G..TTC........GTFEFYF.PT..PAA.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A3B5QDK3_XIPMA/26-201              .......................................................VCLQD....GKHKAT.PGAEP.....RLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..sNK.NEPWDK..C........G..P..L...SS..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A4D9F027_9SAUR/35-217              ......................................................k-CLNG....NPPRRL.KKRER.....RMMFLepas................ggemmC.RGLYPR..............................lSC....CSRTDSQG..LLHIETK...IF.S-----..-........V..T..N...NT..........ECV.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRGQ.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3B4ES39_PYGNA/35-196              ...................................................qcld-----....-YKPPF.QPQEP.....LVF--.........................C.KEYAKF...............................GC....CDLDRDSQ..ISKQFYQ...IM.DY-FDP..S........G..-..-...YM..........ACG.KYI...RSI..M.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....RG....YCYDFWHQCRYS.....LSLL...T...ND....nIT.S.II..........................EEDRE..KFC--..-..---........-------.--..---.--......------.-----....-----................------dhlelkdpeycypnvlssdelnanlgnvqadtkgcvq...........................
A0A3M6V221_9CNID/29-195              ......................................................k-CIDG....PYHKDK.PSPEG.....PDYVE.........................C.QPWKEN...............................TC....CTAGFTAQ..LEKSNVE..vLY.NFSWHH..C........G..N..L...SK..........ECE.RYI...KNE..E.CFY...SCEP.SLIKW....HT-...........................................-SGG..GVK.QVP..IC....AD....YCDKWYDACKND.....MTCA...E...DW.....LA.D.FN..........................FTLSQ..YSCRT..D..SKC........LRFSELY.KD..GEG.LC......NKMWGQ.SFTYE....----K................SNNCM-v...............................................................
G1PPC7_MYOLU/2-153                   .....................................................gg-----....------.-----.....-----.........................-.----KN...............................AC....CSVSTSQE..LHKDTSL...LY.NFNWDH..C........G..K..M...KP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................dsWRRE..RFR.NVP..LC....KE....DCESWWEDCRTS.....YTCK...S...DW.....HK.G.WN..........................WTSGS..NKCPA..Q..AVC........RTFESYF.PT..PAA.LC......EGLWSH.SYQVS....QYSRG................SGRCIQ................................................................
A0A1S3JFL1_LINUN/32-204              ...............................................kcvtlpve-----....GASKTR.PSPEP.....GLE--.........................C.PSFRKR...............................SC....CYVNAVAN..ILENHVW...NE.MITYMH..Cp.....qkP..R..L...SP..........ECE.RLT...FEQ..S.CFY...ACSP.NLGPW....IYR..........................................yLHFD..ALD.NAP..LC....AS....QCNKWWDACKEE.....YTCH...R...NW.....IT.D.MD..........................W-NGL..NTCKE..G..SVC........RKYTEFY.NS..STD.FC......STVFNG.AYKVV....---PD................SEPCM-v...............................................................
A0A0D9R2L1_CHLSB/1-120               .............................................mdtteisspg-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.-NHPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................AHHCFN................................................................
F6UJL7_CALJA/10-189                  ..............................lghvrkrkcevgqagkhvvcqpapg-----....------.-----.....-----.........................C.SPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWEH..C........G..R..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....QK.G.WN..........................WTSGI..NECPA..G..ALC........HTFESYF.PT..PAA.LC......EGLWSH.SYKVS....DYSRG................SGRCIQ................................................................
A0A2K6SEV9_SAIBB/48-206              ..............................................ygppfrpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQDKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ltgdrglqeppgtdgarfchlldlpdkdycfphvlrndhlnrhlgvvardprgclq........
A0A3Q4MBB3_NEOBR/34-195              .................................................tvriti-----....------.-----.....----N.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....ITCK...D...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDFF.PT..PKS.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
U3JUU5_FICAL/47-222                  .......................................................ICMDA....KHHKTE.PGPEG.....QLYGQ.........................C.VLWKDN...............................AC....CTANTSME..AHQDQSY...LY.NFNWDH..C........G..A..M...PE..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRKE..RIR.DVP..LC....QE....DCEQWWEDCQDA.....VTCK...A...NW.....HT.G.WN..........................WTTGT..NQCPK..G..AMC........QKFKYVF.PT..AAE.LC......EQVWSG.SYRYT....SQHRG................SGRCIQ................................................................
I3M7G9_ICTTR/27-208                  ......................................................a-C---....GGSHQF.QARSQ.....GHLGL.........................A.SNLGTNqvqlagdlqasgpqpymmiqdpdsqafplpePC....CPSEMDTP..ETSGPGI...FP.----PR..C........G..T..P...SS..........GCE.SFL...GHL..Q.RAL...RNRF.HLLLL...gVRQ...........................................----..---.APP..LC....EE....LCQNWFATCEAD.....ITC-...-...--.....GR.T.WL..........................WPSGK..RSC--..E..GRC........RTYGQTF.AD..GVD.LC......RSVLGH.ILPVA....--APG................SRHCLN................................................................
A0A3B3S631_9TELE/34-194              .............................................qcldfkppfk-----....------.--PQD.....TLVF-.........................C.VMYTDF...............................GC....CDSRKDRE..LRAKFYE..iMD.NFD---..-........S..Q..G...YA..........SCA.GYV...QEL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SLP.gLC....PD....YCSRFWLRCRSV.....ITLL...S...NNt...sLE.G.LE..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------adkhrfcrylelddadycyphllsnpqltkdlgrvtaneegcl.....................
A0A078G0I8_BRANA/33-173              .............................................vaeseavnss-----....------.--ENA.....LHLNL.........................C.NAFHGN...............................TC....CSSSLALQ..NL--AT-...-H.------..-........G..E..A...SK..........DCL.YLF...ELL..E.CSI...-CHP.DVG--....-GP...........................................----..---.-LR..IC....AS....FCDSVFKACSDA.....YFST...S...DS.....TN.Q.VI..........................VPCGA..RNG--..T..YIC........EKASKLE.TN..GTS.FC......EAV---.-----....-----................------gfsvqagddsvevpcy................................................
A0A0Q3UR77_AMAAE/25-186              ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYAEF...............................GC....CDLRRDRA..LLQRFYR...LS.---ARL..D........G..P..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCLQVWQKCRSI.....FHYL...S...AD.....QE.L.IA..........................LENNA.aKFC--..-..---........RYLS---.LE..DTD.YCf....pHXLANQ.NLNQ-....-----................------nlglvtadaegclq..................................................
H3AU75_LATCH/19-181                  ............................................qcldyrppfkp-----....------.----A.....YHLEF.........................C.SQYDTF...............................GC....CDQDKDNE..IAERYWD...IM.DFFD--..-........Y..Q..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDLET..PLR.SIP.gLC....FD....FCNELVVKCASS.....IVLL...-...--.....TD.D.WR..........................I--LE..ACQQD..R..AGC........CDLLN--.IP..DQD.YC......------.-----....-----................------ypnvlkntilnrklgavvedpagclq......................................
A0A3Q1GX10_9TELE/23-198              .......................................................MCMDA....KHHKEE.PGPEG.....KLYLQ.........................C.APWRDN...............................AC....CKANTTEE..AHNDNSY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQLav.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGV..NQCPA..D..TKC........QKWTEVF.PT..PKS.MC......EQIWSK.SYLYT....TLSKD................SGRCMQ................................................................
A5PJW9_BOVIN/38-220                  .......................................................RCLNG....NPPKRL.KKKDR.....RMMSQpells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAV...-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.lLC....KD....YCTEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3P8P3A5_ASTCA/23-198              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........SKWTDVF.PT..PKS.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A3Q7X8Q3_URSAR/4-176               .........................................hllqspealtlpac-----....------.-----.....-HRIQ.........................C.SPWKKN...............................SC....CFTNTSEE..AHKDISY...LY.KFNWNH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGY..NRCPA..G..AAC........LPFHFYF.PT..SAA.LC......SEIWSH.SYKPS....NYSRG................SGRCIQ................................................................
A0A067EMB2_CITSI/29-192              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetscy............................................
H2RXT6_TAKRU/35-201                  ................................................qcldykp-----....----PF.QPQQ-.....PLVF-.........................C.KEYSKF...............................GC....CDLQKDEE..IRIRFYT..iME.--NFDH..S........G..Y..V...--..........TCS.RYI...HSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRYT.....MSL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lledlgvlhqyanitmaieedrkrfcdflelkdkqycypnvltklnanlgfvrenpkgcl....
A0A2R9C5Y0_PANPA/26-208              .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A2K5DCK6_AOTNA/22-181              ...............................................qcldfrpp-----....------.-FRPQ.....QLLSL.........................C.SRYSAF...............................GC....CDEKRDAE..LTSRFWS...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.CQV...SGRA.ATARA....EDP...........................................--ST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....IRH-...-...--.....--.-.FS..........................TDKEL..QAL-E..D..NRD........KFCHRLS.LD..DAD.YCy....pNLMVNK.NLNSDl..gHMVTD................ATGCLQ................................................................
A0A1S3HE47_LINUN/1-143               ............................................mttsfledhqw-----....------.-----.....-----.........................-.------...............................--....--------..-------...MN.MTDYGH..Cp.....qkP..R..L...SP..........ECE.RLN...HDE..V.CFF...ACSP.NSGPW....IVKgt.......................................esPFNH..RLK.HLP..LC....AS....QCDKWWNACKEE.....YTCH...R...NW.....LT.D.PA..........................WDANG.vNICPK..D..AVC........KKYTEMY.TS..AAD.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A3Q3B8W9_KRYMA/38-209              ..........................................chpqcldykppfg-----....------.--PQQ.....PLVF-.........................C.KEYTKF...............................GC....CDLSKDEE..ISSRFYT..iMD.NF--DH..-........-..S..G...FT..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWWECRYT.....LS--...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------llledlgnppqfanltsaieedhkrfcdvlelkdkqycypnvltnaelnanlglvredpkgcl.
L8Y219_TUPCH/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggevlC.GGFYPR..............................lSC....CPRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQSL....FHSp........................................erDVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYAKKD..G..GSCf.....pdFPRKQVR.GP..ASN.YL......NQMEEY.DKVDEi..nRKHKH................NCFCIQ................................................................
A0A2B4SH32_STYPI/41-152              ..................................................rdgev-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...-YL..E.CFY...QCSP.KVYQW....KNP...........................................KIKG..ALK.GVP..VC....SG....FCDAWFEACKDD.....QICV...E...NV.....LD.D.YN..........................FTIHR.eNYCPG..D..REC........ESYQAMY.GN..GKN.LC......EKMWGE.SYNYT....QPNDN................YSNCL-m...............................................................
K7EVL7_PONAB/47-222                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......DGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
L5K8G1_PTEAL/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVSTSQE..LHRDTSL...LY.NFNWDH..C........G..Q..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQSWWEACRTS.....YTCK...S...DW.....HK.G.WN..........................WTSGS..NKCPV..E..AVC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....QYSRG................SGRCIQ................................................................
A0A2K6GQF4_PROCO/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........R..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQHWWEDCRTS.....YTCK...S...NW.....HQ.G.WE..........................WTSGV..NKCPA..G..ATC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2K1K7J2_PHYPA/29-181              ................................................lcaknle-----....-----P.PGRAN.....LTFCT.........................A.PEYAAN...............................GC....CNSRDDTQ..IKTTFDA...MN.------..-........-..I..S...NA..........KCA.AVM...KAI..L.CSK...-CDQ.YSADL....YDV..........................................tSALS..KPR.PVP.fLC....TSgannYCNQVWTACENV.....TIPN...S...PF.....EP.G.LQ..........................E--RG..NST-S..K..ASA........SLASFYK.NN..DTS.FC......I-----.-----....-----................------ssaaplaaenv.....................................................
C3Z7R5_BRAFL/50-177                  ..................................................ycslf-----....--GNRA.PKPEH.....KLVS-.........................C.PWFRLD...............................SC....CYQEEVDR..LFPIVTP...-P.------..-........R..G..A...DQ..........VCR.DHL...YYL..K.C-Y...ICSP.HQHLF....YHE...........................................----..--E.TVT..MC....EE....FCDSIFWACANA.....TLEG...E...R-.....IS.D.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lysngreycldrkfrvekessgtcytv.....................................
V4A3I8_LOTGI/9-180                   .......................................................TCLDG....QHHKKK.PGPEA.....DLFSF.........................C.SPWKKR...............................SC....CTEQITKQ..MHISDSW...-Y.NFNWNH..C........G..D..L...SA..........NCR.SHF...LQD..L.CFY...ECSP.NTGPW....LQPvk.......................................mkIRNE..KFM.HVP..LC....QV....DCTNWWEDCKND.....LTCT...D...NW.....GK.N.FN..........................WTTGQ..NRCPV..G..SSC........KKFSDIF.SN..STN.FC......EIVWNY.SWKVV....---AD................TESCM-h...............................................................
A0A1A6FW57_NEOLE/213-297             .................................................nvsgle-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..LC....-S....CCVKIWAFEAGT.....-TRD...S...SA.....HS.G.LQs.......................siMYIGY..NQCPV..G..ASC........HPFSFYF.PT..PAA.LC......EEIWTH.SYKLS....NYSRG................SGRCIQ................................................................
A0A3B5KMZ9_TAKRU/46-215              ................................................qcldykp-----....----PF.QPQQ-.....PLVF-.........................C.KEYSKF...............................GC....CDLQKDEE..IRIRFYT..iME.--NFDH..S........G..Y..V...--..........TCS.RYI...HSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRYT.....MSLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledlgvlhqyanitmaieedrkrfcdflelkdkqycypnvltsaelnanlgfvrenpkgcle..
A0A096M9D8_POEFO/15-184              .............................................qcldykppfg-----....------.--PQQ.....PLVF-.........................C.TDYTKF...............................GC....CDLQKDEE..ISRKYDL..iME.NFD---..-........T..L..G...SA..........RCG.KYI...SSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..QMR.VLP.gLC....GD....YCSDYWRDCRYT.....LSLL...L...ED.....KG.N.LQ..........................QFANL..TAAIE..E..DRR........RFCDFLE.LK..DKQ.YCy....pNVLTDA.ELNA-....-----................------nlglvredstgcle..................................................
A0A1X7U4F1_AMPQE/33-210              ......................................................q-CL--....RGDKHS.PEPET.....GDYYA.........................C.HQWKDG...............................AC....CSSNFTKQ..LANSSVT..sID.GFHWDR..C.......dS..N..L...SS..........QCR.KFF...VEI..E.CFY...RCSP.NVAHF....EVA...........................................EFPS..AFA.NLP..LC....GD....YCDRWYEACKDE.....RTCA...V...NW.....IM.D.WD..........................YNNMTgeNHCKA..N..SQC........QKYSDVY.RN..GRG.IC......NMLWGR.SFFYS....NSSSTdp............ddRRECL-t...............................................................
A0A091WBS1_OPIHO/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYENF...............................GC....CDQERDNS..IAAKYWD...IM.DYID--..-........P..Q..G...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCHSA.....ISLL...-...--.....--.-.-T..........................SDKHI..QECCE..T..NKT........HFCNLLH.LH..DED.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
FOLR1_BOVIN/35-210                   .......................................................VCMDA....KHHKAE.PGPED.....SLHEQ.........................C.SPWRKN...............................AC....CSVNTSIE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IREvn.......................................qrWRKE..RVL.GVP..LC....KE....DCQSWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I3GV70_NOMLE/30-187              .......................................................VCMDA....KHHKTK.PGPED.....KLHD-.........................-.QVWTPP...............................AC....TTLTGITV..ARW----...--.------..-........-..-..-...SP..........PAS.ATS...SRD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A0P7U0S1_SCLFO/29-212              .......................................................ACPRD....GKHKAT.PSPEP.....QLTE-.........................C.RLYADSk.............................nAC....CTVDDVQD..LVAPSVP..gVE.SGFWDR..C........G..A..L...SPplhlsllppiRCE.GFL...KRV..A.CFQ...RCSP.DAVHW....TSP...........................................RHST..TAQ.AVP..LC....HS....FCREWYEACKTD.....LTCA...R...NW.....MI.D.W-..........................---KG..RNC--..T..GNC........VPYRQMY.QH..ERD.LC......ESLWGD.HFVTM....VDEEGdqw..........kgrTCGCL-t...............................................................
A0A218V2Q1_9PASE/26-187              ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYAEF...............................GC....CDPRRDRA..LLQRFYR...LS.---ARL..D........E..R..A...YA..........ACA.GHL...QEL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCTQVWQNCRSI.....FHAL...S...AD.....PE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YC......------.-----....-----................------fphllanqnlnqnlglvtadaegclq......................................
A0A078HDM7_BRANA/1-131               ......................................................m-----....------.-----.....-----.........................-.--FHEK...............................TC....CSASQMFS..ASSALQN...LA.TH----..-........G..E..A...SK..........DCL.YLF...ELL..E.CSI...-CHP.DVGVQ....PRP...........................................----..---.-LR..IC....AS....FCDTVFEACSDA.....YFNT...S...DA.....SN.Q.--..........................--VIV.pCVASE..D..TIC........EKASMLE.TN..GTA.FC......EAVGFT.VVQTA....-DDSV................EEPC--yg..............................................................
A0A3Q1CNW7_AMPOC/23-198              .......................................................MCMDA....KHHKEE.PGPEG.....QLYLQ.........................C.APWRDN...............................AC....CKANTTEE..AHNDNSY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...VQD..T.CFY...ECSP.HLGPW....IQLad.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGV..NRCPA..N..TKC........QKWTEVF.PT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A2K5Q8J6_CEBCA/27-183              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPRT...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2K5EWG4_AOTNA/36-211              .......................................................VCMDA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.NFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCRTS.....NTCK...S...NW.....HK.G.WN..........................WTSGS..NKCPV..G..ATC........RPFYFYF.PT..PTA.LC......NEIWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A1V4JJ80_PATFA/11-171              ............................................ldygppfqptf-----....------.-----.....-HLEF.........................C.SAYENF...............................GC....CDQEKDNS..IAAKYWD...IM.DYI-D-..-........S..R..G...HK..........LCG.TYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ISLL...-...--.....--.-.-T..........................SDRHL..QECCE..T..NKT........RFCNLLH.LH..DED.YCf....pNVLKNT.ALNRNl..gSVVED................RRGCL-q...............................................................
A0A3Q0D977_MESAU/26-134              .......................................................VCMKA....KHHKQE.PGPED.....KLFLE.........................C.SPWKDN...............................AC....CTFSTSWE..AHLDELS...SF.NFSMMH..C........G..L..L...TP..........GCH.KHF...IQA..V.CLH...ECSP.NLGPW....IQL...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lgdgsvikhlphkrehlnsilrtpm.......................................
A0A2K5NV54_CERAT/59-215              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2U3YPW0_LEPWE/31-206              .......................................................VCMDA....KHHKEK.PSPED.....QLHKQ.........................C.SPWKKN...............................SC....CFANTSQE..AHKDISY...LY.KFNWDH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPA..G..AAC........LPFHFYF.PT..SAA.LC......REIWSH.SYKLS....NYSRG................SGRCIQ................................................................
C3Z5S2_BRAFL/82-229                  ......................................................d-CHLE....YFHKEA.PGPEP.....DNFTE.........................C.HPWKDY...............................SC....CHQDTVSS..VQKIKEA..yGK.EWHWDR..C........G..P..L...SS..........ACE.RFF...VQE..A.CLY...ECEP.NAGFY....-RKfpdhvy...............................ndsdpnHNKW..QME.GMP..IR....AD....YCDAWFRACRYD.....RFCA...A...DS.....--.-.GS..........................YSS--..-----..-..---........-------.--..---.--......------.-----....-----................------careyakvdntgdn..................................................
A0A226NA06_CALSU/27-188              ..............................................qcldfkppf-----....------.RPPR-.....-ALAF.........................C.RRYGAF...............................GC....CDARRDRA..LLERFYR...LS.---AHL..D........G..A..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FHYL...S...TD.....PE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YCf....pH-----.-----....-----................------llanenlnqnlglvtadaegclq.........................................
A0A0R3SDA3_HYMDI/36-214              .......................................................MCLES....DDLNDH.PVPEP.....SLTS-.........................C.SEWKDL...............................SC....CPAKTADL..ITDES--...LN.GFKFDF..C........-..D..I...TP..........ECK.KMF...LHE..Y.CMA...KCSP.HFGPW....MVKvp.......................................ssKFKE..NFF.KVP..LC....ES....DCNKWYEVCNTS.....MACS...T...NW....rSG.G.FD..........................WSSAT..NKCHK..G..YKC........LEISKIY.GS..AKA.FC......ESVWDN.SYSVI....PSDS-................------vsewgvtdyhcmh...................................................
A0A2K5MMC2_CERAT/20-181              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FHHL...S...T-.....--.-.--..........................-DQEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A452GGV2_9SAUR/35-210              .......................................................VCMDA....KHHKTK.PGPEG.....ALHGQ.........................C.ALWKDN...............................AC....CTAETSTG..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........MCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKDA.....VTCK...E...NW.....HK.G.WN..........................WTSGT..NQCPH..S..STC........QLFKYIF.PR..PAD.LC......EKIWSN.SYKYT....TEHWG................SGRCIQ................................................................
A0A0R4IY94_DANRE/29-201              .......................................................ACLRD....GRHKAT.PSPER.....HLQE-.........................C.SLYTEN...............................SC....CSETDIQD..LSVSVST...VE.NTHWDK..C........G..V..L...SP..........LCE.SFL...KRV..V.CFY...RCSP.DAARW....PHP...........................................HQGS..SLK.AVP..LC....HS....FCRDWFEACKMD.....MTC-...-...--.....AR.D.WT..........................TDPRG..QNC--..T..GAC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPGeedg........vegsSCGCL-t...............................................................
A0A2K6FL04_PROCO/41-168              ......................................................v-C---....AGSHPL.HARSR.....GHHGL.........................E.ADLGTSqlh.........................lagSC....CPSEMDTP..ETPGPGI...FP.----ER..C........G..A..S...SP..........GCE.SFL...GHL..Q.LAL...RSRF.RLLLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFAACEND.....VTC-...-...--.....GP.T.WL..........................PIPEK..RSC--..E..PSC........RTYGQ--.--..---.--......------.-----....-----................------................................................................
E7EU04_HUMAN/43-210                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....N----................------ys..............................................................
A0A2K3LBL3_TRIPR/24-185              .........................................vcvsqggrfppfks-----....--EGNP.PKRGP.....KDLTL.........................C.RVFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.-----S..G........G..E..A...SQ..........ECL.HLW...ELL..E.CAI...-CDP.RVG--....TQS...........................................----..---.GPP.lIC....AS....LCERIYDACSNA.....YFSM...-...DV.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VAA---.-----....-----................------gfrvkssdivhvaseeifcyg...........................................
A0A3P8WQC7_CYNSE/33-206              ............................................nchpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDLEKDEE..ISKSFYS..iME.N--FDH..S........G..Y..V...--..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....FDA..........................................eDANT..PMR.LLP.gLC....GD....YCFDYWNQCRYT.....LSLL...L...EN.....MG.S.PQ..........................QFSNL..TAILE..E..DRT........KFCDFLE.LR..DKQ.YCy....pNVLTNE.ELNANl..gSVREN................TKGCL-e...............................................................
A0A2U4AFZ5_TURTR/11-116              .................................................pepsls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.-VQ...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRGL.....FRHL...S...PD.....RE.L.WT..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A2G9G2W0_9LAMI/30-190              ......................................vcisqggrfppfanegk-----....--PPKK.ASKGP.....RDLTL.........................C.RVFRRR...............................TC....CDVSQTHP..ALLTIRR...LA.S-----..S........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQR...........................................----..---.GPP.rIC....AS....FCDRVYEACSAA.....YFAM...D...AK.....-T.Q.VL..........................APCG-..--L-A..D..FVC........GRASEWI.SN..GTE.LC......HAAGFS.VTQFE....--DPE................EAQC--yg..............................................................
A0A0D9S170_CHLSB/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3L8SQR4_CHLGU/21-188              ......................................................g-CLEG....DTQKLK.PGPEP.....NMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVS.DSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........IPYREMY.AN..GTD.MC......QSMWGE.SFKVR....---ES................SCLCLQ................................................................
H3HEC3_PHYRM/33-184                  ...........................................tcrsagvlkfds-----....---ETH.PMQRT.....KGMEV.........................C.SKYRKS...............................TC....CNATHAHP..LRLKIRE..pVV.------..-........A..K..F...GR..........KCQ.RLT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...-G.....GA.G.TL..........................APCYG..NAL--..-..-VC........SPLSSIA.KS..GAD.FC......VHM---.G----....-----................------fhvgsdtdadgidcfd................................................
A0A091G927_9AVES/3-129               ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A251PAD7_PRUPE/14-166              ..........................................gapstlssplkfc-----....------.-----.....-----.........................-.-SYNET...............................AC....CNSTEDLQ..IQKQFQT...MN.------..-........-..I..S...NS..........GCA.SLL...KSV..L.CA-...RCDP.FSGEL....FTVdsvprpvp..........................llcnstvsaNSSQ..SIQ.EV-..--....ND....FCSNIWDTCQNV.....SILN...S...P-.....--.-.FA..........................PSLQG.qAGLPV..K..SNV........SELTKLW.QS..KAD.FC......NAFGG-.-----....-----................------assdgs..........................................................
A0A0N8K116_SCLFO/23-198              .......................................................MCMDA....KHHKTK.PGPEG.....KLYQQ.........................C.SPWKDN...............................AC....CLANTTEE..AHKDNSY...LY.NFNWDH..C........G..A..M...TD..........KCK.RHF...IQD..T.CFY...ECSP.HLGPW....IQKvn.......................................ssWRKE..RIL.DVP..LC....RE....DCETWWEDCKDD.....HTCK...E...NW.....HV.G.WD..........................WSTDV..NRCPE..G..TQC........KKFSEIF.PT..AQS.MC......EKIWSR.SYKYT....TYTKD................SGKCMQ................................................................
A0A078FZH1_BRANA/153-313             ..................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDLTM.........................C.RVFRKR...............................TC....CSPAQTTP..AFVAVRN...LA.TH----..-........G..E..A...SQ..........DCL.HLF...ELL..E.CSI...-CNP.DVG--....TQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKDA.....YFSS...N...AL.....--.-.-T..........................QTIGP..CGVND..D..IIC........VKASNWE.SN..GTS.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
A0A3Q7RZ30_VULVU/45-206              ...........................................cldygppfqpal-----....------.-----.....-HLEF.........................C.SDYKSF...............................GC....CDQRKDRR..LAARYKD...IM.DYL-D-..-........L..K..G...HE..........LCG.RYV...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................kNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....HR.P.RR..........................P----..QEVDG..-..--A........HFCHLLN.LP..DED.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaqdqqgclq......................................
M4FHF8_BRARP/34-173                  .............................................agseavnsse-----....------.---NA.....LHLNL.........................C.NAFHGN...............................TC....CSSSLALQ..NL--AT-...-H.------..-........G..E..A...SK..........DCL.YLF...ELL..E.CSI...-CHP.DVG--....-GP...........................................----..---.-LR..IC....AS....FCDSVFKACSDA.....YFST...S...DS.....TN.Q.VI..........................VPCGA..RNG--..T..YIC........EKASKLE.TN..GTS.FC......EAV---.-----....-----................------gfsvqagddsvevpcy................................................
A0A1U7SPX6_TARSY/27-183              ......................................................a-C---....GGSHPL.QARSR.....LHHGL.........................A.PDLGTGqlh.........................lpgPC....CPSEVNTP..EVSSPGI...FP.----ER..C........S..A..P...SP..........GCE.SFL...GHF..Q.LAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFDTCKDD.....NTC-...-...--.....GP.T.WI..........................PLSEK..RDC--..E..PGC........RTYGQTF.SD..GAD.LC......RSVLGH.ALPVA....--APG................ARHCLN................................................................
A0A1S3GN12_DIPOR/27-173              .....................................................tc-----....GGSRPL.PARPW.....GHYGL.........................A.SHLGTG...............................QL....HLAEVDTP..DLADP--...--.----ES..C........G..A..P...SP..........GCE.SFL...RHL..Q.RAL...RNRF.RLLLL...gVGQ...........................................----..---.AQP..LC....AE....LCQAWFTICKAD.....LIC-...-...--.....GS.T.WL..........................PPSEN..RTC--..E..PGC........PTYGQTF.VD..GMD.LC......RSVLGH.VVPVA....--APG................SRHCLN................................................................
A0A3Q7RSV4_VULVU/26-182              .......................................................VCMKT....KHHKRE.PGPED.....KLYEE.........................C.IPWAEK...............................AC....CTASTSWH..AHLDVSL...LY.NFSLLH..C........G..L..M...MP..........ACE.EHF...IQA..V.CFY...ECSP.NLGPW....IQKvd.......................................ssGQGE..RIR.DVP..LC....RE....DCEQWWEDCRTS.....YTCR...S...DW.....LG.S.WD..........................WSGA-..-----..-..---........-------.--..---.--......------.-----....-----................------aqrggrsvgarglqrlllhqeqsapsq.....................................
A0A384BN01_URSMA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A398AT13_BRACM/1-125               ......................................................m-----....------.-----.....-----.........................C.SMFHEK...............................TC....CSASQMFS..ASSALQN...LA.TH----..-........G..E..A...SK..........DCL.YLF...ELL..E.CSI...-CHP.DVGVQ....PRP...........................................----..---.-LR..IC....AS....FCDTVFEACSDA.....YFNT...S...D-.....--.-.--..........................-----..-ATSE..D..TIC........EKASMLE.TN..GTA.FC......EAVGFT.VVQTA....-DDSV................EEPC--yg..............................................................
A0A2K5WE79_MACFA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G3SXL0_LOXAF/35-210                  .......................................................ICMDA....KHHKGK.PSPED.....KLHDQ.........................C.TPWKKN...............................SC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.WHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KD....DCQRWWEDCRTS.....NTCK...I...NW.....HK.G.WN..........................WTSGY..NQCPA..E..AKC........APFHVYF.PT..PDV.LC......NEIWSQ.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B4ZPV2_9TELE/52-214              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.TQYEDF...............................GC....CDQKTDNT..IAERYWD..iID.QLE---..-........V..G..G...QE..........LCA.DML...KEI..M.C-Q...ECSP.YAAHL....FDA..........................................eDPYT..PVR.ELP.gLC....SG....YCSEFHSKCRHV.....VKYL...T...AN.....-Q.R.L-..........................QDASE..-----..R..DIT........TFCTMVD.LS..DQD.YC......------.-----....-----................------ypnvlkspglnsnlgevvedprgclq......................................
A0A1S3JMB2_LINUN/29-196              ......................................................e-CLAG....VNHKSR.PGPEP.....YLRA-.........................C.RTYRNS...............................AC....CTPQFTRQ..LAASPIT..kVG.DTNWNL..C........G..Q..L...SA..........RCE.RHM...VAT..E.CFY...RCSP.NIVHW....ASP...........................................NYPA..ATV.RVP..IC....AS....DCDAWFDACKDD.....FTCA...E...NW.....LT.D.WN..........................FTKSG.eKQC--..K..GPC........KTFAETY.KD..GRG.LC......QKMWAL.SLDYS....---TD................SNRCM-k...............................................................
A0A2P5AD84_PARAD/27-185              .....................................cvsqggrfppfssegkpp-----....----KK.VSKGP.....KDLTL.........................C.RVFRQK...............................TC....CDVAQTHP..ALLNIRK...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.QVG--....VQP...........................................----..---.GPP.vVC....TS....FCDRVFEACSDA.....YFSM...E...PM.....-T.Q.VL..........................SPCGV..NDF--..-..-VC........GRASQWV.HN..GTD.LC......HAA---.-----....-----................------gfavkddllveetscy................................................
A0A3P9DJM5_9CICH/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
U6ITH9_ECHGR/36-215                  .......................................................MCPDS....GELKDH.PSPEP.....DLKE-.........................C.SEWKSR...............................TC....CSPETAEQ..IA--NAT...LH.GFSFDF..C........G..N..M...SE..........QCR.NYF...HYD..Y.CMI...KCSP.DLGPW....IVKmt.......................................ssRFKE..RAF.RVP..LC....ES....DCYAWYEACKWD.....KACS...T...NW....rSG.G.FD..........................WSEGT..NKCRK..G..FEC........LNISMVY.GS..PIA.FC......EHVWDH.AYRVV....PVESVavw..........gssDKHCM-h...............................................................
A0A2I2ZUF7_GORGO/37-193              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ESSGPGN...--.--HPER..C........G..V..P...SP..........QCK.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFVNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
G3WWL0_SARHA/29-194                  ..................................sahpqcldfkppfrpprplpf-----....------.-----.....-----.........................C.EQDSAF...............................GC....CDAEQDAA..LSRRYWA..vTS.RLE---..-........P..D..T...FA..........VCA.AYV...RGL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCVDVWHNCRTI.....FRHL...S...PD.....PE.L.WA..........................LETNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A452EP42_CAPHI/44-206              ...........................................qcldyrppfqpl-----....------.-----.....QHLEF.........................C.SDYESF...............................GC....CDQRKDHL..IAARYWD...IM.DYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSDCHSA.....IALL...T...ND.....-R.R.LQ..........................ESPGK..DGA--..-..---........RFCHLLN.LP..DKD.YC......------.-----....-----................------fpnilrsdhlnrnlgavaedrrgclq......................................
A0A453NZF6_AEGTS/36-189              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A2U3V495_TURTR/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2I2Z774_GORGO/36-206              .......................................................VCMNT....KHHKTQ.PSPED.....ELCG-.........................-.--QKKN...............................AC....CMTNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..T...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLRPW....IWQin.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........HTFEPYF.PT..PAA.LC......EVLWSH.SFKMW....-----................------fdsaqgnpne......................................................
A0A078G1E7_BRANA/37-201              .......................................vcvskggrshqpyele-----....-----G.KLPESadlefRDLNM.........................C.GMFHEK...............................TC....CSASRMLS..SSLALQN...LA.TH----..-........G..E..A...SK..........DCL.FWF...ELL..E.CSI...-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSDA.....YFNT...S...DS.....TN.Q.VI..........................V---P..CVASN..D..TIC........EKASKLE.TN..GTA.FC......EAV---.-----....-----................------gftvvqpagdsveepcyg..............................................
A0A397Z1Q3_BRACM/37-197              ......................................vcvskggrfppyesegk-----....------.-PPKPvgkgsKDLTL.........................C.QVFRKR...............................TC....CSPAQTNP..AFVAVRN...LA.TF----..-........G..E..A...SQ..........ECQ.HLF...ELL..E.CSI...-CNP.NIG--....VQP...........................................----..---.GPP.rIC....AS....FCNKVFAACKDA.....YFAS...N...AL.....--.-.--..........................TQMIG.pCGV-N..D..IIC........VKTSSWE.SN..GTS.FC......EAA-GF.SVQTN....-DDSR................KEPC--yg..............................................................
A0A1S3JFL3_LINUN/34-209              ...............................................mcitlpve-----....GASKTE.ASPEP.....DLE--.........................C.PSFREK...............................SC....CNTNATAD..FLKTHVW...ES.VINFDH..Cp.....gkP..R..L...SP..........DCA.RLM...HQE..M.CFY...ACSP.NLGPW....IVKay.......................................ahPDLD..HLN.HAP..LC....AS....QCEEWWNACKEE.....YTCH...K...DW.....IT.D.MV..........................W--GK.lHSCKK..D..AVC........KKYKEFY.SS..AAD.FC......STIWHG.DYKVV....---PD................SEPCL-v...............................................................
A0A287BJS7_PIG/82-257                .......................................................VCMDA....KHHKVE.PGPED.....ELHDQ.........................C.VPWKKN...............................AC....CSARVSHE..LHRDKSS...LY.NFSWEH..C........G..R..M...EP..........ACK.RHF...IQN..N.CLY...ECSP.NLGPW....FQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCLDWWEDCRTS.....YTCK...S...SW.....HK.G.WN..........................WSSGS..NQCPT..G..TTC........DTFESFF.PT..PAA.LC......EGIWNH.DYKFT....NYSRG................SGRCIQ................................................................
A0A3P9DIJ7_9CICH/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A498LKF0_LABRO/1-143               ...................................................myky-----....------.-----.....-----.........................-.-----F...............................GC....CDYARDRE..LMAKYYR..vMD.NFD---..-........Y..Y..G...YS..........NCA.SYV...QDL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFHSKCRSF.....LTLL...S...DD.....PR.L.SE..........................LEHD-..----Q..S..RLC........QY---LE.LD..DPD.YCy....pHLLSNE.RLTKNl..gRTVED................SDGCL-q...............................................................
H2Q8W9_PANTR/22-183                  ...............................................qcldfrpp-----....-----F.RPPQ-.....-PLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A3B3XJI1_9TELE/11-173              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.SQYEQF...............................GC....CDQRTDNV..IAERYWD..vIE.QLE---..-........T..A..G...YD..........LCE.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHRKCRHV.....LRYL...T...D-.....-N.Q.LL..........................LDTSG..RDM--..T..TFC........SLV---D.LS..DQD.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
F6SQN2_HORSE/31-192                  ......................................................q-CL--....DFRPPF.RPPEP.....LRF--.........................C.AQYSAF...............................GC....CAPEQDAA..LAHRFGA..lAA.RVD---..-........A..D..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TLP.gLC....ED....YCLDMWQTCRGL.....IRHL...S...PD.....RE.L.WA..........................LEDNR.aKFC--..-..---........---HYLS.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2D0S3X0_ICTPU/26-192              .......................................................ACLQD....GHHKSM.PSPEP.....NLKE-.........................C.SSYMEN...............................AC....CSAQDIED..LTASTSS...V-.--SWDR..C........G..S..L...ST..........VCE.EFL...KRV..I.CFY...RCSP.DATYW....PHP...........................................QRGS..SLR.VVP..LC....HS....FCRDWYEVCKSD.....LTC-...-...--.....AR.D.WT..........................RDPRG..LNC--..T..GSC........IPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEALev...........kgrGCGCLN................................................................
A0A0D2U8N0_CAPO3/45-225              ......................................................s-CISH....PSHARH.GKPTV.....KDLSSpet..................tlefC.TPWAGN...............................GC....CRPELTRL..INSVPDYd.aVY.DFNWAV..C........G..E..L...SA..........DCA.TYM...KHE..A.CFV...ECSP.YLTPF....EDR...........................................SFGY..YFS.SVP..VC....SS....WADRWFDACRND.....KTCV...D...NWy...dDN.A.WD..........................YTPDG.wNICKP..D..SQC........TTYADRF.GS..PKK.ML......ETLWGI.SFTYS....---TD................ESRC--ym..............................................................
FOLR1_MOUSE/34-209                   .......................................................VCMDA....KHHKEK.PGPED.....NLHDQ.........................C.SPWKTN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..T..M...TS..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCQSS.....FTCK...S...NW.....HK.G.WN..........................WSSGH..NECPV..G..ASC........HPFTFYF.PT..SAA.LC......EEIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A452Q700_HUMAN/34-104              .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..S.C--...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------l...............................................................
K7EKV3_HUMAN/27-183                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
F6PEI8_DANRE/34-195                  .............................................qcldfkppfq-----....------.--PQQ.....EL-QF.........................C.QMYKNF...............................GC....CDYARDQE..LMKKYYR..vMD.NFD---..-........Y..Y..G...YS..........NCA.SYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCAQFHSKCRSF.....LTLL...S...DD.....PR.L.AE..........................LEHDQ..-----..R..KLC........QYLE---.LD..DPD.YCy....pHLLSNE.HLNKNl..gRTAAD................SEGCLQ................................................................
A0A1R3K877_9ROSI/29-193              ....................................vcisqggrfppfssegkpp-----....----KK.VGKGQ.....KDLTL.........................C.RLFRKR...............................TC....CDAAQTHP..ALLSIRR...LA.V-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACSSA.....YFSM...D...AK.....TQ.A.L-..........................A----..PCGAS..D..FVC........GRASEWV.SN..GTE.LC......RAA---.-----....-----................------gflveqtdvtrngveerfcyg...........................................
A0A0D9S1B0_CHLSB/26-201              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPva.......................................psGQGE..RVV.NAP..LC....QE....DCEEWWEDCHLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
H9GJK4_ANOCA/31-192                  .........................................qcldfkppfkpsrp-----....------.-----.....-L-AF.........................C.VQYSDF...............................GC....CEAERDAA..LLRRYYS...VS.---THL..D........Q..G..A...YA..........ACA.SHL...QNL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PER.TLP.gLC....RD....YCTQVWQNCRSM.....FRHL...T...SD.....EE.L.LS..........................LENNQ.aK----..-..-FC........RYLS---.LD..DTD.YCf....pQLLVNE.NLNQNl..gLVTAD................SEGCLQ................................................................
A0A087TW61_9ARAC/34-209              ......................................................w-CLDS....VNHKHK.PGKED.....TLHEQ.........................C.LPWKDH...............................AC....CTNEVAIM..VHETNMY...--.NFTLDH..Cfs...qtgF..N..M...SD..........KCR.RHF...NQN..N.CFY...ECEP.HIGLW....VVKtk.......................................rkIATE..RFY.KVP..LC....AS....DCNSWFDACKED.....FTCA...H...NW.....PR.D.FK..........................FSKGH..NTCKE..D..AKC........FTFKQVY.ET..DKN.FC......ENVWDD.SWVYT....---PD................DQPCM-r...............................................................
A0A1S3NQ50_SALSA/33-194              ......................................................q-CL--....DYKPPF.QPREP.....LVF--.........................C.KEYAKF...............................GC....CDLEKDDK..ISQNFYK...IM.DY-FDY..S........G..Y..-...-M..........TCA.KYI...RTI..L.C-Q...ECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRYT.....ISLL...T...DN.....NA.T.LG..........................IEEDR.nKFC--..-..---........NF---LE.LK..DRE.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
M3VY61_FELCA/41-200                  .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQQKDHR..LAARYRV...IM.DYL-D-..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....--.-.--..........................--RRL..RETRE..K..DSA........HFCHLLN.LP..DKD.YCf....pNVLRN-.-----....-----................------dhlnrnlgvvaedgrgclq.............................................
A0A2K5P851_CERAT/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q3AF00_KRYMA/92-253              ...........................................qcldfkppfrpl-----....------.-----.....RDLQL.........................C.VMYNEF...............................GC....CDHQKDQE..LLARFYR...VM.---GNL..D........E..R..G...YA..........DCA.GLV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCTRFWNQCRST.....LPFL...S...DD.....--.-.--..........................--PRV..REA-E..H..DRR........RFCKLME.LD..DAD.YCy....pHLLANQ.DLTKNl..gRVQTD................SDGCLQ................................................................
A0A2K6Q6I7_RHIRO/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGTGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3M0K652_HIRRU/21-188              ......................................................g-CLEG....DTQKLN.PSPEP.....HMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVS.DSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........IPYHEMY.AN..GTD.MC......QSMWGK.SFKVS....---ES................SCLCLQ................................................................
D3Z631_MOUSE/26-172                  .......................................................VCMNS....KRHKQE.PGPED.....ELYQE.........................C.RPWEDN...............................AC....CTRSTSWE..AHLEEPL...LF.NFSMMH..C........G..L..L...TP..........ACR.KHF...IQA..I.CFH...ECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHSS.....LTCK...S...NW.....LH.G.WD..........................WSEGS..PPC--..-..---........-------.--..---.--......------.-----....-----................------lapsplvwmaag....................................................
A0A2C9JK01_BIOGL/16-180              ..............................................qcldyrapf-----....------.-KPES.....ALHF-.........................C.SQYTEL...............................GC....CSTTNDEI..LRDEFEY...IK.---TQV..T........R..E..D...WQ..........RCG.DFV...QEI..L.C-Q...KCSP.YAAHI....YDA...........................................EGSS..QAR.KFP.gLC....QH....YCYNYFEACSNL.....TMLL...H...PG.....LV.T.A-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------eimaskrsfcdkvslqdkdycypdlltnpmilrnwtiardsddissgclcl.............
F7H8H0_MACMU/22-183                  ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRVD---..-........T..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....--.-.--..........................--QEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A2Y9F773_PHYMC/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1L8F099_XENLA/22-183              ...........................................qcldfkppfrpi-----....------.-----.....KELTF.........................C.IQYKDF...............................GC....CDSVRDGE..IMQNFYC..vLS.HFD---..-........L..S..G...YE..........SCA.AHV...QDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIA.gLC....ED....YCWDVWQTCRSI.....FQYL...T...TD.....KE.L.LA..........................LESNK.aKFC--..-..---........---RHLA.LQ..DTD.YC......------.-----....-----................------fprllansnlnqnlglvtadaegclq......................................
G1SDN5_RABIT/126-287                 ..............................................cldygppfr-----....------.---PS.....RHLEF.........................C.SDYESF...............................GC....CDQRKDRR..VAARYQD...IM.DYFD--..-........L..R..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPHT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.-.--..........................---GL..QDAQA..K..DSA........RFCHLLN.LP..DED.YCf....pNVLRND.HLNRQl..gVVAED................PEGCL-q...............................................................
A0A452GH52_9SAUR/6-159               ..................................................qhply-----....------.-----.....-----.........................-.-----N...............................AC....CTAETSTG..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........MCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKDA.....VTCK...E...NW.....HK.G.WN..........................WTSGT..NQCPH..S..STC........QLFKYIF.PR..PAD.LC......EKIWSN.SYKYT....TEHWG................SGRCIQ................................................................
A0A2K6KI95_RHIBE/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q2ECL3_CYPVA/38-210              ...........................................chpqcldykppf-----....------.-EPQQ.....QLVF-.........................C.KDYTKF...............................GC....CDLQKDEE..ISRKFHS..iMK.NFD---..-........S..L..G...SK..........TCG.EYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSSYWLQCRYT.....LSLL...L...E-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dmgnpqqfanwtasieedrnrfcdflelkdkqycypnvltdaelnanlglvredpkgcle....
A0A067JV92_JATCU/29-192              ......................................vcvskggrfppfssegk-----....--PPKK.VSRGS.....KDLTL.........................C.RVFRRK...............................TC....CDVAQTYP..ALLSIRR...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.QIG--....VQP...........................................----..---.GPP.lIC....SS....FCDRVYQACANA.....YFSM...D...S-.....NK.Q.VL..........................APCGV..ND---..-..YVC........GKAAEWV.SN..GTE.LC......RTA---.-----....-----................------gfavklsdyvhidteeascy............................................
H2Q4C3_PANTR/36-211                  .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.HHF...IQD..G.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..A..ALC........STFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A3S3R303_9MAGN/40-191              ..............................................fssegkppr-----....-----K.VAKGP.....KDLTL.........................C.RVFRKS...............................TC....CDAAQTHP..ALLSIRR...LA.-----S..A........G..E..G...SP..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....AS....LCDMVLQACANA.....YFSI...D...A-.....KT.Q.VL..........................S-PCG..FG---..D..IVC........GRATEWA.SN..GTE.LC......HQA---.-----....-----................------gfsvplnehsyqdtgdpic.............................................
H3B327_LATCH/36-213                  .......................................................RCLDG....TAPRRL.KKRDR.....KWSQDts....................vdiC.HKLYPR..............................lSC....CTRSGRQG..PSSDAKI...FS.------..-........V..T..N...NT..........ECV.KLL...EEI..K.CAY...-CSP.QAQNL....FYPpd.......................................ieEASG..REL.VIP.fLC....RD....YCKEFFQTCRGH.....VPG-...-...-L.....FP.T.TT..........................DEFCL.nYGRRD..G..GVCf.....pdFPRNQVR.GP..ASN.YL......DQMEEY.DKAEEn..sRKHKH................NCFCVQ................................................................
A0A1U7R1V5_MESAU/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RVMSQlells...............ggeilC.GGFYPR..............................vSC....CLQSDSPG..LGRLENK..iFS.------..-........S..T..N...NT..........ECD.RLL...EEI..K.CAP...-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYTRKD..G..GACf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.EKVEEl..sRKHKH................SCFCVQ................................................................
A0A384DFQ4_URSMA/1-168               ....................................................mel-----....------.KDKSG.....VFPTQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A226PHG7_COLVI/27-188              ..............................................qcldfkppf-----....------.RPPR-.....-ALAF.........................C.RRYGAF...............................GC....CDARRDRA..LLERFYR...LS.---AHL..D........G..A..T...YA..........ACA.GHL...QDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FHYL...S...TD.....PE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YCf....pH-----.-----....-----................------llanenlnqnlglvtadaegclq.........................................
A0A1V4L0L5_PATFA/141-276             .......................................................VCMDA....KHHKTE.PGPEG.....ELYGQ.........................C.SPWRDN...............................AC....CTANTSLE..AHRDQSY...LY.NFNWDH..C........G..A..M...SS..........KCK.RHF...IQD..T.CLY...ECDP.NLGPW....IDEsd.......................................tsWRRE..RIL.HVP..LC....RE....DCEQWWDDCQDS.....VTCK...V...NW.....HK.G.WN..........................WTSVT..-----..-..---........-------.--..---.--......------.-----....-----................------pgppp...........................................................
A0A1S3K2Z7_LINUN/34-177              ...................................................ycsf-----....-FNNRA.PKPQP.....DLKN-.........................C.TWYKEN...............................SC....CLQREIDA..TFGKVKP...LQ.------..-........-..G..A...SK..........DCS.DYI...NYL..M.C-Y...ICAP.NQNLY....YRI...........................................----..--E.RLY..VC....EG....FCDSLYSACNSA.....ILKG...S...V-.....IR.D.L-..........................YSNGK..EFCES..-..---........-------.--..---.--......------.-----....-----................------rrfivrnasaescfdlheslvksgsichsnps................................
F1Q4J6_CANLF/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RLMSQlells...............ggevlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDTK...IF.S-----..-........M..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....IQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A286ZQ37_PIG/38-196                .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..R.CAL...-CSP.HSQSL....FHSp........................................erEALG..RDP.VLP.lLC....KD....YCKEFFYTCRGH.....I---...-...--.....-P.D.--..........................-----..-----..-..---........FPRKQVR.GP..ASN.YL......DQMEEY.DKVEDi..sRKHKH................NCFCIQ................................................................
H2N3N0_PONAB/47-205                  .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....DQHKDRRI..AARYWDI...ME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGR..DGT--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrqlgmvaqdpqgclq......................................
A0A2Y9M9H7_DELLE/27-177              ......................................................a-C---....GGSHPL.PARSQ.....RHHRL.........................A.SNLGTS...............................QL....HLAEMNTP..EASDPGI...VS.----GS..C........G..E..L...SP..........GCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....TIC-...-...--.....CP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A2K6L4W1_RHIBE/59-198              ......................................................a-C---....GGSHPL.QARSQ.....GHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGTGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAR.VQ..WHD.LC......S-----.-----....-----................------lq..............................................................
G1T5D7_RABIT/26-201                  .......................................................VCMNA....KHHKRE.PGPED.....ELYVE.........................C.EPWKDN...............................AC....CTPTTSWE..AHLDVSP...LY.NFSFVH..C........G..L..L...TP..........DCH.RHF...IQA..I.CFY...ECSP.NLGPW....IQPvd.......................................psGPEQ..RAM.DVP..LC....HE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSRGR..NRCPA..E..APC........RPFPHYF.PT..PAD.LC......EKIWNN.TFKAS....PEHQG................SGRCLQ................................................................
G5E8D3_MOUSE/26-170                  .......................................................VCMNS....KRHKQE.PGPED.....ELYQE.........................C.RPWEDN...............................AC....CTRSTSWE..AHLEEPL...LF.NFSMMH..C........G..L..L...TP..........ACR.KHF...IQA..I.CFH...ECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHSS.....LTCK...S...NW.....LH.G.WD..........................WSEE-..NGT--..-..---........-------.--..---.--......------.-----....-----................------pskvlvktaee.....................................................
A0A3B4T3H9_SERDU/47-222              .......................................................MCMDA....KHHKVE.PGPEG.....KLYLQ.........................C.SPWRDN...............................AC....CTANTTAE..AHNDNSY...LY.NFNWNH..C........G..V..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qsWRKE..RIL.DVP..LC....ME....DCHNWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGV..NKCPE..S..SKC........RKWTEVY.PT..PKS.MC......ELIWSN.SYLYT....THSNS................SGRCMQ................................................................
U3I6W0_ANAPP/48-153                  .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQ...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------mwfdpakgnpnvvvakyyawkk..........................................
R0JWY8_ANAPL/31-206                  .......................................................VCMDA....KHHKTK.PGPEG.....TLHGQ.........................C.APWKDN...............................AC....CTANTSSE..AHRDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...D...NW.....HK.G.WN..........................WATGT..NRCPW..G..SIC........RPFSEVF.PE..PKD.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
G1R071_NOMLE/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G1QJ55_NOMLE/22-183                  ...............................................qcldfrpp-----....-----F.RPPQ-.....-PLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A2K6N9T0_RHIRO/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDISR...LY.NFNWDH..C........G..K..M...QP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WSSGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
A0A3Q2DXE5_CYPVA/26-204              .......................................................VCLQD....GKHKAT.PGPEP.....NLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..sNK.NEPWDK..C........G..P..L...SP..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQevgeag...etvgegrPCGC--lt..............................................................
A0A2K5R2D8_CEBCA/48-206              ..............................................ygppfrpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HK..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...S-.....DR.G.LQ..........................ESPGT..DGA--..-..---........RFCHRLD.LP..DKD.YCf....pN-----.-----....-----................------vlrndylnrnlgvvaqdprgclq.........................................
C3Y0S4_BRAFL/3-162                   .............................................pfepaeplvf-----....------.-----.....-----.........................C.REYGDF...............................GC....CTRRQDYE..LQRQFDD..iMR.RMP---..-........Y..H..L...QT..........SCH.HHV...MNI..L.C-Q...ECSP.YASHL....YDL...........................................ETTQ..VKK.PLP.gMC....PQ....YCPTVFDSCKDI.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------itgdptvqhaitlsnytqfcevtsitdmdycypnllaneqlsgdiqeavqgtggegclcfq...
A0A3Q0SB82_AMPCI/24-197              ......................................schpqcldykppfgprq-----....------.-----.....-PLNF.........................C.KEYSKF...............................GC....CDLEKDEE..ISGRFYT..iME.N--FDH..S........G..-..-...YA..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRYT.....LSLL...L...ED.....LG.N.PQ..........................QFANL..TATIE..E..DRR........KFCEVLE.LK..DKE.YCy....pN-----.-----....-----................------vltnaelnanlgslnedpegcle.........................................
A0A2K6RR53_RHIRO/47-222              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
G1NDJ8_MELGA/23-190                  ......................................................g-CLEG....DTHKVK.PSPEP.....NMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPVI..kVS.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....INP...........................................RYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICA...R...NW.....LT.D.WE..........................RDESG.eNHC--..K..SKC........MPYGEMY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A3M6V5B8_9CNID/42-193              ......................................................y-CP--....YFKNRG.PSRQE.....NLRN-.........................C.SWYKEN...............................SC....CHDEEIEF..AFRQLSP...LE.------..-........-..G..A...NG..........QCA.QYM...NYL..Y.C-Y...ICAP.NQNTF....FKD...........................................----..--F.TLT..VC....EE....FCDHIYNACQNA.....ILKG...R...KL.....EH.V.YKsgq....................efcKARRF.kTDKEA..H..GKC........FTYK---.--..---.--......------.-----....-----................------gkpntksasqqlsvnskyaghne.........................................
A0A3Q0FNI2_ALLSI/26-201              .......................................................VCMDD....KHHKAN.LGPVG.....ELHGQ.........................C.TPWKAN...............................AC....FTGNTSTE..AHRDQSY...LY.RFKWNH..C........G..V..M...LH..........KCQ.HHF...IQD..N.FLY...ECSP.NLGPW....ILKtd.......................................ssWQRE..RIL.HVP..LC....KE....DCEEWWENCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NHCPW..G..TVC........RPFKLVF.PR..AAV.LC......EKIWSD.SYKYT....TAPRD................RGRCIQ................................................................
A0A1S3G802_DIPOR/228-357             ................................................sesifsa-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECG.RLL...EEV..K.CAP...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....PD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKAEEi..sRKHKP................NCFCVQ................................................................
A0A384APX0_BALAS/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2I4H1H5_JUGRE/32-195              ....................................vcvsqggrfppfssegkpp-----....----RK.VSKGA.....KDLTL.........................C.RVFRRK...............................TC....CDVAQTYP..ALLSVRR...LA.S-----..T........G..E..G...SP..........ECM.HLW...ELL..E.CSI...-CHP.RVG--....VQA...........................................----..---.GPP.lIC....SS....FCARVYEACSNA.....YFSM...D...AK.....-A.Q.VL..........................APCGL..K----..D..FIC........GRASKWV.SN..GTE.LC......LA----.-----....-----................------agfsvnptdemymstedtscy...........................................
F6YV89_HORSE/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GAFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.ELP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEm..sRKHKH................NCFCIQ................................................................
M3YLD8_MUSPF/27-201                  .......................................................VCMNT....KHHKRE.PGPED.....QLYKE.........................C.NPWRGN...............................AC....CRADTSLN..THLDLPL...LY.NFSLHH..C........G..V..M...LP..........DCE.KHF...LQA..I.CLY...QCSP.NLGPW....IQKld.......................................sgGPGE..RIL.EVP..LC....WE....DCEQWWEDCRTS.....YTCK...A...DW.....-H.G.WD..........................RTEGK..NLCPA..Q..AFC........HPFPHYF.PT..PVD.LC......EKIWSH.SFKAS....PEHRN................SGQCLQ................................................................
H9GQT5_ANOCA/10-102                  ...............................lhafyvlsretsqskatfynlsls-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....-S....LCR--YDACKND.....FICV...K...NA.....LT.D.WE..........................IDERG.eNHC--..K..NEC........ISYRKMY.AN..GTE.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
A0A2Y9F2Q7_PHYMC/34-209              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTAGY..NQCPV..R..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A3Q7SWQ2_VULVU/56-197              ..................................stalssvsssvkrgadqfmqt-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.----VE..C........P..A..C...VR..........RCT.PGV...QQPgpL.PSE...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNK.NLNSNl..gRVVAD................AKGCL-q...............................................................
A0A2K5RGK0_CEBCA/20-181              ..............................................qcldfrppf-----....------.--RPQ.....RLLAL.........................C.SRYSVF...............................GC....CDEKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRHL...S...TD.....KK.L.WA..........................LEDNR.dKFC--..-..---........---HYLS.LD..DMD.YCy....pNLMVN-.-----....-----................------knlssdlghmvadatgclq.............................................
A0A3P8P175_ASTCA/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfkenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
S4RHD7_PETMA/30-210                  .......................................................ICMDA....KHHKTK.PGPEG.....LLYGQ.........................C.EPWKDN...............................AC....CNANTTEQ..AHEDQSY...LY.NFNWNH..Cws...lgqP..K..L...SD..........KCK.KHF...VQD..T.CLY...ECSP.NLGPW....IQKtd.......................................ssWRKE..RIL.NVP..LC....KS....DCQSWWNDCRND.....YTCK...E...NW.....HS.G.WE..........................WINGT..NLCPP..D..SQC........QMFDVIF.PT..PKD.LC......ERIWSS.SYKYT....EDDRG................SDRCIQ................................................................
A0A0A0MVH3_PAPAN/59-215              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2K6T2M9_SAIBB/59-215              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....FCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A452SU57_URSAM/30-205              .......................................................VCMDA....KHHKAK.PGPED.....KLHNQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
W4XKK9_STRPU/19-164                  ................................................qcldfyp-----....----PF.ELPSD.....SQP-F.........................C.DGYKDF...............................GC....CTLTQNEA..IRERYQT...LK.R---NL..P........E..S..A...AH..........ECR.NFL...KDI..L.C-Q...ECSP.YAAHL....FDA...........................................ETTH..RKT.PLP.gLC....GG....YCSSLYNTCPEL.....IPLV...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tddaaiidahntnesafcaaveigdmdycypnilqdtf..........................
A0A2K6C7H9_MACNE/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRVD---..-........T..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....--.-.--..........................--QEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A0P7ZE86_SCLFO/55-199              ...........................................qcldfeppfglp-----....------.-----.....HHLEF.........................C.REYEKF...............................GC....CDQDMDNR..IAERYWD..iMD.LYD---..-........M..Q..G...DE..........LCG.QFI...KNI..L.C-Q...ECSP.YAAHL....YDA..........................................eDSYT..PIR.HIP.gLC....SN....YCSEFHVNCRSM.....VKH-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ltddkgllevcqkdpikfcnllslpdpdycypdvlhst..........................
A0A2U3YCG8_LEPWE/27-213              .......................................................VCMNT....KHHKQE.PGPED.....KLYEE.........................C.LPWQDN...............................AC....CTAGTSWE..AHLDVSL...LY.NFSLLH..C........G..V..M...MP..........GCE.KHF...LQA..V.CFY...ECSP.NLGPW....IRKvrrlgwg............................ggrhmdsgGPGE..RIL.DAP..LC....QE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.S.WD..........................RSGGK..NRCPA..R..AVC........RPFPHYF.PT..PAD.LC......EKIWSR.SFKAS....PEHRG................SGQCLQ................................................................
A0A3P9B4E6_9CICH/28-209              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTQEQIQD..ISHVPSA..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..L.CFY...RCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
A0A2D0S2Z2_ICTPU/42-208              .......................................................ACLQD....GHHKSM.PSPEP.....NLKE-.........................C.SSYMEN...............................AC....CSAQDIED..LTASTSS...V-.--SWDR..C........G..S..L...ST..........VCE.EFL...KRV..I.CFY...RCSP.DATYW....PHP...........................................QRGS..SLR.VVP..LC....HS....FCRDWYEVCKSD.....LTC-...-...--.....AR.D.WT..........................RDPRG..LNC--..T..GSC........IPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEALev...........kgrGCGCLN................................................................
G1KRJ2_ANOCA/23-190                  ......................................................k-CLGG....GGHKDI.PTQEN.....NLKE-.........................C.TLYTKS...............................SC....CHADITEE..LAHSPVI..kVN.TTYWNR..C........G..N..H...SK..........LCE.DYL...KKI..E.CFY...RCSP.HAAFW....AHH...........................................QYEA..AID.SVP..VC....KT....FCDNWYDACKND.....FICV...K...NA.....LT.D.WE..........................IDERG.eNHC--..K..NEC........ISYRKMY.AN..GTE.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
M7BJ70_CHEMY/12-178                  .......................................................RCLAG....GKHKVA.PSPEG.....QLGV-.........................C.QLYAAN...............................AC....CSPKVAQE..ISSAPLA..kVN.DISWNR..C........R..S..L...SP..........RCK.HYL...QRV..E.CFY...RCSP.SAARW....PHP...........................................QRPT..AVL.EVP..LC....LS....FCEAWYEACKDD.....LTCA...R...NW.....VS.D.WQ..........................WGPQG..NNC--..S..RDC........VPYSQMY.RD..GRE.LC......ENIWGD.SFVAA....---RE................PCPCL-s...............................................................
G3U6S7_LOXAF/49-130                  .......................................................VCMEA....KYHKTK.PGPED.....KLYGQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ECA.T--...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ssrtpvsmsapptwgpgsk.............................................
A0A3P9C2F5_9CICH/21-183              ............................................qcldfkppfkp-----....------.--PW-.....-HLEF.........................C.NQYEQF...............................GC....CDQGTDNM..IAERYWD..iIE.QLE---..-........A..A..G...HE..........LCT.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRHV.....LKYL...-...-T.....VN.Q.LL..........................LYAAE..RDV--..T..TFC........SMV---D.LP..DQD.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
U3K058_FICAL/31-207                  .......................................................VCMDA....KHHKRE.PGPEG.....QLYEQ.........................C.SPWKDN...............................AC....CTANTSAE..AHRERSL...LY.NFNWRH..C........G..A..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IEQvg.......................................laWALP..GIQ.GCP..PC....QG....TISLQHLGCLNF.....SHSV...E...SF....qGF.S.WP..........................LTDGR.tNRCPW..G..SMC........RPFRQVF.PR..PRD.LC......EKIWSG.SFSYS....PERRG................SGRCI-................................................................
F5H3Z4_HUMAN/45-198                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......------.-----....-----................------................................................................
A0A1U8I9H5_GOSHI/43-205              .....................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRR...LA.L-----..T........G..E..A...SE..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGA..NDF--..-..-VC........GRASEWA.SN..GTE.LC......LAA---.-----....-----................------gfrveqsvgmhggieeescy............................................
A0A1S3ABQ2_ERIEU/54-180              ....................................................lhq-----....------.-----.....-----.........................-.------...............................--....----ADSE..MDMSPEM...VL.GTLPDH..C........R..P..P...SS..........RCQ.SFL...GDL..R.VRL...QSRF.HLLLL....GNR...........................................----..--H.PWP..LC....QE....LCDTWLASCETD.....PAC-...-...--.....TP.A.WL..........................SITGS..RLC--..P..AGC........RTYAKLF.PD..GAD.VC......RWALGP.ALPMA....--PPG................SQRCLN................................................................
F7GMI4_CALJA/22-183                  ...............................................qcldfkpp-----....-----F.--RPP.....QLLTL.........................C.SRYSAF...............................GC....CDAKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRH-...-...--.....--.-.FS..........................TDKAL..RAL-E..D..NRD........KFCHYLS.LD..DTD.YCy....pDLMSNK.NLNSDl..gHMVAD................ATGCL-q...............................................................
A0A093QB07_9PASS/21-188              ......................................................g-CLEG....DTQKPK.PSPES.....DMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAPSPVI..kVS.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWYEACKDD.....SICA...R...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........IPYSEMY.AN..GTD.MC......QNMWGE.SFKVS....---KS................SCLCLQ................................................................
A0A2K5HJW8_COLAP/42-217              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....RTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A287U6R1_HORVV/44-197              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFSI...-...D-.....MK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....-----................------daslsevdetfcyg..................................................
B9RFD1_RICCO/36-198                  ......................................ctskggrfppfssegkp-----....---PKK.ISRGS.....KDLTL.........................C.RVFRKK...............................TC....CDVAQTYP..ALLSVRR...LA.S-----..A........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.NIG--....IQP...........................................----..---.GPP.lIC....SS....FCDRVYEACATA.....YFSM...E...AK.....-T.Q.VL..........................APCGV..NEF--..-..-VC........GKAAEWV.SN..GTE.LC......HSA-GF.AVKVA....D----................------dtyhgtegafcy....................................................
A0A2K6AU43_MACNE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2Y9F811_PHYMC/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2R2MQE2_LINUN/5-177               ...................................................pgfs-----....-----K.PSPSP.....DTKLE.........................C.IRYRDR...............................SC....CKPGITNT..FEENENF...QN.ITIYNI..Cp.....qkS..S..L...SS..........ACH.REF...FDE..L.CFF...LCSP.NIGPW....ITEath.....................................daaPEKE..RFK.DVP..LC....AS....ECNRWWDACKHE.....FTCY...V...NW.....YN.D.VV..........................RDANG.lNICGP..G..QQC........RRYDAIY.NS..STN.FC......ETIWDF.SFKVT....---PD................DQPCM-k...............................................................
A0A3Q0D6Q1_MESAU/43-204              ............................................cldygppfrps-----....------.-----.....LHLEF.........................C.SDYDSF...............................GC....CDQRKDHR..IAARYWD...IM.NYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHRSCHSA.....ISLL...T...SD.....-R.S.LQ..........................ESHG-..-----..K..DGA........RFCHLLN.LP..DED.YCf....pNVLRNS.QLNRNl..gVVAED................HKGCL-q...............................................................
A0A0Q3U3A0_AMAAE/333-508             .......................................................VCMDA....KHHKTK.PGPEG.....MLHEQ.........................C.APWKDN...............................AC....CTANTSLE..AHKDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....RE....DCEQWWEDCRDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PX..PKD.LC......EKIWSN.SYRYT....TEQRG................SGRCIQ................................................................
A0A067QXU6_ZOONE/110-207             .................................................qvsmki-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................-RNE..RFY.QVP..LC....ES....ECIAWFSACVDD.....YTCT...D...NW.....VR.N.LV..........................WNKQG..NHCKK..G..LEC........KTFKEIF.GT..AEN.FC......EKVL--.-----....-----................------clfclkvwddswkytpdnqpcmk.........................................
A0A1Q3DEW2_CEPFO/27-190              .......................................cisqggrfplfasegk-----....--PPKK.VSRGS.....KDLTL.........................C.RVFRQK...............................TC....CDAAQTHP..AFLSIRR...LA.S-----..T........G..E..A...SS..........DCL.HLW...ELL..E.CSI...-CDP.LVG--....VQP...........................................----..---.GPP.lMC....SS....FCDRVFDACANA.....YLSM...D...A-.....KT.Q.VL..........................SPCGV..NDF--..-..-IC........GRASEWV.SN..GTE.LC......RAA-G-.-----....-----................------favkisdyqysdveetscyg............................................
A0A060ZA98_ONCMY/1-169               .......................................................-----....------.-----.....-----.........................C.APWKDN...............................AC....CTANTSAE..AHDDNSY...LY.NFNWNH..C........G..I..M...TS..........KCK.KHF...TQD..T.CFY...ECSP.HLGPW....IQQvd.......................................qsWRKE..RIL.YVP..LC....QE....DCHSWWDDCKDD.....FTCK...Q...DW.....HY.G.WD..........................WTTGT.hTHTHI..Y..THT........HIYTHTH.TH..THT.HT......HTHTHT.H----....-----................------ththththtqrqshvlyssspeadlclt....................................
H3AJ36_LATCH/1-106                   .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........-CE.GYL...KKL..D.CFY...RCSP.DAARW....SHA...........................................ENPA..TLI.EVP..LC....LG....FCNKWFEACKND.....LTCN...W...NW.....KT.D.M-..........................-PKGL.qENC--..T..GDC........ITYGQMY.RN..AKH.LC......NNIWGD.FFSVA....---KK................PCRCL-s...............................................................
A0A2K6UMR7_SAIBB/36-211              .......................................................VCMDA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.NFNWNH..C........G..E..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCRTS.....KTCK...S...NW.....HK.G.WN..........................WTSGS..NECPV..G..ATC........EYFHSYF.PT..PTA.LC......NEIWSH.SFKVS....NYSRG................SGRCIQ................................................................
G3TAX8_LOXAF/39-200                  ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.TQYSGF...............................GC....CAAERDEV..LARRFGA...LA.A---SL..D........A..A..V...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....IRHL...S...PD.....RE.L.WA..........................LEGNR.aKFC--..-..---........RYLS---.LD..DAD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCL-q...............................................................
A0A2K1XZF1_POPTR/29-191              .......................................vcvskggrfppysseg-----....------.KPPKKvgkgaRDLTL.........................C.RLFHKK...............................TC....CDVAQTYP..ASLSVRR...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACASA.....YFSM...D...AN.....--.-.--..........................KRVIA.pCGV-N..D..FVC........GQAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklsdanvgveevscy.............................................
A0A287BP62_PIG/29-204                .......................................................VCMDA....KHHKPK.PSPED.....KLHDQ.........................C.SPWRKN...............................SC....CSVNTSLE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qkWRRE..RIL.NVP..LC....KE....DCQNWWEDCRTS.....YTCK...S...NW.....HE.G.WN..........................WSSGY..NRCPA..N..AAC........HPFDFYF.PT..PAA.LC......SQIWSN.SYKQS....NYSRG................SGRCIQ................................................................
A0A1S3JNS0_LINUN/23-192              ......................................................k-CLEG....PYHKDK.PSPEG.....NDYVE.........................C.LSWKRS...............................SC....CLANVTQQ..IATHKAK..nLH.NYEWDR..C........G..T..L...SQ..........ACE.LFI...KDE..L.CFY...RCEP.ALVRF....PAA...........................................-TKG..NVK.GIP..IC....AK....YCNDWFEACKDD.....RTCV...A...DW.....LA.D.FD..........................FSRGE..NHCPT..G..SQC........RTFADVY.KN..GQG.LC......ERMWGE.AFTYE....----T................SNNCM-vmk.............................................................
FOLR2_HUMAN/30-205                   .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
#=GR FOLR2_HUMAN/30-205        SS    .......................................................---SB....TT--SS.-B--T.....T--GG.........................G.GGGTTS...............................BS....S-HHHHHH..TTSTT-T...TT.---TTT..T........S..-..-...-H..........HHH.HHH...HHH..H.HHH...HH-S.S-GGG....EEEEE.......................................ETTEEE..EE-.SEE..EE....HH....HHHHHHHHHTTS.....EES-...S...-S.....SS.-.-B..........................-TTSS..-B--T..T..---........EEHHHH-.SS..HHH.HH......HHTTTT.SEEEE....SS-TT................SSSSB-................................................................
A0A340XP17_LIPVE/34-209              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGY..NQCPV..R..AAC........HRFDFYF.PT..PAD.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A267GZF5_9PLAT/45-230              ......................................................l-CMMG....RLHKAE.PGPEP.....GLTTG........................pC.IGYSDN...............................SC....CTAEVGSL..LGSDDEF..aQA.AFRLDH..C........G.rR..L...SA..........ECE.KWF...ECS..R.CLY...ECSP.NLGPW....LVKvs......................................gysWRTE..RAY.GVP..LC....HS....QCQAWYAACAAD.....LSCV...P...NW.....SS.G.FRwi.....................rqaNGSGY.vNVCPD..GglAQC........RSIAQLHnHK..AEQ.FC......ETVWDG.EFKVV....---PD................GSPCFQ................................................................
A0A2K6T2H0_SAIBB/37-193              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....FCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
K7EIS2_HUMAN/27-183                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
M3WR11_FELCA/31-206                  .......................................................VCMDA....KHHKEK.PSPED.....ELHEQ.........................C.RPWKKN...............................SC....CFANTSRE..AHKDISY...LY.RFNWDH..C........G..Q..M...AP..........ACK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGH..NRCPV..G..AAC........HHFHFYF.PT..PAA.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A251TBJ9_HELAN/46-194              ............................................tiqgkpprrvs-----....------.--KGP.....TDLTL.........................C.RVFRKN...............................TC....CDVTQTHP..ALLAVRR...LA.S-----..S........G..E..A...SD..........ECL.HLW...ELL..E.CSI...-CDP.HVG--....VQS...........................................----..---.GPP.vIC....AS....LCDRIYDACSNA.....YFA-...-...--.....MD.G.KN..........................QVLVP..CGI-S..D..TVC........GRASEWV.SN..GTE.LC......KAS-GF.SVKPS....-----................------ndlketfcyg......................................................
A0A2I3TNA5_PANTR/37-193              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
R7VC87_CAPTE/22-180                  ............................................qcldfrppfen-----....------.----M.....ELLEF.........................C.SQYSDF...............................SC....CTNSRDRE..LESKYLS...LV.------..-........N..T..L...SM..........ECR.EKL...QEM..L.C-Q...ECSP.YAIHI....YDA...........................................ERSG..VVNnTFP.gLC....RS....YCTDLVPSCRNI.....IPL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------itedqiyinamqstddfcslveltdreycypdlltdprlngdieretrnsagcmcl........
A0A3B4CK08_PYGNA/27-199              .......................................................ACLQD....GRHKAT.PSPEP.....YLKE-.........................C.SMYTEN...............................AC....CLEQDIDD..LTSPPAG...AD.SAPWDR..C........G..T..L...SP..........VCE.AFL...KRV..V.CFY...RCSP.HAAHW....PHP...........................................QRDS..FLK.AVP..LC....HS....FCRDWYEACKTD.....LTC-...-...--.....AR.D.WA..........................GDPRG..QNC--..T..GSC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEAGeedr........veghGCGCL-t...............................................................
A0A2K5ZD61_MANLE/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A3B4T9N7_SERDU/37-210              ..............................................schpqcldy-----....--KPPF.EPRQP.....LVF--.........................C.KEYSKF...............................GC....CDLEKDEE..VSVKFYT..iME.NF--DH..S........G..-..-...FA..........TCG.KYI...RTI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....RD....YCSNYWHQCRYT.....LSLL...L...EN.....-T.G.SP..........................QQFAN.lTATIE..D..DRR........RFCDYLE.LK..DKQ.YC......------.-----....-----................------ypnvltnaelnanlglvredpkgcle......................................
W5KAU7_ASTMX/41-203                  ...............................................pqcldykp-----....----PF.QPLEP.....LVF--.........................C.KEYAKF...............................GC....CDLDRDNQ..ISRQFYQ...IM.EY-FDH..S........G..F..M...--..........VCG.KYI...RNI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....RG....YCNDYWQQCRYS.....LSLL...T...NN.....NI.T.ET..........................IEENQ.eKFC--..-..---........-------.--..---.--......------.-----....-----................------dylelkdpeycypnvlssdelnanlgnvqadrkgclq...........................
A0A0E0G967_ORYNI/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
A0A287BB49_PIG/38-220                .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..R.CAL...-CSP.HSQSL....FHSp........................................erEALG..RDP.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEDi..sRKHKH................NCFCIQ................................................................
A0A2K6KI91_RHIBE/47-222              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3SI27_9TELE/80-245              ......................................................s-CLGG....AHHKNA.PGPER.....NMRE-.........................C.FTYSNS...............................SC....CHANFTEK..LVSPVTK...VD.NTSWIT..C........G..N..L...SD..........RCE.AFM...KKI..E.CFY...QCSP.HAAHW....VNK...........................................DYPA..GFL.NVP..VC....VS....FCDGWLEACKDD.....LTCA...K...NW.....LT.D.FK..........................LDIDG..NHC--..Q..HDC........VPFSKMY.SN..GTD.LC......NSMWGP.SFTAS....---SS................NCACLQ................................................................
G1LWD6_AILME/34-202                  .......................................................VCMDA....KHHKIK.PGPED.....KLHGQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EL..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREl........................................rqGCGR..PHP.HAP..LR....GA....QGRAWWGGERGW.....G---...-...--.....LR.I.WG..........................WPERI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A3Q0SDH6_AMPCI/30-191              .............................................qcldfkppfr-----....------.---PQ.....RELEF.........................C.VMYKEF...............................GC....CDYQKDQE..LMAKYYK..iVD.NFD---..-........Y..Y..G...YA..........NCA.GFV...LEL..L.C-Q...ECSP.YSAHL....FDA..........................................eDPST..PVR.TIP.gLC....SD....YCFQFWKKCHFT.....IPFL...S...--.....--.-.--..........................GDPNI..AKV-K..G..NQT........RLCDYLE.LH..DKD.YCy....pHLLSNQ.QLTQNl..gRVQSN................SDGCLQ................................................................
A0A287AG84_PIG/27-206                ......................................................a-C---....GGSHPL.PARSR.....RHHQL.........................A.ADLGTVqlhqgstrpwfpna..mmmqdrnsqdfpslwPS....CPSAMDTS..EVSGLGI...--.--SAES..C........G..E..L...SP..........RCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gV--...........................................----..-LQ.TQP..LC....SE....LCDAWFATCESD.....FTCS...-...--.....-S.T.WL..........................PLVEK..RGC--..K..PIC........STYGQTF.AD..GAG.LC......RSVLGY.VLPVA....--DPG................SSPCLN................................................................
A0A3B3UE12_9TELE/65-243              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..rNK.NEPWDK..C........G..P..L...SS..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRLD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeageag...engaegrP-----cgclt...........................................................
E2RQM1_CANLF/29-185                  ......................................................a-C---....GGSRPL.PALSR.....RHHRL.........................A.ADLGTGqlh.........................lagSC....CPPEMDTP..EASGPGM...VS.----EH..C........G..K..P...SP..........GCE.SFL...GHL..Q.VAL...HNRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDIWFATCESD.....ITC-...-...--.....GP.T.WL..........................PLLEK..RGC--..E..PRC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................ADHCLN................................................................
A0A3B4V0D4_SERDU/28-209              .......................................................MCLQD....GKHKAT.PSPEP.....HLRD-.........................C.ALYADN...............................SC....CTEEGIQD..ISHVPSA..sNK.NEPWDK..C........G..P..L...SS..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFVACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GAC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPEdvgeageigvegdgsrP-----cgclt...........................................................
A0A3B4GEC7_9CICH/36-208              .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKI...............................GC....CDVEKDEE..ISGRFYN..iME.N--FDH..S........G..-..-...YA..........ACG.KYV...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDADT..PMR.ALP.gLC....GD....YCSDYWRQCRYT.....LSLL...L...ED.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle.....
M3XH66_LATCH/42-190                  .............................................qcldfkppfk-----....------.--PQ-.....KELAF.........................C.VMHKDF...............................GC....CDSLKDAA..LITRFYS..iVE.HLD---..-........T..E..R...YA..........TCA.GYV...QDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPTT..PMR.TIP.gLC....KD....YCSVLWQKCRPI.....FGL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------isedshlatlennveklcdylaledldycfphllsnekltqn......................
A0A2U4BPU2_TURTR/34-209              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...KP..........ACK.HHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGY..NQCPV..R..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A2J7QBQ4_9NEOP/1-132               ......................................................x-----....------.-----.....-----.........................-.------...............................--....CTHNTTRN..AHHSN--...LY.NFNYDH..Cs.....hkK..N..M...SI..........DCR.RHF...TQD..L.CFY...ECSP.NTGPW....TVKvs.......................................mkTRNE..RFY.QVP..LC....QS....DCIAWFAACIDD.....YTCT...D...NW.....FR.N.WV..........................WSKQG..NRCEE..G..LEC........RTFKEVF.GT..AEN.FC......EKV---.-----....-----................------lcl.............................................................
A0A3Q1EF35_9TELE/26-207              .......................................................VCLQD....NKHKAT.PSPEP.....HLTE-.........................C.GLYADN...............................SC....CTEEHIQD..ISYVPSA..sSK.NEPWDK..C........G..R..L...SP..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HRHS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigsegdgsrpcgclt..........................................
E9PYD9_MOUSE/34-137                  .......................................................VCMDA....KHHKEK.PGPED.....NLHDQ.........................C.SPWKTN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..T..M...TS..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DC----------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A1L8H304_XENLA/26-180              ......................................................k-CLPG....RTPNLL.PEAEA.....NLLQ-.........................C.QQYSEK...............................AC....CTQEQINA..HP-----...IT.SFPWGL..C........G..P..L...SS..........SCE.KYV...SRV..Q.CMY...LCSP.HISAF....WNQ...........................................DSDT..GIY.NLP..LC....SG....FCNQWFEACKED.....LICT...-...--.....--.-.-L..........................TNETI..PRC--..A..DAC........VPYKQMFkSE..GED.LC......NGIWGD.SLVAS....---SE................NCACVN................................................................
A0A3Q3F7P7_9LABR/29-190              ...........................................cldfeppfkplw-----....------.-----.....-HLEF.........................C.TQYEEF...............................GC....CDQKTDNV..IAERYWD..iID.QLE---..-........V..S..G...YE..........LCA.DML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHGKCRHA.....VKYL...T...E-.....-N.R.LL..........................RDTSG..RDA--..S..TFC........SLVD---.LS..DQD.YCy....pNVLKSQ.DLNSNl..gRVAED................PRGCLQ................................................................
A0A2K5JMS7_COLAP/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlelln...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A0R3WW82_HYDTA/36-215              .......................................................MCPES....GHLKEH.PSPEP.....DLDE-.........................C.TEWKDR...............................TC....CPRETATL..IASAT--...LH.GFSFNF..C........E..N..M...SK..........PCR.DFF...HYD..Y.CMI...KCSP.DLGPW....IVKlt.......................................ssRFKE..RAF.RIP..LC....ES....DCNAWYEACKED.....KACA...I...NW....rSG.G.FD..........................WSEGT..NKCRD..G..FTC........VEISKLY.GS..AKT.FC......EHVWDH.SYRVV....PVESVavw..........nssDKHCM-h...............................................................
A0A1U7XLM8_NICSY/41-192              .............................................rfsnegkppk-----....-----K.VKKGP.....RDLNL.........................C.RIFRGK...............................TC....CDVTQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSNA.....YFSM...D...AK.....-T.Q.VL..........................AP---..CGV-S..D..FVC........GRASQWI.SN..GTE.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A2K5DR67_AOTNA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQLEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G1PDG2_MYOLU/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQqells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDHK...IF.S-----..-........V..N..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQNL....FHSp........................................erEALD..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYAKKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEl..sRKHKH................NCFCIQ................................................................
A0A3B3YMF8_9TELE/35-196              ..............................................qcldfkppf-----....------.--RPD.....RDFEF.........................C.IMYREF...............................GC....CDRQKDQE..LMARYYR..iME.NFT---..-........E..R..G...HK..........SCA.GFV...LEL..L.C-Q...ECSP.FAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNQCRSI.....IPFL...S...DY.....TP.L.--..........................----K..QAK--..D..DQN........RFCKLLE.LD..DAD.YCy....pHLLSNH.KLNQNl..gRVQKD................SDGCLQ................................................................
W2QZC1_PHYPN/33-184                  ............................................tcrsagvlkfd-----....--PKTH.PMQRT.....KGMEV.........................C.SKYRKS...............................TC....CNATHAHA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ALT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...-G.....GA.G.TL..........................APCYG..NAL--..-..-VC........SPLKSIA.NS..GAD.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
I3LDJ1_PIG/29-169                    .......................................................VCMDA....KHHKPK.PSPED.....KLHDQ.........................C.SPWRKN...............................SC....CSVNTSLE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qkWRRE..RIL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGE..-----..-..---........-------.--..---.--......------.-----....-----................------glggswveag......................................................
A0A498M645_LABRO/27-199              .......................................................ACLRD....GRHKAT.PSPEP.....HLKQ-.........................C.SLYMEN...............................SC....CSETDVQD..LSGSVSG...VD.NSLWDK..C........G..L..L...SP..........LCE.SFL...KRV..V.CFY...RCSP.DAARW....PHP...........................................HRDS..SLK.AVP..LC....HS....FCRDWYEACKMD.....MTC-...-...--.....AR.D.WT..........................TDPRG..QNC--..S..GGC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPGeedg........veghSCGCL-t...............................................................
A0A3B4AFX2_9GOBI/36-197              ..........................................qcldfkppfrplr-----....------.-----.....-ELEF.........................C.VMYKDF...............................GC....CDFQKDQD..LMAKYYT..iMN.HFD---..-........Y..D..G...YA..........TCA.GFV...QEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPNT..PVR.SIP.gLC....PD....YCTQFWDKCNAT.....LPHL...S...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ddphvtklkfdpkrlcqylelddadycyphllsnpqltqnlgrvqydsdgclq...........
H0UUP4_CAVPO/27-198                  .................................................acggsh-----....----PP.QARSQ.....GCHRL.........................A.TEAGTGelhlqasfsppyl....miqapgsqpalslePC....CPSEVDRP..AT-----...--.---GKR..C........G..A..R...SP..........GCE.SFL...RRL..Q.RAL...HRRF.RRQLL...gLHQ...........................................----..---.APP..LC....VE....LCEAWLTTCKAD.....GAC-...-...--.....SP.P.WL..........................PPSED..RGY--..M..PDC........LSYGQIF.AD..GAD.LC......RWALGD.TLPVA....--APG................SRHCLN................................................................
A0A2U3ZAQ4_ODORO/34-209              .......................................................ICMDA....XHHKTK.PGPKD.....KLHGQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDTSL...LY.NFTWDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSL.NLGPW....IWEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGF..NKCPA..G..TTC........RTFETYF.PT..PAA.LR......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A3Q0FY17_ALLSI/57-232              .......................................................VCMDA....KHHKTK.PGPEG.....ELHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.RHF...IQD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
RTBDN_ICTTR/27-208                   ......................................................a-C---....GGSHQF.QARSQ.....GHLGL.........................A.SNLGTNqvqlagdlqasgpqpymmiqdpdsqafplpePC....CPSEMDTP..ETSGPGI...FP.----PR..C........R..T..P...SS..........GCE.SFL...GHL..Q.RAL...RNRF.HLLLL...gVRQ...........................................----..---.APP..LC....EE....LCQNWFATCEAD.....ITC-...-...--.....GR.T.WL..........................WPSGK..RSC--..E..GRC........RTYGQTF.AD..GVD.LC......RSVLGH.ILPVA....--APG................SRHCLN................................................................
G3VZ16_SARHA/6-166                   ..................................................qlpil-----....------.-----.....----Q.........................C.SPWKKK...............................AC....CTANTSFA..IHEDASY...LY.NFNFNH..C........G..Q..M...TP..........ACK.RHF...IQD..S.CLY...ECSP.NLGPW....IQPvs.......................................ssWRKE..RIL.NVP..LC....KE....DCDQWWEDCRSS.....YTCK...E...NW.....HK.G.WN..........................WTSGI..NKCPI..Q..AAC........HPFTFYF.PT..PAS.LC......ENIWSR.SYNAS....SFGRG................SGKCIQ................................................................
A0A2U9CIJ6_SCOMX/57-218              ...........................................cldfeppfkpfw-----....------.-----.....-HLEF.........................C.RQYEQF...............................GC....CDQTTDNM..IAERYWD..iVE.HLE---..-........V..E..G...LE..........LCA.DVL...MEI..M.C-Q...ECSP.YAAHL....FDA..........................................eDPYT..PVR.DLP.gLC....FD....YCSDFHGKCRHV.....VKYL...T...E-.....-N.K.LL..........................R----..-DTAE..R..DAA........TFCSVAN.LS..DQD.YC......------.-----....-----................------ypnvlkspdlvgtlgqvvedpkgclq......................................
G3RFV1_GORGO/26-208                  .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
F6S8Y5_XENTR/23-177                  .......................................................RCLPG....RTPNLL.PRAEA.....KLLE-.........................C.QQYSEK...............................AC....CTQEQISA..HP-----...IT.NFPWGL..C........G..S..L...SP..........SCQ.KYV...SQV..Q.CLY...LCSP.HISAY....WNP...........................................DSDT..GIY.NLP..LC....SG....FCDQWFEACKDD.....LICT...-...--.....--.-.-L..........................TNETI..PRC--..A..DAC........VPYKQMFkAG..GKD.LC......NGIWGD.SLVAS....---PQ................DCSCV-s...............................................................
A0A1S3CUH7_DIACI/30-204              ......................................................w-CLDG....KFHKSL.PGPED.....ELHSQ.........................C.TPWKSF...............................SC....CTHNISKT..LH--YGN...LY.NFDLNH..Ca.....hiK..P..M...SV..........GCK.RHF...IQD..S.CFY...ECEP.NVRPW....AVRvn.......................................mtDRKE..RFY.KVP..LC....QS....DCEAWYRACEND.....YTCA...K...NW.....VT.D.FK..........................WGPGG..NKC-S..N..SKC........ITFREMFqNS..SKK.FC......EGIWDV.AWRRD....RR---................------hqsmyed.........................................................
A0A151MKL1_ALLMI/26-189              .......................................................TCLPG....GKHKAR.PSPE-.....SSLGL.........................C.QAYAHN...............................AC....CSPETAAE..ISTTGAR...--.DVAWDC..C........G..P..L...SS..........SCA.RYL...QQL..E.CFY...RCSP.GAAHW....LHP...........................................EHPT..ALH.RAP..LC....RD....FCQQWYNACRDD.....LTCA...Q...DW.....VR.D.WR..........................WGPEG..NNC--..T..GGC........APYSQMY.RD..GQD.LC......ETIWGD.AFVTE....---DP................PCPCL-t...............................................................
K1PDZ2_CRAGI/29-160                  .................................................fcsffg-----....---NRG.PKPQS.....NLRN-.........................C.SWFQTN...............................SC....CMQEEIDA..TFGKVKP...LI.------..-........-..G..A...SP..........ACQ.RYT...NYL..M.C-Y...ICAP.YQNRF....YKF...........................................----..--E.RLT..VC....EE....FCDDWFEACGSA.....ILKG...-...VV.....IK.D.L-..........................YNNGK..AFC--..K..G--........-------.--..---.--......------.-----....-----................------rsfevdmyanqrcynfdskl............................................
A0A2R9BIN5_PANPA/1-108               ....................................................agy-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.--A...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNR.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyvlinknlnsnlghvvadakgclq......................................
H2NEK1_PONAB/36-211                  .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......DGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A3P8ZWH6_ESOLU/23-198              .......................................................MCMDG....KHHKRK.PGPEG.....ELYKQ.........................C.SPWRDN...............................AC....CNANTSAE..AHEDNSY...LY.NFNWNH..C........G..I..M...TP..........KCK.QHF...IQD..T.CFY...ECSP.HLGPW....IQEvn.......................................qnWRKE..RIL.HVP..LC....QK....DCHNWWNDCQED.....FTCK...Q...NW.....HS.G.WN..........................WSTGY..NRCPA..D..TPC........RKWTDVF.PT..AQV.MC......EKIWSD.SYSYT....TLSNT................SGRCMQ................................................................
A0A0R4IXN7_DANRE/28-203              .......................................................MCMDG....KHHITE.PKPEG.....QLYQQ.........................C.SPWKDN...............................AC....CTANTTEE..AHQDNSY...LY.NFNWNH..C........G..I..M...ND..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPad.......................................esWRRE..RIL.DVP..LC....LE....DCESWYEDCKEE.....LTCK...Q...NW.....HK.G.WD..........................WSSGT..NRCPQ..D..SQC........RRWTEVF.PS..ARD.MC......EKIWSN.SYKHT....TLTKS................SGRCMQ................................................................
A0A2R9B8A1_PANPA/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........S..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A067EQR5_CITSI/29-192              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTE.LC......HAA---.-----....-----................------gfavklpddryidgeetscy............................................
A0A2T7PMZ6_POMCA/44-145              ......................................................k-CIDG....RNHKSQ.PGEES.....SLMSF.........................C.SPWKKR...............................SC....CTQETAEE..IHHDENW...LN.-FDRNH..C........G..E..L...SP..........SCR.EFF...IKD..L.CFY...ECSP.NVGPW....IVP...........................................EST-..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------pvqleehvkhlqifle................................................
A0A068V9B7_COFCA/53-201              .................................................ldegkp-----....---PRK.VSKGH.....RDLTL.........................C.RVFRHN...............................TC....CDVTQTHP..AFLSIRK...LA.S-----..A........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.vIC....VS....FCDRVYQACSDA.....YLSV...D...A-.....KT.Q.VL..........................APCGL..KD---..-..FVC........GRASEWI.SN..GTD.LC......RAA---.GFSVK...pSDDPQ................ELSC--yg..............................................................
F6XN05_XENTR/14-175                  ..................................................qcldy-----....--KPPF.QPSQP.....LDF--.........................C.SAYSSF...............................GC....CDSAQDEA..IASRYHY...IT.DF-LDH..S........G..-..-...VT..........ACG.DYI...RDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDVNT..PLR.DLP.gLC....GN....YCTEFWHRCRYT.....LSL-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------iieerdvteiegdlgkfcsflslddvnycypnvltnaelnsglgevkedeegclq.........
A0A2K5YE35_MANLE/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgivaqdprgclq......................................
I1P1R4_ORYGL/49-201                  .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
E1BGX8_BOVIN/44-206                  ...........................................qcldyrppfqpl-----....------.-----.....QHLEF.........................C.SDYESF...............................GC....CDQRKDHR..IAARYWD...IM.EYF-D-..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....IALL...T...ND.....-R.R.FQ..........................ESPGK..DGT--..-..---........RFCHLLN.LP..DKD.YCf....pNIL---.-----....-----................------rsdhlnrnlgtvaedrrgclq...........................................
A0A1D5Q8N0_MACMU/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A0A2I2YC44_GORGO/47-201              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WT---..-----..-..---........-------.--..SAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A0S3SQM8_PHAAN/36-196              ...........................................vcvsqggrfppf-----....KSEGSV.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CGVTHTHP..ALMSVRK...LA.TT----..-........G..E..A...NP..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VAA---.-----....-----................------gfrvsssdigfiaseeascy............................................
A0A2K6F2B6_PROCO/36-211              .......................................................VCMDA....KHHKAK.PSPED.....NLYGQ.........................C.SPWRKN...............................AC....CSVSTSQE..LHKDISG...LY.NFNLDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCRSS.....YTCK...S...NW.....QK.G.WN..........................WTSGI..NECPA..G..TAC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A087X2K1_POEFO/53-214              ..............................................qcldfkppf-----....------.--RPD.....RDLEF.........................C.IMYREF...............................GC....CDRQKDQE..LMARYYR..iME.NFT---..-........E..R..G...HK..........SCA.GFV...LEL..L.C-Q...ECSP.FAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNQCRSI.....IPFL...S...DY.....TP.L.--..........................-----..NQA-K..D..DQN........RFCKLLE.LD..DAD.YCy....pHLLSNH.KLNQNl..gRVQKD................SDGCLQ................................................................
A0A2K5HJY9_COLAP/33-208              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....RTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q3LHK4_9TELE/33-208              .......................................................MCMDA....KHHKTE.PGPEG.....QLYSQ.........................C.APWRDN...............................AC....CTANTTEE..AHNDNSY...LY.SFNWNH..C........G..V..M...SP..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qnWRKE..RIL.DVP..LC....VE....DCHNWWEDCKND.....YTCK...T...NW.....HK.G.WD..........................WSSGI..NKCPE..G..SKC........RKWTEVY.PT..PKS.MC......EQIWSN.SYLYT....THSKT................SGHCMQ................................................................
H0VLN7_CAVPO/34-160                  .......................................................VCMDA....KHHKEK.PGPED.....NLHQQ.........................C.SPWKKN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..E..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....QE....DCQRWWEDCKTS.....QTCK...S...NW.....HK.G.WN..........................W----..-----..-..---........-------.--..---.--......------.-----....-----................------................................................................
A0A3B3T870_9TELE/54-216              ...........................................qcldfeppfkpq-----....------.-----.....FHLEF.........................C.RDYEKF...............................GC....CDQDTDNS..IAERYWN...IM.DYYD--..-........M..Q..G...HE..........LCG.EFV...KNI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.NLP.gLC....FN....YCSEFHVKCQSV.....VRHL...T...N-.....--.-.--..........................DKRLQ..ESC-Q..K..DRS........KFCNLVN.LP..DQD.YCy....pNVLQSS.MLNLNl..gKVAKD................PKGCLQ................................................................
A0A1B0GQW7_MOUSE/29-87               .......................................................VCMDA....KHHKTK.PGPED.....KLHDQgpwkh..............rdslsqC.SPWKKN...............................AC....CSVNTSQE..LHKADSR...L-.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------yf..............................................................
A0A0D3E146_BRAOL/221-381             ..................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDLTM.........................C.RVFRKR...............................TC....CSPAQTTP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........DCL.HLF...ELL..E.CSI...-CNP.DVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKDA.....YFAS...N...AL.....--.-.-T..........................QTIGP..CGVND..D..IIC........VKASNWE.SN..GTS.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
A0A287BK62_PIG/31-206                .......................................................ICMNA....KPHKPE.PSPED.....KLYEE.........................C.IPWKHN...............................AC....CTADTSWE..AHLDVAL...LY.NFSLVH..C........G..L..M...MP..........GCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQQvr.......................................gaGWGE..RIL.DAP..LC....QE....DCEEWWADCRTS.....YTCK...S...NW.....LG.G.WT..........................WSRGK..HRCPA..R..ALC........HPFPHYF.PT..PAD.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
A7RPJ5_NEMVE/32-187                  ...............................................qctyygsg-----....------.RVPEE....aYSLSN.........................C.TWFRER...............................SC....CRHTEVTS..VFKGMMA...LN.------..-........-..E..A...SQ..........DCR.NHM...NYL..M.C-Y...FCSP.EQERW....YKN...........................................----..--S.RLH..VC....ES....LCDAVYEKCKDS.....SFQG...K...EI.....GA.E.--..........................YSNGK..EFC--..-..-EA........QFFHVVN.SK..DQE.-C......FDFDSG.LFGTA....-----................------sclstsstvyvavsliclk.............................................
A0A4D9B3N1_SALSN/50-198              ................................................snvgkpp-----....----KK.ASKGP.....RDLTL.........................C.RVFRKK...............................TC....CDVTQTHP..ALLSVRR...LA.S-----..S........G..E..A...SQ..........ECL.QLW...EFL..E.CSI...-CDP.RVG--....VQR...........................................----..---.GPP.iIC....GS....FCDRVYEACSTA.....YFAM...D...GK.....--.-.--..........................TQALA..PCSQD..D..FVC........GRASEWV.SN..GTE.LC......NAA---.GFSVK...pLDDPE................ESRCY-g...............................................................
I1IB47_BRADI/46-199                  .........................................fssegkppgraakg-----....------.----R.....RDLAL.........................C.RLFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.WVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSV...D...T-.....-K.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.AVQVS....EASP-................------tevdetfcyg......................................................
A0A3Q7WXT0_URSAR/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................lSC....CLRSDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A1S3V654_VIGRR/38-198              ...........................................vcvsqggrfppf-----....KSEGNV.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALMSVRK...LA.TS----..-........G..E..A...SP..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VA----.-----....-----................------agfrvtssdigfiaseeascy...........................................
F7GD25_ORNAN/21-180                  ......................................................s-CLSG....GQDKLM.PGPEA.....QLGA-.........................C.RLYSSI...............................FCisftCLSFPVHT..LGNSPFP..nPR.RPFIHE..C........N..R..I...SR..........RCE.SFL...QRI..E.CFL...RCSP.LAGGW....AHP...........................................QRRG..GVR.AVP..LC....EA....FCQDWFAACKAD.....LACI...H...NW.....VS.T.PE..........................RGPKG..KNC--..G..GGC........RTYAQLY.RD..GRD.LC......DSIGGD.S----....-----................------l...............................................................
E1BJL8_BOVIN/30-205                  .......................................................VCMNA....RYHKEK.PGPED.....KLHGQ.........................C.SPWKKN...............................AC....CFVNTSIE..AHKDISS...LY.RFDWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IREvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRTS.....YTCK...S...NW.....HR.G.WD..........................WTSGY..NQCPV..K..AAC........HRFDFYF.PT..PAA.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
A0A3Q2LEL7_HORSE/30-205              .......................................................VCMDA....KHHKQK.PGPED.....TLHEQ.........................C.NPWKEN...............................SC....CSLTTSQE..AHKDISH...LY.RFNWDH..C........G..R..M...EA..........IRK.RHF...IQD..T.CLC...ECSP.NLGPW....IQQvd.......................................qsWSKE..RIL.DVP..LC....KE....DCPCRWEDCHPS.....YTCK...T...NW.....HK.G.WN..........................CTSGF..NQCPV..E..AAC........RPFDFYF.PT..PEA.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2K5LBN5_CERAT/3-164               ..................................................paame-----....------.-----.....---VQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A453NZ04_AEGTS/34-187              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A091VAP1_NIPNI/31-206              .......................................................ICMDA....KHHKTK.PGPEG.....MLHDQ.........................C.APWKDN...............................AC....CTANTSSE..AHKDQSN...LY.NFNWNH..C........G..L..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PR..PKD.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
HIPL1_HUMAN/22-183                   ...........................................qcldfrppfrpt-----....------.-----.....QPLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWA...LAsRVD---..-........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....QE.L.WA..........................LEGNL.aRFC--..-..---........RY---LS.LD..DTD.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A3Q0FUI1_ALLSI/129-304             .......................................................VCMDA....KHHKTK.PGPEG.....ELHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.RHF...IQD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
A0A2P5RKS1_GOSBA/38-192              .........................................ppfssegkpskrvg-----....------.--KGH.....KDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRR...LA.L-----..T........G..E..A...SE..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSNA.....YFSM...D...A-.....KT.Q.VL..........................APCGA..NDF--..-..-VC........GRASEWA.SN..GTE.LC......LA----.-----....-----................------agfrveqsvgmhggieevscy...........................................
E2R888_CANLF/47-206                  .............................................dfgppfqpal-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQRKDRR..LAARYED...IM.DYL-D-..-........L..K..G...YE..........LCG.GYV...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....HRpR.GP..........................QEVDG.aHF---..-..---........--CHLLN.LP..DED.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaqdqqgclq......................................
A0A2K6V1Q0_SAIBB/2-158               ...................................................rppf-----....------.--RPQ.....QLLAL.........................C.SRYSVF...............................GC....CDEKRDAE..LTSRFWA...LA.NR---M..L........A..A..E...WA..........DCA.GYA...REL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRRL.....LRHL...S...T-.....--.-.--..........................-DKEL..RAL-E..D..NRD........KFCHHLS.LD..DTD.YCy....pNLMVNK.SLNSDl..gHMVAD................ATGCLQ................................................................
A0A093IA02_STRCA/3-129               ....................................................lsv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECV.KLL...EEL..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..REL.ALP.yLC....KD....YCKELYYTCRGH.....IPG-...-...-F.....LR.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..nRKHKH................NCFCIQ................................................................
A0A2K6L4U9_RHIBE/37-193              ......................................................a-C---....GGSHPL.QARSQ.....GHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGTGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
L5L0C6_PTEAL/26-177                  .......................................................ICMKA....KPHKQE.PSPED.....QLYEE.........................C.IPWRDN...............................AC....CTTNTSWE..AHLDVSL...LY.NFSLVH..C........G..L..M...MP..........DCQ.KHF...IQA..V.CFY...ECSP.NLGPW....IRQvd.......................................psGQRE..RIL.NAP..LC....QE....DCEQWWTDCHTS.....YTCK...S...NW.....HS.S.WD..........................WSQGE.vEGVWS..Q..GQ-........-------.--..---.--......------.-----....-----................------taavamklftgn....................................................
W5PJZ5_SHEEP/39-221                  .......................................................RCLNG....NPPKRL.KKKDR.....RMMSQpells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAV...-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K5U066_MACFA/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
M3YFP6_MUSPF/31-206                  .......................................................VCMDA....KHHKEK.PSPED.....ELHKQ.........................C.SPWKKN...............................SC....CSTNTSQE..AHKDISY...LY.RFNWNH..C........G..Q..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HQ.G.WD..........................WTSGY..NRCPA..G..AAC........LPFHFYF.PT..PAA.LC......SEIWTH.SYQAS....NYSRG................SGRCIQ................................................................
RTBDN_MOUSE/27-203                   ......................................................a-C---....GWSHPL.QTRSW.....GHPGL.........................A.AKVRTGqlqpaghpqssvlpsypriqvpgsqtppvpvPC....CTAEIDRP..ES-----...--.--LLES..C........G..A..P...SP..........ECE.FFL...GQL..Q.GAL...RDRF.HPQLF...gARP...........................................----..---.VQP..LC....PE....LCQIWFTTCQAD.....FIC-...-...--.....GP.T.WL..........................QSSGE..RGC--..E..PSC........RTYGQTF.AN..ATD.LC......HSVLGH.VLRVA....--APG................SSHCLN................................................................
A0A0D9QVZ6_CHLSB/1-148               .......................................................-----....------.-----.....-----.........................-.----KN...............................AC....CTANTSQE..LHKDTSC...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..LAT.LC......EGVWSH.SFQNY....--SGG................SGRCIQ................................................................
E1BK45_BOVIN/27-177                  ......................................................a-C---....GGSHPL.PARSQ.....RHYRL.........................A.TNLGTD...............................QL....HLEEMNPP..EASDSGL...VP.----VR..C........G..E..L...SP..........RCE.SFL...VHL..Q.AAL...RSRF.HLVLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....VIC-...-...--.....SP.T.WL..........................PLLEK..RGC--..E..PGC........TTYRQTF.AD..GAE.LC......RSLLGD.ALPVA....--DPG................SGHCLN................................................................
A0A3Q0FTQ0_ALLSI/36-211              .......................................................VCMDA....KHHKTK.PGPEG.....ELHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.RHF...IQD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
E2RTK1_CANLF/26-171                  .......................................................VCMKT....KHHKRE.PGPED.....KLYEE.........................C.IPWAEK...............................AC....CTASTSWH..AHLDVSL...LY.NFSLLH..C........G..L..M...MP..........GCE.EHF...IQA..V.CFY...ECSP.NLGPW....IQKvg.......................................ssGQGE..RIR.DAP..LC....RE....DCEQWWEDCRTS.....YTCR...S...DW.....LG.S.WD..........................WSRAH..R----..-..---........-------.--..---.--......------.-----....-----................------tkdprsgqgppspq..................................................
A0A093GNC2_DRYPU/21-188              ......................................................g-CLEG....DTHKPK.PSREP.....NMHE-.........................C.TLYSKS...............................SC....CYADFTGQ..LARSPVI..kVN.NSYWNR..C........G..Q..L...SK..........PCE.DFT...KKI..E.CFY...RCSP.HAARW....IRP...........................................NSTA..AIQ.FVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WGQSG.eNRC--..K..NKC........IPYSKMY.AN..GTD.MC......QNMWGE.SFKVS....---QS................SCLCLQ................................................................
A0A3Q4I5G8_NEOBR/5-166               ..............................................qcldfkppf-----....------.R--PR.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.HFD---..-........Y..S..G...YA..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycyphllsnqqltqnlggiqvnsdgclq.........
A0A2R9CP43_PANPA/36-211              .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..G.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..A..ALC........STFESYF.PT..PAA.LC......EGLWTH.SFKVS....NYSRG................SGRCIQ................................................................
B7PRB5_IXOSC/1-110                   .......................................................-----....------.-----.....-----.........................C.TPWKNE...............................AC....CTENTTRD..VHHTAMY...--.GFSLDF..Cee...qtgQ..K..M...RD..........VCK.KHF...HRD..L.CFY...ECEP.NIGPW....VVKvk.......................................rkLSRE..RFF.EAP..LC....ES....DCNTWWQDCRFE.....YACT...P...NW.....PR.G.F-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------kfg.............................................................
A0A452DS15_CAPHI/31-192              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.SQYSAF...............................GC....CTPEQDAA..LARRFGA..vAA.RVD---..-........A..A..M...WA..........ECA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR..A----..-..KLC........RSLSL--.-D..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
A0A2U4BPH0_TURTR/30-205              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.IPWKKN...............................AC....CSAKVSQE..LHRDTSS...LY.NFNWEH..C........G..K..M...KP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRTS.....YTCK...A...DW.....HK.G.WN..........................WTSGS..NKCPT..G..TTC........GTFEFYF.PT..PAA.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A2A9MBR2_9APIC/75-244              ........................................vclpsmgfsvdiprd-----....------.--RRD.....DVFLA.........................C.HEHQGN...............................TC....CQRRDTEH..VLRRLSF...YY.GMEKVK..Kg......fS..F..P...PR..........DCP.SFT...SAA..M.CA-...RCDA.RVGLG...kM--...........................................----..TRR.NAP.lLC....RS....FCDTWFRACFDD.....YFAP...A...--.....-P.S.GS..........................PQALT..VCSPD..S..VIC........SPLRDVT.SD..GAS.FC......RKL---.-----....-----................------gfevaggssgeegtdeeenee...........................................
W5PLT6_SHEEP/47-204                  ....................................................gas-----....GGSHPL.PARSQ.....RHRRL.........................A.TNLGTDqlh.........................levPS....FPSEMNPP..EASDSGL...LP.----VR..C........G..E..L...SP..........RCE.SFL...VHL..Q.AAL...RSRF.HLLLL...gVRQ...........................................----..---.RQP..LC....SE....LCDAWFATCESD.....VIC-...-...--.....SP.T.WL..........................PLLEK..RSC--..E..PGC........TTYGQTF.AD..GAE.LC......RSLLGD.ALPVA....--DPG................SVHCLN................................................................
A0A1S3HG53_LINUN/34-210              .................................................mcirlp----N....EYSKAR.PSPEP.....DV--E.........................C.IRYRDE...............................SC....CKPNMTTS..FLEDHQW...MN.MTDYGH..Cp.....qkP..R..L...SP..........ECE.RLT...HDE..M.CFF...ACSP.NSGPW....IVRgk.......................................eyPYSD..RYN.QLP..VC....AS....QCDKWWNACKEE.....YTCH...R...NW.....FT.D.PA..........................WDANG.mNICPK..D..AVC........KKYTEVY.TS..AAD.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A452EP48_CAPHI/44-206              ...........................................qcldyrppfqpl-----....------.-----.....QHLEF.........................C.SDYESF...............................GC....CDQRKDHL..IAARYWD...IM.DYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSDCHSA.....IALL...T...ND.....-R.R.LQ..........................ESPGK..DGA--..-..---........RFCHLLN.LP..DKD.YC......------.-----....-----................------fpnilrsdhlnrnlgavaedrrgclq......................................
F7AZK3_MACMU/47-206                  .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LS..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A3M6VV48_9STRA/5-113               .............................................arkirepvva-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..Q..F...SR..........KCQ.ALT...EEM..T.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYKVCKDE.....YYAH...-...-S.....GA.G.TL..........................TPCYG..NAL--..-..-VC........SPLKAIT.DN..GAN.FC......VLMGFH.-----....-----................------vgseadaegidcfd..................................................
L8H8F4_ACACA/30-211                  ......................................................q-CP--....YQNEEApHKPQP.....PIT-T.........................C.SWYADN...............................AC....CDHRDTND..LIRWLYV...SQ.-KS-GG..Q........D..G..T...NG..........ECL.SLL...HVM..R.CGL...LCSP.AQADF....VEKtnpmqs..............................ssklklaASPQ..MPY.TYR..LC....SS....FCDRLYAACSDE.....GMRE...-...--.....--.-.VE..........................EAEAG..PTW-D..A..AMT........WDSESSS.PA..AEE.FC......KSMA--.-----....-----................------psdveivvvediptksgdghkhmcfn......................................
A0A2K5Y4M3_MANLE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A162DD41_9CRUS/41-214              ......................................................s-CIDG....NNHKRE.PGPED.....SLHQQ.........................C.SPWKNN...............................SC....CTGNTTVH..AHGGKMY...--.GFNYNH..Cp......nK..K..M...SN..........KCL.EHF...VQD..L.CFY...ECSP.NVGPW....VQMvs......................................smkMRRE..RFL.GVP..LC....AT....DCDDWFKACKDD.....FTCT...D...NW.....TL.N.FE..........................WINGT..NRCRP..E..SEC........RTFSEIF.QN..SSN.FC......ERVWDH.SWKYT....---DN................SEPCM-r...............................................................
A0A3Q1CDN9_AMPOC/47-209              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.TQYEDF...............................GC....CDQKTDNS..IAERYWD..iID.QLE---..-........V..G..G...QE..........LCA.DML...KEI..M.C-Q...DCSP.YAAHL....FDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHSKCGHV.....VKFL...T...--.....AN.R.LL..........................RETSE..RDM--..-..--T........TFCSMMD.LS..DQD.YC......------.-----....-----................------ypnvlkspglnsnlgqvvedprgclq......................................
A0A3B4CU07_PYGNA/20-181              ..............................................qcldfkppf-----....------.--QSQ.....QALQF.........................C.VMYKHF...............................GC....CDYARDRQ..LMNRFYE..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PN....YCSQFYFKCKST.....ISLL...S...ND.....SR.L.LE..........................LQHDR..-----..-..--S........RFCQDLE.LD..DQD.YCy....pHLLTNE.KLNKNl..gRVTAN................SDGCLQ................................................................
A0A3P8P3A6_ASTCA/23-176              .......................................................MCMDA....KHHKTE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CTANTSAE..AHDDASY...LY.NFNWNH..C........G..I..M...SK..........ECK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKND.....FTCK...T...NW.....HK.G.WD..........................WSSGG..AHT--..-..---........-------.--..---.--......------.-----....-----................------wkskadmhvcacislinhsk............................................
A0A3B4GM25_9CICH/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A4D9EL97_9SAUR/63-225              ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.SAYETF...............................GC....CDQDKDNS..IAAKYWE...IM.DYID--..-........P..Q..G...HK..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.IQ..DQD.YCy....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
F7DUE2_ORNAN/39-222                  .......................................................RCLNG....NPPRRL.KRRDR.....RVMSQleaps...............ggesvC.GGLYPR..............................lSC....CSRTDSQG..WLHVETK..iFS.------..-........V..I..N...NT..........ECV.KLL...EEI..Q.CAH...-CSP.HAQNL....FHSpe.......................................rgEATE..REI.ALP.lLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LL.T.TV..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEl..sRKHKH................NCFCLQ................................................................
A0A0D3F724_9ORYZ/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
F7A0H6_HORSE/30-205                  .......................................................VCMDA....KHHKAK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CSVNTSRE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRTS.....YTCK...S...NW.....HK.G.WD..........................WTSGS..NKCPA..E..ATC........RTFESYF.PT..PAA.LC......EELWSH.SYKVS....NYRRG................SGRCIQ................................................................
H0X6F3_OTOGA/27-208                  ......................................................a-C---....GGSHTL.QARSW.....GHHGL.........................A.TDLDTDqvhleenpqasdskpylkiqdlsskesllpgSC....CPSVTDTP..EALGPGV...--.--PPEP..C........G..A..P...ST..........GCE.FFL...GHL..Q.VAL...RSRF.RTLLL...gVRQ...........................................----..---.AKP..LC....LE....LCEAWFAICEND.....MTC-...-...--.....GW.T.WL..........................PLPVK..RSC--..E..PNC........RTYGQTF.VD..GTD.LC......RSVLGH.TTPVA....--SPG................ARHCLN................................................................
A0A2K6FMI0_PROCO/39-221              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....LPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1Y1HPQ5_KLENI/12-158              .................................................yaiqgk-----....---EPR.RVRGA.....ESLSL.........................C.KAYKWK...............................TC....CGKEQTDT..ALLWLRK...LA.TS----..-........G..E..A...GA..........DCL.ALW...EVV..E.CAL...-CDP.DVG--....VSE...........................................----..---.GPP.vIC....RS....LCDRLLDACGGA.....YFAL...D...AM.....TQ.D.L-..........................---VP..CGR-R..D..LVC........TTAAEWA.SS..GAH.FC......QL----.-----....-----................------agfrtaddvtddvtgg................................................
L9LAB8_TUPCH/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....RLHGQ.........................C.SPWRKN...............................AC....CTVSTSQE..LHSDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.HHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KE....DCQRWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WTSGV..NKCPP..G..AAC........HTFEFYF.PT..PAA.LC......EGLWSN.SYKVS....NYSKG................SGRCIQ................................................................
A0A0A0AHT2_CHAVO/21-188              ......................................................g-CLEG....DTHKVK.PSPEP.....NMHE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICV...H...NW.....LT.D.WE..........................WDESG.eNHC--..K..NKC........IPYSEMY.AN..GTD.MC......QNMWGK.SFKVS....---ES................SCLCLQ................................................................
B6AIB9_CRYMR/25-190                  ...............................vclkmysditinkedrneshppvd-----....------.---YK.....D---Qf......................ffC.KEHERR...............................TC....CNKSHPNI..LSKLYST..fVL.N-----..-........T..S..L...SR..........NCV.TYY...LKS..W.CSY...-CDA.DVGIG....MKL...........................................----..-YQ.KKP.vLC....HS....LCEDWYNSCRAD.....YFGD...P...NNyl.iyGN.T.LI..........................SARIT..PCSET..S..VLC........SPLHTIT.TN..PDE.FC......R-----.-----....-----................------lngfissreli.....................................................
A0A2K6R864_RHIRO/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A218UGW8_9PASE/82-257              .......................................................VCMDA....KHHKSE.PGPEG.....SLYEQ.........................C.SPWKDN...............................AC....CTANTSLE..AHKDQSY...LY.NFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....RE....DCEEWWEDCKDA.....LTCK...E...NW.....HK.G.WN..........................WATGT..NRCPW..G..SMC........RPFSQVF.PR..PQD.LC......EKIWSN.SFRYS....REPRG................SGRCIQ................................................................
A0A099ZIV6_TINGU/3-165               ..........................................qcldygppfqppf-----....------.-----.....-HLEF.........................C.TAYENF...............................GC....CDQEKDNS..IAAKYWE...IM.DYID--..-........P..Q..G...HK..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCYSA.....ISL-...-...--.....LT.G.--..........................DKHIQ..ECC-E..T..NKT........RFCNLLN.LH..DKD.YCf....pNVLKNT.DLNRNl..gSVVED................RKGCL-q...............................................................
HIPL2_ARATH/27-181                   ..................................................lcsds-----....----KT.PVNNN.....ETLQF.........................C.DSYKER...............................SC....CNSKDDLQ..LQNRFNS...MN.------..-........-..I..S...DS..........NCS.SLL...KSI..L.CSK...-CDE.FSGQL....FGD...........................................---D..DSS.LVP.iLCnstsQD....LCSKLWDSCQNI.....SIVS...S...PF.....SP.T.LL..........................GGATS..PST--..S..SNS........STLTDLW.KS..QTE.FC......TAFGGP.SQTNN....----N................KTKC--fn..............................................................
A0A2I3SSW9_PANTR/36-206              .......................................................VCMNA....KYHKTQ.PSPED.....ELYG-.........................-.--QKKN...............................AC....CMTNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.GLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECLA..W..ALC........HTFEPYF.PT..PAA.LC......EGLWSH.SFKMW....-----................------fdsaqgnpne......................................................
G1SMW7_RABIT/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlemls...............ggevlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENQ...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HAQSL....FHSp........................................ekEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....LPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3Q2W5I8_HAPBU/33-194              ..............................................qcldfkppf-----....------.--RPQ.....KELEF.........................C.IMYKEF...............................GC....CDYQKDQE..LMSKYYQ..iMD.NFD---..-........Y..S..G...YT..........SCA.GFI...FDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSFT.....IPF-...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------lsgdpyianfrenqtslchyleihdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A1S3EVX4_DIPOR/4-107               ..................................................pslsw-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.--Q...ECSP.YAAHL....YDA..........................................eDPAT..PLR.TMP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...SD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNLNl..gRVVAD................AKGCLQ................................................................
A0A3Q1EN57_9TELE/38-199              ............................................qcldfkppfrp-----....------.----R.....RELEF.........................C.VMYKEF...............................GC....CDYEKDQE..LMTKYYQ..iMD.NFD---..-........D..H..G...YA..........NCA.SFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSVV.....IPLL...S...D-.....--.-.--..........................-DPHI..AKV-R..E..NQT........RLCKYLE.LD..DMD.YCy....pHLLSNQ.KLTQHl..gRVQSD................SHGCLQ................................................................
A0A2Y9QIY5_DELLE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A443SE65_9ACAR/1-154               .......................................................-----....------.-----.....-----.........................C.KPWQEN...............................SC....CTEETSAL..TH-AFQN...QY.NFDLNA..Ces...qvnR..K..L...SE..........ECR.KHF...IRD..L.CFY...ECEP.HIGLW....VVKvk.......................................rkIAKE..RFF.EVP..LC....AS....SCEQWWNACRDQ.....FTCA...Y...NW.....QT.D.FI..........................WVNGV..NRC--..N..TTC........KQFKEMY.KN..SVD.FC......ESVFDH.SWKYT....---DD................SKPCM-r...............................................................
F5H2G8_HUMAN/34-74                   .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LH-----...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------k...............................................................
A0A2K5RQN5_CEBCA/34-104              .......................................................VCMDT....MHHKAQ.PGPED.....NLYGQ.........................C.RPWRKN...............................AC....CTANTSQE..LHKDTSR...LY.KFNWEH..C........G..R..M...EP..........AWK.RHF...IQD..T.C--...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------l...............................................................
A0A3Q7V2L7_VULVU/38-220              .......................................................RCLNG....NPPKRL.KRRER.....RLMSQlells...............ggealC.GGFYPR..............................lSC....CLRSDSAG..LGRPDTK...IF.S-----..-........M..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....IQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G5C3X2_HETGA/50-179                  .......................................................VCMNA....RHHKRE.PGPED.....KLFVQ.........................C.IPWKDN...............................AC....CTATTSWQ..AHLTESQ...LH.SFSLIH..C........G..L..L...TP..........SCQ.NHF...IQA..T.CFY...ECSP.NLGPW....IQLvd.......................................pkGLEE..QVL.GVP..LC....QE....DCEQWWADCSSS.....YTCK...S...NW.....QG.G.WD..........................LS---..-----..-..---........-------.--..---.--......------.-----....-----................------qa..............................................................
G3TGC7_LOXAF/59-204                  ..............................................hlrpcltlm-----....---SRN.PHPTI.....QDPGS.........................L.ASLSPG...............................PC....CSSEMDTP..EASGPGM...IP.----EH..C........G..A..L...SP..........RCE.SFL...GHL..Q.GAL...RSH-.-----....---...........................................----..--F.HLP..LC....AE....LCEGWFTTCEGD.....IIC-...-...--.....GR.T.WL..........................SLPER..RSC--..E..PGC........RTYGQTF.AD..GAD.LC......RSVLGH.TLSVA....--APG................SRHCLN................................................................
H2ZRN0_LATCH/30-204                  ......................................vcvcvrvhvypsptlfq-----....------.-----.....-S-FQ.........................C.TPWRDN...............................AC....CTANTSQE..AHNDNSY...LY.NFNWNH..C........G..I..M...SD..........KCK.RHF...TQD..T.CLY...ECSP.NLGPW....IQPvd.......................................ssWRKE..RIL.DAP..IC....KE....DCEEWWQDCKDD.....LTCK...E...NW.....HK.G.WD..........................WSTGI..NQCPK..E..SLC........KRFTQVF.PQ..PLD.LC......EKIWSR.SYKYT....GHARG................SGRCIQ................................................................
F7F3D9_MACMU/67-187                  .......................................................-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A4D8Z232_SALSN/47-195              ................................................snvgkpp-----....----KK.ASKGP.....RDLTL.........................C.RVFRKK...............................TC....CDVTQTHP..ALLSIRR...LA.S-----..S........G..E..A...SQ..........ECL.NLW...EFL..E.CSI...-CDP.RVG--....VQR...........................................----..---.GPP.nIC....AS....FCDRIYEACSTA.....YFAI...D...G-.....KT.Q.VL..........................A-PCG..---QG..D..FVC........GRASEWV.SN..GTE.LC......NAA---.GFSVK...pLDEPG................EFPC--yg..............................................................
A0A2K5LBK1_CERAT/36-211              .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..A.CLY...ECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..R..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A369RWN8_9METZ/21-149              ...............................................ecpyfgna-----....----RK.PETHA.....GLS-H.........................C.TWFS-K...............................TC....CRRTEVTS..VFNNMPR...LT.------..-........-..S..A...SA..........PCQ.QRM...EYL..R.C-Y...FCSP.NQGNW....YNR...........................................----..SAG.RFI..IC....SS....FCNTIFNHCRTA.....IYNG...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tlfsslyhngtefctalkfrtstlgcysfds.................................
A0A3P8Y848_ESOLU/29-178              ......................................................q-CL--....DYKPPF.QPREP.....LVF--.........................C.KEYAKF...............................GC....CDLEKDDQ..ISKNFYN..iMD.HFD--Y..-........-..L..G...YV..........TCA.KYI...RTI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.DLP.gLC....GD....YCTEFWQQCRYT.....ISLL...T...DN.....NA.T.AG..........................IEEDR.nKFC--..-..---........-------.--..---.--......------.-----....-----................------dllelkdreycypnvlsndklnanl.......................................
H0WLX7_OTOGA/33-195                  .........................................qcldygppfqprlq-----....------.-----.....--LKF.........................C.SDYESF...............................GC....CDQNKDRR..IAAQYQD...IM.EYF---..D........L..K..S...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YGA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHA-..-----..K..DGA........RFCHLLN.LP..DKD.YCf....pNVLRNH.HLNRNl..gVVTRD................PQGCL-q...............................................................
A0A2Y9F0R6_PHYMC/30-205              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.SPWKKN...............................AC....CSVNTSQE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KD....DCQIWWEDCRTS.....YTCK...T...NW.....HK.G.WN..........................WTSGY..NQCPV..R..AAC........HPFDFYF.PT..PAA.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
G5BYW7_HETGA/29-211                  ..ggrhlpqarsqgchglaaepgtgqlhlerdppasfpqpylmiqvpgsqvalsp-----....------.-----.....-----.........................-.------...............................AP....CPSEVDRP..RARGPGA...--.--DPEH..Y........G..A..L...SP..........GCE.SFL...GHL..Q.RAL...HRHF.HLLLL...gLRQ...........................................---C..GFE.ALT.pLS....PH....I-IPTFTTCKAD.....VTC-...-...--.....GP.T.WL..........................PISED..RGC--..A..PNC........PTYGQTF.AN..GVD.LC......RLALGD.ALPVA....--APG................SCHSL-n...............................................................
K7F2U8_PELSI/26-201                  .......................................................ICMDA....KHHKTR.PGPEG.....KLYQQ.........................C.ALWKDN...............................AC....CTANTSTE..AHQDQSY...LY.NFNWNH..C........G..V..M...PA..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IQQad.......................................nsWRRE..RIL.HVP..LC....KE....DCEQWWEDCKDA.....ITCK...E...NW.....HK.G.WN..........................WTAGT..NRCPR..G..SMC........QPFRYVF.PR..PAD.LC......EKIWSN.SYKYT....QEHRG................SGRCIQ................................................................
A0A2Y9Q8H2_DELLE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1L8G145_XENLA/52-210              ..............................................ygppfkplv-----....------.-----.....-HLEF.........................C.SEYETF...............................GC....CDQDRDNV..IAEKYWS..iMD.YFD---..-........L..N..N...YH..........ICG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eDPHT..PLR.VIP.gLC....FN....YCSEFHLKCQNS.....ITLL...T...E-.....--.-.--..........................DKQIR..ESC-D..K..GRD........LFCSLLN.LP..DED.YCf....pN-----.-----....-----................------vlhntelnnnlgsvvedpegcik.........................................
A0A452CM71_BALAS/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
F6TQQ8_MONDO/48-210                  ..........................................qcldygppfkppv-----....------.-----.....-HLEF.........................C.SYYETF...............................GC....CDQSKDNR..IAARYLD...IM.EYF-D-..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...NE.....-H.H.IQ..........................ESQ--..--L--..K..DGA........HFCHYLN.LP..DQD.YCf....pN-----.-----....-----................------vlrndnlnrnlgvvvedrkgclq.........................................
A0A0P7VCE9_SCLFO/34-194              ................................................qcldfkp-----....----PF.RPRH-.....-QLTF.........................C.VMYKDF...............................GC....CDSARDRQ..LMSKFHR..iMD.HFD---..-........D..Y..G...YT..........TCA.SYV...HDI..I.C-Q...ECSP.YAAHL....FDA..........................................eDPRT..PMR.IFP.rLC....ED....YCSSFWLRCRTT.....IPFL...T...D-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dprvaqlasyrtqfcdrtgledtdycfphlvsnmqltqglghlatdakgci.............
A0A2K6PQ69_RHIRO/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
E0VVL1_PEDHC/33-206                  .......................................................TCLDG....KYHKKE.PGFES.....ELYSQ.........................C.TPWKYR...............................SC....CSNSTSKS..VHEPLH-...-H.NFNYNH..Cs.....siK..P..L...SD..........ECR.KHF...IQD..L.CFY...ECSP.NVGPW....LVQvd.......................................mkIRKE..RFF.NVP..LC....QS....DCSDWYNACKND.....YTCS...S...NW.....LR.G.WK..........................WTPQG..NECPN..Q..ETC........ETFENVF.HN..STN.FC......EKIWDH.SWKVV....---LD................EKPCM-k...............................................................
RBP_CHICK/21-188                     ......................................................g-CLEG....DTHKAN.PSPEP.....NMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPII..kVS.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IDP...........................................RYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICA...H...NW.....LT.D.WE..........................RDESG.eNHC--..K..SKC........VPYSEMY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
#=GR RBP_CHICK/21-188          SS    ......................................................-----S....SS--SS.-B--T.....T-SS-.........................-.GGGTTS...............................BS....S-HHHHHT..TSSSS--..EET.TEES-T..T........S..-..-...-H..........HHH.HHH...HHH..H.HHH...HH-T.TGGGG....EET...........................................TEEE..EE-.-EE..E-....HH....HHHHHHHHHTTS.....EES-...S...ST.....TT.S.EE..........................E-TTS.-EEE--..-..S--........EEHHHH-.SS..HHH.HH......HHTTGG.GEEE-....---S-................SSSSB-................................................................
A0A1S3HG59_LINUN/1-143               ...........................................mttsfledhqwm-----....------.-----.....-----.........................-.------...............................--....--------..-------...-N.MTDYAQ..Cp.....qkP..R..L...SP..........ECE.RLT...HDE..I.CSF...ACSP.NLGPW....IVRgk.......................................eyPYSD..RYN.QLP..LC....AR....QCDKWWNACKEE.....YTCH...K...NW.....FT.D.PA..........................WDANG.mNICPK..D..TVC........RKYTEVY.TS..AAD.FC......NTIWDG.GYHVV....---PD................TEPCL-e...............................................................
A8MS02_ARATH/40-200                  ..................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKK...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................KRVIG.pCGVND..D..IIC........IKASNWE.SN..GTS.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A2U3WI08_ODORO/44-206              ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SAYESF...............................GC....CDQHRDRR..LAARYRD...IM.DY-FDL..-........-..G..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....RR.-.LQ..........................-----..-GSHE..K..DGA........HFCHLLN.LP..DKD.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaedhqgclq......................................
HIPL1_MOUSE/28-189                   ....................................................qcl-----....DFRPPF.RPPQP.....LSF--.........................C.AQYSAF...............................GC....CTAEQDAA..LARRFRV..lET.RMD---..-........A..G..V...WA..........TCA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRLL...S...PD.....RE.L.WA..........................LESNR..AKL--..-..--C........RYLS---.LD..DTD.YCf....pSLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
R0FGV8_9BRAS/37-198                  .................................vcvskggrfppyesegkppksv-----....------.-GRGS.....KDLTM.........................C.RVFRKR...............................TC....CSSVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SD..........ECL.QLF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....GS....FCDRVFEACKDA.....YFAS...N...--.....--.-.VL..........................TRAIG.pCGVNG..N..IIC........VKASNWE.SN..GTA.FC......EAA---.GFAVQ...tNGDSR................EKPC--yg..............................................................
A0A3B4CWE8_PYGNA/34-195              ..............................................qcldfkppf-----....------.--QSQ.....QALQF.........................C.VMYKHF...............................GC....CDYARDRQ..LMNRFYE..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..I.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PN....YCSQFYFKCKST.....ISLL...S...ND.....SR.L.LE..........................LQHDR..-----..-..--S........RFCQDLE.LD..DQD.YCy....pHLLTNE.KLNKNl..gRVTAN................SDGCLQ................................................................
A0A401NPK4_SCYTO/49-197              .........................................qcldfkppfrpvkg-----....------.-----.....--LSF.........................C.TMYSQF...............................GC....CDSTKDRE..IMNRFYR..iVD.NFD---..-........Y..S..L...YA..........TCA.AYI...QDI..L.C-G...ECSP.YAAHL....YDA..........................................eDPTT..PVR.LLP.gLC....GE....YCIDFWNKCKTT.....VRSL...V...ED.....RN.L.LD..........................LVSNR.nKFC--..-..---........-------.--..---.--......------.-----....-----................------ealqlqdpdycfprvlsnnnltkn........................................
A0A1A6G263_NEOLE/38-213              .......................................................ICMNA....KYHKRE.PGPED.....KLFLE.........................C.VPWKDN...............................AC....CTLATSWE..AHLEESL...LF.NFSMTH..C........G..L..L...TP..........VCH.KHF...VQA..I.CFH...ECSP.NLGPW....IQPvv.......................................pgRQEE..RVW.GVP..LC....WE....DCEEWWKDCHSS.....YTCK...A...NW.....HS.G.WD..........................WSRGK..NRCPA..H..APC........HPFPHYF.PT..PTD.LC......EKIWSN.TFKAS....PERRN................SGRCLQ................................................................
A0A3Q1HKH9_ANATE/23-198              .......................................................MCMDA....KHQKTQ.PGPEG.....KLYLQ.........................C.APWSDN...............................AC....CTANTSEE..AHSDNSY...LY.NFNWNH..C........G..V..M...SS..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQQvd.......................................qsWRKE..RIL.DVP..IC....KE....DCHNWWEDCKED.....YTCK...T...DW.....HK.G.WD..........................WTSGV..NKCPE..G..SMC........RKWTEVY.PT..PKS.MC......EQIWSN.SYLYT....TYPKT................SGRCMQ................................................................
A0A401PCQ3_SCYTO/23-189              ......................................................s-CLSG....INHKAM.PGPEP.....GMRA-.........................C.KLYSQS...............................SC....CFSNYTEQ..LAVAPVT..kVQ.NTYWNR..C........G..Q..L...SS..........RCE.EYM...KKI..D.CFY...HCSP.HTFNW....IHP...........................................NNSH..SVL.AVP..IC....QG....FCDDWFTACRDD.....LTCT...R...NW.....IS.D.WE..........................WDDHG..NNC--..R..NEC........IPYHQMY.KD..GKD.LC......VNMWGA.TFKVI....---SC................PCHCL-m...............................................................
F7GD28_ORNAN/24-179                  ......................................................s-CLSG....GQDKLM.PGPEA.....QLGA-.........................C.RLYSSN...............................AC....CSSETAEI..GTAGITA..pIG.ALPRDR..C........G..P..P...SP..........RCE.SFL...QRI..E.CFL...RCSP.LAGGW....AHP...........................................QRRG..GVR.AVP..LC....EA....FCQDWFAACKAD.....LACI...H...NW.....VS.T.PE..........................RGPKG..KNC--..G..GGC........RTYAQLY.RD..GRD.LC......DSIGGD.S----....-----................------l...............................................................
M3Y5G6_MUSPF/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRNDSPG..LGRLDNK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEALE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................EEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEDY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3M6T9Y8_9CNID/26-192              ......................................................k-CLPG....DKHKES.PSGEE.....SMAA-.........................C.KSYKDA...............................SC....CTSDFTKQ..LATSPVE..kVG.KFSWTP..C.......nN..T..L...SP..........KCE.AFM...VMV..E.CFY...RCSH.NTYFW....KNP...........................................DYPS..AIM.KAP..VC....AS....FCNGWFDACKDD.....LTCA...K...NW.....IT.D.FN..........................KTETG.vNTC--..K..KPC........KNFSDYF.TN..GKD.LC......ESMWGT.SFVYK....-----................ETDCL-q...............................................................
A0A3Q2D842_CYPVA/23-198              .......................................................MCMDA....KHHKVA.PGPEG.....ALYSQ.........................C.APWRDN...............................AC....CTANTSEE..AHEDNSY...LY.NFNWNH..C........G..A..M...SQ..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.NVP..LC....KE....DCEKWWEDCKDD.....FTCM...T...NW.....HK.G.WD..........................WTSGT..NKCPT..G..SKC........RKWTEVY.AT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A0L8HYB6_OCTBM/30-200              .......................................................RCLDG....IHHKQK.PGPEG.....SLYNQ.........................C.SPWKKS...............................SC....CQANVTEK..VHKET--...LY.KFNFHH..C........K..K..L...SK..........RCL.QHF...IQD..L.CFY...QCTP.NGGPW....IHKes......................................nmkIRKE..RYF.ELP..LC....QD....TCGEWWDSCKDD.....ETCS...E...NW.....MR.G.FN..........................WTTET..NTCIT..G..SKC........QKISEVF.KT..STN.FC......EKVWDH.SWKVV....S----................QKPC--fv..............................................................
A0A340X6T2_LIPVE/31-192              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CAPEHDAA..LARRFGA...LE.A---RV..D........A..A..I...WA..........ECA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRGL.....FRHL...S...PD.....RE.L.WT..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
Q69L70_ORYSJ/49-201                  .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
G1S5Y4_NOMLE/36-211                  .......................................................VCMNA....KHHKTQ.PSPED.....QLYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.HHF...IQD..N.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....QK.G.WN..........................WTSGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A2K5DWK8_AOTNA/26-208              .......................................................ICMDA....KHHKGK.PGPEY.....KLYDE.........................C.LPWKDN...............................AC....CTFKTSWE..AHLDVSP...LY.NFNLFH..C........G..L..L...MP..........GCQ.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weaapsGQGE..RVV.NAP..LC....QE....DCKEWWEDCRTS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWNN.SFKAS....PEQRN................SGRCLQ................................................................
A0A2K5DRF2_AOTNA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQLEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K5YTW5_MANLE/26-208              .......................................................ICMNA....KHHKRV.PGPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRLS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A3Q1EN42_9TELE/38-199              ............................................qcldfkppfrp-----....------.----R.....RELEF.........................C.VMYKEF...............................GC....CDYEKDQE..LMTKYYQ..iMD.NFD---..-........D..H..G...YA..........NCA.SFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSVV.....IPLL...S...D-.....--.-.--..........................-DPHI..AKV-R..E..NQT........RLCKYLE.LD..DMD.YCy....pHLLSNQ.KLTQHl..gRVQSD................SHGCLQ................................................................
HIPL2_HUMAN/44-206                   ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGR..DGT--..-..---........RFCHLLD.LP..DKD.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
K7FZF8_PELSI/19-156                  ......................................................h-CLAG....GKHKAA.PGPE-.....GHLGI.........................C.QLYAAN...............................AC....CSSKVAQE..ISSTPLN...IY.---WNR..C........G..N..L...SP..........RCE.QYL...QRV..E.CFY...CCSP.SAARW....PHP...........................................QRPT..AVL.EVP..LC....LS....FCEKWYTACQDD.....LTCA...H...NW.....VS.D.WQ..........................RGPQG..NNC--..S..QDC........VSYHQVS.--..---.--......------.-----....-----................------a...............................................................
H0WV59_OTOGA/38-220                  .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLLSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRSH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.EKVEDi..sRKHKH................NCFCIQ................................................................
A0A3P8N784_ASTCA/28-209              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTQEQIQD..ISHVPSA..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..L.CFY...RCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
A0A1S3EZ02_DIPOR/35-210              .......................................................VCIDA....KHHKEK.PGPED.....NLHGQ.........................C.SPWKKN...............................SC....CTSNTSQE..AHKDVSY...LY.SFNWNH..C........G..E..M...TP..........SCK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCRTS.....FTCK...S...NW.....HK.G.WN..........................WTSGY..NQCPI..G..AAC........HPFHFYF.PT..PAA.LC......EEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I4BN34_9TELE/30-191              ..............................................qcldfkppf-----....------.RP--P.....RDLEF.........................C.VMYNDF...............................GC....CDRQKDQE..LMARFYR..vMD.--PFDQ..S........-..-..G...YA..........NCA.GFV...LEL..L.C-Q...ECSP.YTAHL....FDA..........................................eDPST..PLR.TVP.gLC....PD....YCSRFWTQCRSV.....LPFL...S...DD.....-P.R.IN..........................KA---..-KHDR..S..RLC........K---LLE.LD..DVD.YCy....pH-----.-----....-----................------llsnqkltqnlgrvqtdpdgclq.........................................
G3NYE5_GASAC/30-205                  .......................................................MCMDG....KHHKVN.PGPEG.....KLYLQ.........................C.APWREN...............................AC....CTANTSTE..AHDDASY...LY.NFNWNH..C........G..A..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRRE..RIL.DVP..LC....NE....DCHSWWEDCKND.....FTCK...T...DW.....HK.G.WD..........................WSSGT..NRCPE..G..SKC........RKWTEVY.PT..AKS.MC......EQIWSN.SYLYT....THPKT................SGRCMQ................................................................
A0A384DET5_URSMA/31-206              .......................................................VCMDA....KHHKEK.PSPED.....ELHKQ.........................C.SPWKKT...............................SC....CFTNTSEE..AHKDISY...LY.KFNWNH..C........G..H..M...TP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRTS.....YTCK...S...NW.....HK.G.WD..........................WSSGY..NRCPA..G..AAC........LPFHFYF.PT..SAA.LC......SEIWSH.SYKPS....NYSRG................SGRCIQ................................................................
A0A287U713_HORVV/41-194              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFSI...-...D-.....MK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....-----................------daslsevdetfcyg..................................................
A0A093G981_DRYPU/31-160              .......................................................VCMDA....THHKKE.PGPEG.....KLYGQ.........................C.SPWKDN...............................AC....CTANTTAE..AHRDQSY...LY.SFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................ssWRKE..RIL.HVP..LC....RE....DCEQWWEDCQEA.....LTCK...V...NW.....HK.G.WN..........................WTS--..-----..-..---........-------.--..---.--......------.-----....-----................------g...............................................................
A0A3Q2LMS3_HORSE/3-164               ..................................................paake-----....------.-----.....---AQ.........................C.SPWKKN...............................AC....CSVNTSRE..LHKDTSL...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRTS.....YTCK...S...NW.....HK.G.WD..........................WTSGS..NKCPA..E..ATC........RTFESYF.PT..PAA.LC......EELWSH.SYKVS....NYRRG................SGRCIQ................................................................
A0A3R7NL63_9STRA/48-199              ..........................................tcrsagvlkfdqe-----....----TH.PMQRM.....KGMEV.........................C.SKYRKS...............................TC....CNASHSYA..LRLKIRE..pVV.------..-........A..K..F...GR..........KCQ.RLT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....VCNDWYDACKGE.....YYS-...-...YG.....GS.G.IL..........................APCYG..NAL--..-..-VC........SPLSSIV.ES..GAD.FC......THM---.GFHVG...sDTDVE................GKECF-d...............................................................
R4GDF8_ANOCA/7-121                   ....................................................qay-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...-K..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHLYCRSA.....ITLL...-...--.....--.-.-T..........................DDKNI..QECCE..K..NKT........RFCNFLN.IQ..DED.YCf....pDVLKNT.DLNRNl..gSVVAD................RKGCL-q...............................................................
A0A210R2X3_MIZYE/34-171              ............................................cpyyglesnrf-----....------.TASDH.....GLI-N.........................C.SWYAQK...............................SC....CKRTEVTS..VFSSMFS...LY.------..-........-..G..A...SK..........NCK.NHM...NYL..M.C-Y...FCDP.DQYRW....YHS...........................................----..---.KAH..VC....AD....FCRAVFTHCKDA.....KYDG...K...SI.....GT.N.Y-..........................-RNGT..DFCEA..-..---........-------.--..---.--......------.-----....-----................------qnfhvvegdncfdydptvfgranit.......................................
A0A2K5YHP2_MANLE/20-181              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LE.S---RV..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FHHL...S...T-.....--.-.--..........................-DQEL..RAL-E..G..NRA........RFCRYLS.LD..DTD.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A2D0RR57_ICTPU/23-184              ..........................................qcldfkppfqplq-----....------.-----.....-ELQF.........................C.VMYKHF...............................GC....CDFARDQE..LMKKFYR..iMD.NFD---..-........Y..Y..G...YA..........NCA.GYV...QDL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PD....YCSIFYSKCRST.....IPLL...S...DD.....-P.-.--..........................---RL..SQL-E..H..DRT........RLCRYLE.LD..DSD.YCf....pH-----.-----....-----................------vlsnevlnknlgrvtadrdgclq.........................................
A0A2K5C4C4_AOTNA/48-206              ..............................................ygppfrpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...S-.....DR.G.LQ..........................ESPGT..-----..-..---........-------.--..---.--......------.-----....-----................------dgarfchlldlpdkdycfpnvlrndylnrnlgvvaqdprgclq.....................
W5MM21_LEPOC/28-203                  ......................................................k-CMDG....KHHKKT.PGAEG.....KLFQQ.........................C.KPWKSN...............................AC....CTANTTEE..AHEDNSY...LY.NFNWNH..C........G..I..M...SS..........SCK.RHF...IQD..T.CFY...ECSP.HLGPW....IQKvn.......................................qsWRNE..RII.DVP..IC....KE....DCNGWWEDCKND.....LTCK...E...NW.....HK.G.WD..........................WSTGT..NICPA..G..TKC........RKFTDVF.PT..PQS.MC......EKIWSR.SYAYS....MFERS................SGRCMQ................................................................
A0A3M7S946_BRAPC/46-193              ...................................................ycsf-----....-FNNRA.PSPQT.....NLKN-.........................C.TWYKEN...............................SC....CLQREIES..TFSKVKP...LI.------..-........-..G..S...SI..........KCQ.KFL...NNL..M.C-Y...ICAP.NQFKF....YGK...........................................----..--E.RLT..VC....LE....YCNLMYEACSDA.....ILKG...A...KI.....-R.E.I-..........................YENGH..EFC--..E..---........-------.--..---.--......------.-----....-----................------srrynidrldkdrsiwsetdtlnkrfrvsndsiklnh...........................
A0A3M0KY50_HIRRU/30-149              .......................................................VCMDA....KHHKTE.PGPEG.....QLYGQqvpaeswwvlvgpdgsqlspscpvqC.VLWKDN...............................AC....CTANTSLE..AHQDQSY...LY.NFNWDH..C........G..A..M...PE..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IEQ...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vgadptlthpp.....................................................
F1NGW6_CHICK/35-217                  .......................................................RCLNG....TPPRRL.KKRDR.....RLLSPeapg................gaeamC.RGLYPR..............................lSC....CSRADAQG..LLHAGAK..iLS.------..-........V..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRGH.....LPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
M4A9K7_XIPMA/23-198                  .......................................................MCMNA....KHHKVE.PGPEG.....ALYNQ.........................C.VPWREN...............................AC....CTANTSAE..AHNDNSY...LY.NFNWNH..C........G..A..M...SA..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQSad.......................................esWRKE..RIL.NVP..LC....KE....DCEQWWEDCKDD.....FTCK...T...NW.....HK.G.WD..........................WSSGT..NKCPA..D..SQC........TKWTDVY.AT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A3B4BE12_9GOBI/24-198              .......................................................MCMDA....KHHKTT.PGPEG.....ELYLQ.........................C.APWRDN...............................AC....CTANTSSE..AHQDNSY...LY.NFNWNH..C........G..I..M...SP..........QCK.KHF...IQD..T.CFY...ECSP.HLGPW....IEEv........................................ygSIRQ..RIV.NVP..LC....LE....DCHIWWEDCKND.....VTCK...T...DW.....HK.G.WD..........................WSSGT..NKCPK..D..TQC........RKWTDVF.PT..PKA.MC......EQIWSN.SYLYT....THSNT................SGRCMQ................................................................
A0A199VWI2_ANACO/42-190              ..............................................fsnegkppr-----....------.RAPKG....pRDLTL.........................C.RVFRQS...............................TC....CDVTQTYP..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....IRP...........................................----..---.GPP.tIC....AS....FCDMVFEACSNA.....YYSV...-...D-.....IK.N.QL..........................LSPCG.lNDI--..-..-VC........GRASAWV.SN..GTE.LC......RLA---.-----....-----................------gfavqpannnagfesv................................................
A0A2C9JGR2_BIOGL/35-207              .......................................................ICMDA....QNHKKK.PGPEP.....DLLKE........................fC.SPWANR...............................SC....CTYSTAEG..IHVNPKW...LN.-FDWNH..C........Q..A..L...SP..........QCR.EKF...IMD..L.CFY...ECSP.NVGPW...lV-Kds.......................................kkIRNE..RFK.DVP..LC....SK....ECDRWWYSCEND.....FTCV...K...NW.....AV.E.FD..........................WSKGV..NRCPE..G..SEC........KPFNKFY.KN..SRD.FC......ENLMGG.SFKVA....S---D................TEDC--fy..............................................................
A0A445IMQ3_GLYSO/40-203              ...........................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
G3P081_GASAC/7-132                   ...............................................nfdhsgym-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........TCA.RYI...RSI..L.C-L...ECSP.YAAHL....YDA..........................................eDANT..PMR.TVP.gLC....GD....YCSEYWQQCRYT.....LSLL...L...ED.....SG.S.PE..........................QFANL..TATIE..E..DRT........MFCNFLE.LK..DKQ.YCy....pNVLTNA.ALNANl..gSVRED................PEGC--le..............................................................
A0A2U3YYH4_LEPWE/7-112               ..................................................eldqr-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.VLL...ECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pHLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
A0A4D9DXW4_9SAUR/26-201              .......................................................VCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.APWKDN...............................AC....CTAETSTG..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................nsWRRE..RIL.NVP..LC....KE....DCELWWEACKDA.....VTCR...E...NW.....HK.G.WN..........................WTSGT..NRCPR..G..STC........QLFKYVF.PR..PAD.LC......EKIWSN.SYKYT....TEHRG................GGRCIQ................................................................
A0A140T8H8_CHICK/21-188              ......................................................g-CLEG....DTHKAK.PSPEP.....NMHE-.........................C.TLYSES...............................SC....CYANFTEQ..LAHSPII..kVS.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IDP...........................................RYTA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....SICA...H...NW.....LT.D.WE..........................RDESG.eNHC--..K..SKC........VPYSEMY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A1S3JEC5_LINUN/34-210              ......................................................m-CISVp..nEYSKSR.PSPEP.....GLE--.........................C.TRYRDS...............................SC....CRPNMTTS..FLEDHQW...MN.MTDYGH..Cp.....qkP..R..L...SP..........ECE.RLN...HDE..V.CFY...ACSP.HSGPW....IVIgn.......................................gyPYSH..RLK.NLP..LC....AS....QCDKWWNACKEE.....YTCH...R...NW.....LT.D.PA..........................WDANG.mNICPK..D..AVC........RKYTEMY.TS..AAD.FC......NTIWDG.GYHVV....P---D................TESCM-e...............................................................
M4E4P6_BRARP/40-187                  ...............................................vciskrgr-----....PYELEG.KLPKP.....GDLNL.........................C.NASHDK...............................TC....WSASLALQ..N------...--.---LAT..H........G..E..A...SK..........DCF.YFY...DLL..E.CSI...-CHP.DVG--....VQS...........................................----..--E.RLR..IC....AS....FCDRVFEACSDA.....YFST...S...DA.....SN.Q.VI..........................V-P--..CGASN..G..IIC........VKVFKWG.TN..GTS.FC......EAV---.-----....-----................------gftvdqtadvsacyg.................................................
A0A0D2MI20_9CHLO/46-214              ....................lapcqralaqealcqpglikleeprgpparvqlpf-----....------.-----.....-----.........................C.KEFG-C...............................SC....CASRHALS..IARAFSR...TT.-----D..G........G..D..T...SD..........ACV.AAL...RLL..A.CRP...-CDP.EVGVG....SKP...........................................----..---.--A..VC....LQ....TCDATFDACRED.....FFTF...S...ES.....-S.G.-S..........................LAPCG..SETAG..A..LVC........STLSQHV.SG..GRG.YC......EAM---.-----....-----................------gwavaeeqpcyngsvsseaa............................................
I3M4T2_ICTTR/29-204                  .......................................................VCMDA....KHHKAK.PGPED.....KLHNQ.........................C.TPWRRN...............................AC....CSVNTSQE..LHKDTSH...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KE....DCQNWWDDCRTS.....FTCK...S...NW.....HK.G.WD..........................WTSGV..NKCPV..G..AVC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2K5TT47_MACFA/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.VQ..WHN.LC......S-----.-----....-----................------lq..............................................................
F7CL75_MONDO/29-205                  .......................................................VCMDG....KHHKYE.PSQED.....DLHQQ.........................C.SPWKKR...............................AC....CTANTSIA..AHEDASH...LY.KFNFNH..C........G..M..L...TP..........ACK.RHF...VQD..L.CLY...ECSP.NLGPW....IQPvn.......................................ssWRKE..RVL.NIP..LC....KE....DCNMWWEDCKTS.....YTCK...E...NW.....HK.G.WN..........................WSSGI..NECPV..K..AAC........HPFSFYF.PT..PTS.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
A0A0K9PSK5_ZOSMR/20-185              ..............................psssalplctdlrapvtpklplsfc-----....------.-----.....-----.........................-.-SYNGT...............................SC....CNSTDDSN..LKKQLSA...MN.------..-........-..I..S...DA..........SCS.SLI...KSM..L.C-T...RCDP.FSGEL....YTV...........................................ESKT..R-R.TVP.vLC....SS...gFCDQIWDTCKDV.....PIKN...S...LF.....AA.S.LKg.......................sgSGSGG.gEQL-V..T..SPA........STLIDLW.QS..KTD.FC......RSFEGN.TS---....-----................------vcfdgetvvfn.....................................................
G7I8R3_MEDTR/42-203                  .........................................vcvsqggryppfks-----....--EGNP.PKRGP.....KDLTL.........................C.RVFRKK...............................TC....CDVTHTHP..ALLSVRK...LS.-----S..G........G..E..A...SS..........ECL.HLW...ELL..E.CAI...-CDP.SVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KS.Q.VL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.-----....-----................------gfrvkssdivhvaseetfcyg...........................................
A0A3M6T6G4_9CNID/32-211              ......................................................i-CIDS....KYHKEK.PGPES.....DFFNTt......................fhC.TPWKNH...............................AC....CTSNTTDS..IRKDGTL..sLY.NMHWDQ..C.......gR..K..M...SP..........QCR.RYF...EVD..T.CMY...ECSP.NMKPWi..vVDPns.......................................kkTRKE..RFQ.EVP..IC....SE....DCDAWFDACKDD.....LTCS...D...NWg...dFK.T.WN..........................WTSGM..CKF--..-..-EC........KTFKEYF.DN..AKK.FC......EKLFDY.SWKYT....KGE-L................GIDCM-t...............................................................
F6X5A6_XENTR/22-188                  .......................................................RCLGG....PHHKST.PSSET.....NFQE-.........................C.FLYAES...............................SC....CHANFTQK..LSDSPLI..eMN.NYYYNR..C........G..N..L...SK..........RCE.DYM...KRI..E.CFY...QCSP.LASHW....IHP...........................................NISE..AIQ.HVP..VC....QS....FCDKWFDACHSD.....LICA...Y...NW.....IS.D.WT..........................FDETG..NHC--..K..NDC........IPFNKMY.AN..GTD.LC......QNAWGI.SFIAS....---SS................PCRCL-d...............................................................
A0A2K5W2J6_MACFA/47-206              .............................................dygppfqpll-----....------.-----.....-HLEF.........................C.SDYESF...............................GC....CDQHKDRR..IAARYWD..iME.YFD---..-........L..K..R...HE..........LCG.DYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...ND.....-R.G.LQ..........................ESHGM..DGV--..-..---........RFCHLLD.LS..DKD.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
H2Q4C5_PANTR/30-205                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3M0JCQ9_HIRRU/26-187              ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYAEF...............................GC....CDPRRDRA..LLQRFYR...LS.---ARM..D........E..R..A...YA..........ACA.GHL...QEL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCTQVWQTCRSI.....FRSL...S...AD.....PE.L.IA..........................LENNV.aKF---..-..--C........RYLS---.LE..DTD.YC......------.-----....-----................------fphllanqdlnqnlglvtadaegclq......................................
A0A3P9PHY5_POERE/26-201              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..sNK.NEPWDK..C........G..P..L...SA..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....ITCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A2Y9QJG0_DELLE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...MF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRGH.....VPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQIR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
Q9XSH1_PIG/28-203                    .......................................................ICMDA....KHHKTK.PGPED.....GLHEQ.........................C.SPWEMN...............................AC....CSVNTSQE..AHNDISY...LY.KFNWEH..C........G..K..M...KP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qkWRRE..RIL.NVP..LC....KE....DCQNWWEDCRTS.....YTCK...S...NW.....HE.G.WN..........................WSSGY..NRCPA..N..AAC........HPFDFYF.PT..PAA.LC......SQIWSN.SYKQS....NYSRG................SGRCIQ................................................................
A0A3Q3LNQ8_9TELE/28-201              ..............................................nchpqcldy-----....--KPPF.EPRQP.....LVF--.........................C.KEYSKF...............................GC....CDLEKDEK..LAFRFST..iMG.--NFDH..L........G..Y..-...-N..........ICG.KYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSSYWHQCRYT.....LSLL...L...E-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dtgsplqfanltatleedrrrfcdflelkdkqycypnvltnaelnanlgsvredpkgcle....
K7ENA4_HUMAN/27-174                  ......................................................a-C---....GGSRPL.QARSQ.....QHHGL.........................A.ADLGKGklhlagdpqasvpkpylniqdpssqgsplpgPC....CPSEMDTT..ETSGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........-------.--..---.--......------.-----....-----................------................................................................
C3Y181_BRAFL/80-227                  ......................................................k-CYLQ....YLHKTV.PGPEP.....DNFTE.........................C.HPWKDR...............................TC....CRQQTVPS..PQKINQN..yGP.EWRWDR..C........G..P..L...SS..........ACE.RFF...VQE..A.CFY...ECDP.NAGLYr..kV-Sdkdfd.................................esnpeHNKW..QIQ.GMP..IR....AD....YCDAWWTACRND.....LFCA...H...SQ.....GS.Y.F-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------scaaeydkagkdyfs.................................................
A0A2K5Y2E7_MANLE/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.VQ..WHN.LC......S-----.-----....-----................------lq..............................................................
A0A3B6PLG0_WHEAT/54-207              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A2K5F410_AOTNA/59-215              ......................................................a-C---....GGSRSL.QARSQ.....RHHGL.........................A.TDLGKDkph.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
F7F3D9_MACMU/36-69                   .......................................................VCMNA....KHHKAQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTM-----..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------e...............................................................
G3QS30_GORGO/36-211                  .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2U9CK68_SCOMX/34-196              ........................................pqcldfkppfrplre-----....------.-----.....--LDF.........................C.VMYKEF...............................GC....CDYQKDQE..LMTKFYR..iMD.NFD---..-........Y..H..G...YT..........SCA.GFV...LEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPGT..TLR.TIP.gLC....QD....HCFQFWEKCSST.....IPLL...S...DD.....--.-.--..........................--PHM..VKV-K..E..DRA........RFCQYVG.LD..DVD.YCy....pHLLSNQ.KLTNNl..gRVQSD................SDGCLQ................................................................
M3XZP6_MUSPF/27-177                  ......................................................a-C---....GGSRPL.PAMSR.....RHHRL.........................A.ADLGTS...............................QL....HLAEMDTS..EPLDPGM...--.--APER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gARH...........................................----..---.AQP..LC....SE....LCDVWFATCESD.....IIC-...-...--.....GP.T.WL..........................PILEK..RGC--..E..PGC........PTYEQTF.AD..GAE.LC......RWVLGY.AMPVA....--APG................AGHCIN................................................................
B3RXI9_TRIAD/32-204                  .......................................................TCIAS....SYHKKV.PTPEQ.....DLVE-.........................C.KPWKAR...............................SC....CTPATVKE..LSLTANQ..vLY.NFRWDH..C........G..N..L...SS..........QCY.RYM...VQD..S.CFY...ECSP.NVGPW....IVNas.......................................ssRRSE..RFM.HVP..IC....AS....FCDNWFAACEND.....KTCS...G...DW.....RY.D.WK..........................WINRS..NHCKA..N..NTC........KTFGQIF.KT..SKG.FC......EGLWHY.SFKYQ....---SD................DKPCM-k...............................................................
G1NKP2_MELGA/1-102                   ......................................................l-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.CSE...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRSI.....FRYL...S...TD.....QE.L.IA..........................LENNM.aKF---..-..--C........RYLS---.LE..DTD.YCf....pHLLANE.NLNQN....-----................------lglvtadaegclq...................................................
A0A2J6KPQ2_LACSA/72-220              ..............................................siqgkpprk-----....------.VNKGP.....NDLTL.........................C.RIFRKK...............................TC....CDVTQTHP..ALLAIRR...LA.S-----..T........G..E..A...SD..........ECL.HLW...ELL..E.CSI...-CDP.HVG--....VQP...........................................----..---.GSP.vIC....GS....LCDRIYDACSNA.....YFAM...D...AK.....N-.-.--..........................QVLAP..CGM-S..D..TVC........GRASEWV.IN..GTE.LC......KAS---.-----....-----................------gfsvkpsndfkdtfcyg...............................................
A0A1S3HHT0_LINUN/34-210              .................................................rciflp----T....KFSKTR.PSPEP.....ELE--.........................C.IRYRDS...............................SC....CRPNMTTS..FLEDHQW...MN.MTDYGH..Cp.....qkP..R..L...SP..........ECE.RLN...HDE..V.CFY...ACSP.HSGPW....IVIgn.......................................gyPYSH..RLK.NLP..LC....AS....QCDKWWNACKEE.....YTCH...R...NW.....LT.D.PA..........................WDANG.mNICPK..D..AVC........RKYTEMY.TS..AAD.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A444XKH3_ARAHY/1-94                ......................................................m-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...--L..E.CAI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....FCERIYKACSNA.....YFSM...-...DV.....KT.Q.LL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......VAAG--.-----....-----................------fqvkpsdmihaaseetlcyg............................................
T0PZY6_SAPDV/6-156                   .......................................crstgglkfdaseppr-----....------.-LQRQ.....GALEH.........................C.GKYWKH...............................SC....CNATHNLP..LKRLVLE..pLV.------..-........A..N..V...NR..........RCQ.SLS...EEL..T.CSA...-CHP.LVGAG...aIDR...........................................----..---.---..IC....ID....LCDDWFDACKDE.....FYMA...E...--.....--.H.HR..........................LAPCY.gNAL--..-..-VC........SPLKDIV.TT..GAA.FC......RHM-GY.TPGKA....T-DAE................GKDCF-d...............................................................
D3ZGL3_RAT/38-220                    .......................................................RCLNG....SPPKRL.KRRDR.....RMMSQlells...............ggeilC.GGFYPR..............................vSC....CLQSDSPG..LGRLENK...IF.S-----..-........A..T..N...NT..........ECG.RLL...EEI..K.CAP...-CSP.HSQSL...fFSPe.........................................rDVLD..GDL.ALP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-L.....LQ.T.TA..........................DEFCF.yYARKD..A..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEDY.EKVEEi..sRKHKH................NCFCVQ................................................................
A0A3Q3NPD7_9LABR/23-198              .......................................................MCMDA....KHHKVS.PGPEG.....KLYLQ.........................C.APWREN...............................AC....CKANTTEQ..AHEDNSY...LY.NFNWNH..C........G..A..M...SP..........SCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQKvd.......................................qsWRKE..RIL.DVP..LC....KE....DCHEWWEDCKND.....MTCK...T...DW.....HK.G.WD..........................WSSGI..NKCPA..D..SKC........RKWTDVY.PT..AKD.MC......EQIWSN.SYIYT....THSKS................SGRCMQ................................................................
A0A2K6BUM7_MACNE/59-215              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISSPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.HAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A1D1UKL7_RAMVA/25-165              .................................................lcpyyg-----....--ADRI.AEPEG.....NLAN-.........................C.SWFGKK...............................AC....CKRTEVTS..VFSDMFK...LF.------..-........-..G..A...TK..........ECE.DRL...NYL..N.C-Y...FCSP.DQEIW....FRE...........................................----..---.KAT..IC....RS....FCDSIYEHCADA.....WFED...R...MI.....RD.I.F-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------tdktlqdggfckdnffdvvdsekdcykfdavpfsraes..........................
A0A3B3T646_9TELE/83-257              .......................................................RCYDG....SLPKRP.KKRDN.....GGMGL.........................C.PRLYPR..............................lSC....CPSKRSAFrmLHRRNGM...VL.------..-........S..S..N...NT..........DCT.KLL...EEL..Q.CA-...RCSP.HAQLL....YHTas.......................................pgRAPR..GQP.HLP.iLC....QD....YCKRLYYTCRGH.....IPEL...-...-F.....QA.D.V-..........................DEFCQ.yYGTGG..N..SLCf.....pdFHRRQTR.GP..SSN.YL......DLTDDY.EQKEDf..nRKHKD................SCYC--am..............................................................
A7RN66_NEMVE/1-169                   .......................................................-CLST....STAKTS.PSSNS.....DVFSA.........................C.QVYQNN...............................SC....CSATFTQQ..LSSPVKG...VG.NFSWLQ..C........GqaK..L...SS..........KCE.RFQ...VAV..E.CFY...RCSP.NVAFW....QNP...........................................TYKA..GFL.GAP..LC....SN....FCDDWFDACKDD.....LTCA...E...DW.....LT.G.FN..........................YTSSG.eNTC--..K..TPC........KKFSEYY.KN..GTG.LC......TKQWGD.SFKYS....---QK................SGECLN................................................................
A0A1D5QFI7_MACMU/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAG.VQ..WHN.LC......S-----.-----....-----................------lq..............................................................
F6R036_CALJA/26-208                  .......................................................ICMDD....KHHKGK.PGPED.....KLYDE.........................C.IPWKDN...............................AC....CTFGTSWK..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgsle................................weaapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRTS.....YTCK...S...NW.....HG.S.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
V3ZYM9_LOTGI/31-204                  ......................................................l-CIDS....TSHKTT.PSREA.....SLYKQ.........................C.SPWKER...............................SC....CTENTTRI..AHESTTD...LY.NIDFGH..C........A..P..L...SK..........KCK.EHF...VQD..I.CFY...ECSP.NTGPW...lIEKpn.......................................nkYVTE..KAN.NAP..LC....ES....DCTNWYNDCKYD.....LTCV...E...NW.....GE.D.FN..........................WTTGV..STCPT..N..SQC........KTFEDIY.GS..AAK.FC......SKVWNY.SWKMV....---PD................SEPCI-h...............................................................
A0A3Q0H7L2_ALLSI/429-591             ...........................................qcldygppfqpp-----....------.-----.....LHLEF.........................C.SAYEKF...............................GC....CDQEKDNS..IAAKYWE...IM.DYIS--..-........P..Q..G...HR..........LCG.RYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHFNCHSA.....ITLL...T...N-.....--.-.--..........................DKHIQ..ECC-E..R..NKT........RFCNLLN.LQ..DQD.YCf....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
I3M939_ICTTR/43-205                  ...........................................qcldygppfrpp-----....------.-----.....LHLEF.........................C.SDYESF...............................GC....CDQRKDNR..IAARYWD...IM.NYFD--..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPHT..PLR.NLP.gLC....FD....YCSAFHSDCHSA.....ISLL...T...ND.....-R.G.LR..........................ESHK-..-----..K..DGA........RFCHLLN.LP..DKD.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedhegclq.........................................
A0A2K5J324_COLAP/59-198              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDTT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQAR.VQ..WHD.LC......S-----.-----....-----................------lq..............................................................
A0A2K6RRY9_RHIRO/22-183              ..............................................qcldfrppf-----....------.--RPP.....QLLRL.........................C.AQYSDF...............................GC....CDEGRDAE..LTRRFWD...LAsRV----..D........A..A..E...WA..........ACA.GYA...RDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRGL.....FRHL...S...TD.....RE.L.Q-..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------alegnrarfcrylslddmdycfpyllvnknlnsnlghvvadakgclq.................
A0A0R3T8X3_HYMNN/1-179               .......................................................MCPKS....DKQNDH.PIPEP.....YLER-.........................C.PEWKDL...............................SC....CPPTTANL..INNES--...LH.GFNFNF..C........-..N..I...TK..........GCK.DFF...LHE..H.CMV...KCSP.HLGPW....IVKts.......................................ssKFKE..NVF.KIP..LC....ES....DCNKWYEACSSS.....TACA...T...NW....rSG.G.FD..........................WSSGT..NQCHE..G..YKC........LPISNIY.GS..AKA.FC......EKVFDN.SYSVI....QSD--................------svadwnvtdyhcmh..................................................
C1MHV6_MICPC/49-171                  ...............................................lpefaiag-----....-----K.PPAKN.....RGLTF.........................C.ADYGKS...............................TC....CDKGTTDA..IRRVVAH...MQ.------..A........N..S..F...SP..........RCR.DAW...TSL..E.CSV...-CDP.RAGTT....--P...........................................----..---.RTA..VC....AH....ACDAIYRACKDE.....YFSE...D...SL.....RR.L.V-..........................-----..PCRAS..D..TIC........TKLSD--.--..---.--......------.-----....-----................------wggdgg..........................................................
A0A2B4SCE1_STYPI/23-165              ..............................................cfaqrqics-----....YYGSER.KPKEA.....YSLSN.........................C.TWYRES...............................SC....CTRTEVTS..SFLGMPH...LA.------..-........-..T..S...SD..........DCR.NRM...NYM..M.C-Y...FCSP.DQYKW....LKE...........................................----..--G.KVH..IC....KS....FCDDILTHCKDA.....KYDG...T...SI.....GS.M.--..........................YSSGK..DFCEA..-..---........-------.--..---.--......------.-----....-----................------qffqvgdkdcfefdeeifangsly........................................
A0A2K6T2N3_SAIBB/59-195              ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPGN...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....FCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQA-.--..---.--......------.-----....-----................------gvqwrdlg........................................................
K7E4M5_MONDO/139-265                 ..........................................hsagspimagicl-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.--IWDR..C........G..G..L...SP..........RCE.SFL...QSL..S.HFL...YCSL.LAGNW....AHP...........................................EKHG..SVQ.ALP..IC....AA....FCDQWFSACRDD.....LTC-...-...--.....GR.N.WL..........................FQPGG..GSC--..E..GGC........LTFDQTF.LD..ARD.LC......NSALGD.YLVAA....-----................------papcpflq........................................................
W9RZ38_9ROSA/53-202                  ................................geeppeeavrvtrsimivkppgv-----....------.-----.....-----.........................-.--FCRK...............................TC....CDAAQTHP..ALLTIRK...LA.S-----..T........G..E..A...SQ..........ECL.QLW...ELL..E.CSI...-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFGACSDA.....YFSM...-...--.....-E.T.VT..........................QVLAP..CGV-N..D..FVC........GRASQWV.HN..GTE.LC......HAA---.GLAVK...dDAHVE................EKSC--yg..............................................................
A0A2K6KI84_RHIBE/47-261              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.HLGPW....IRQvaclppthpsrlpspsitsrrwlpaslaerspasplptqvnqsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3B3II88_ORYLA/35-195              ..........................................qcldfkppfrplr-----....------.-----.....-ELQF.........................C.VMYKDF...............................GC....CDYQKDQE..LMAKFNR..iVD.NFD---..-........Y..H..G...YA..........SCA.GYV...MEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQIWSKCHFA.....IPLL...S...ND.....SS.I.IS..........................SKDN-..-----..-..-QT........RLCQHLQ.LD..DAD.YC......------.-----....-----................------yphllsnqrltkdlgrvqtdvdgcl.......................................
F1S9I3_PIG/147-306                   ...........................................dygppfqpllpl-----....------.-----.....---EF.........................C.SDYDNF...............................GC....CDQRKDRR..IAARYWD...IM.EYF-D-..-........L..K..G...HE..........LCG.GYI...KDI..L.C-Q...ECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHSA.....ISLL...T...SD.....-R.R.L-..........................-----..QQSHQ..K..DGA........RFCHLLN.LP..DQD.YC......------.-----....-----................------fpnvlrsnhltgklgvvaedprgclq......................................
A0A433TG37_ELYCH/50-178              .........................................fcsffanrapniql-----....------.-----.....G-LKN.........................C.TWFKES...............................SC....CRQKEIDA..LFPRVKP...LR.------..-........-..G..A...SP..........ACQ.KYT...NYL..M.C-Y...VCAP.NQGDF....YKK...........................................----..--E.SLT..VC....EE....FCDSWYDACQFA.....VLKG...S...-V.....IK.D.L-..........................YSNGS..EYC--..-..---........-------.--..---.--......------.-----....-----................------hsrrfkvqpkkkggcfffd.............................................
B5XAT1_SALSA/23-198                  .......................................................MCMDA....KHHKKE.PGAEG.....QLYQQ.........................C.APWKDN...............................AC....CTANTSTE..AHDDNSY...LY.NFNWNH..C........G..V..M...TP..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQQvd.......................................qsWRKE..RIL.YVP..LC....QE....DCHSWWDDCKDD.....FTCK...Q...DW.....HY.G.WD..........................WTTGR..NRCPA..E..ASC........RKWTDIF.PT..AQI.MC......EKIWSD.SYNYT....NLPKS................SGRCMQ................................................................
A0A2I4C0I7_9TELE/50-212              ............................................qcldfeppfkp-----....------.---Q-.....WHLEF.........................C.TQYQEF...............................GC....CDQKTDNM..IAERYWD...II.E-LLEK..A........G..-..-...HE..........LCE.PML...KEI..M.C-Q...ECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSKFHSKCRHV.....LRYL...-...-T.....VN.Q.VL..........................LDTSE..RDM--..S..TFC........SMVD---.LS..DQD.YCy....pNVLKST.DLNSNl..gRVVED................PRGCL-q...............................................................
A0A3Q4H3Z1_NEOBR/28-129              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTEEQIQD..ISHVPSA..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..L.CFY...RCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCH---------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------l...............................................................
A0A3Q1M762_BOVIN/35-169              .......................................................VCMDA....KHHKAE.PGPED.....SLHEQ.........................C.SPWRKN...............................AC....CSVNTSIE..AHKDISY...LY.RFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IREvn.......................................qrWRKE..RVL.GVP..LC....KE....DCQSWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGE..-----..-..---........-------.--..---.--......------.-----....-----................------dwgv............................................................
A0A091VAB3_NIPNI/21-188              ......................................................g-CLEG....DTHKLK.PSPEP.....NMHE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kVK.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAARW....IHP...........................................KYAA..GIR.SVP..LC....QS....FCDDWYEACKDD.....SICA...H...NW.....LT.D.WE..........................WDESG.kNHC--..K..TKC........IPYSEMY.TN..GTD.MC......QNMWGE.SFKVS....---KS................SCLCLQ................................................................
A0A0P7TVM8_SCLFO/49-211              ......................................................q-CL--....DFKPPF.KPAQE.....GLVF-.........................C.AMYKEL...............................GC....CDSARDQE..LMATFYR..iMD.HFS---..-........Y..H..A...YV..........SCA.GYV...QEL..L.C-Q...ECSP.YAAHL....FDA..........................................eDPST..PVR.AVP.gLC....PD....YCSRFWSTCRSV.....VTLL...S...ND.....TV.L.AD..........................LEQDQ.qRFC--..-..---........---EYLE.LD..DAD.YCy....pH-----.-----....-----................------llsneqltkdlgrvtadaegclq.........................................
A0A267DD81_9PLAT/45-189              ......................................................l-CMMG....RLHKAE.PGPEP.....GLTTG........................pC.IGYSDS...............................SC....CTAEVGSR..LGSNDEF..aQA.AFRLDH..C........G.rR..L...SA..........ECE.KWF...ERS..R.CLY...ECSP.NLGPW....LVKvs......................................gysWRTE..RAY.GVP..LC....HS....QCQAWYAACAAD.....LSCV...S...QL.....EQ.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------rlpldppgqrqrlrervp..............................................
D0NJK0_PHYIT/1-136                   ..................................................mqrtk-----....------.-----.....-GMEV.........................C.SKYRKN...............................TC....CNASHAHA..LRLKIRE..pVV.------..-........A..K..F...SR..........KCQ.ALT...EEM..A.CSS...-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKDE.....YYAY...-...--.....GG.A.GT..........................VAPCY.gNAL--..-..-VC........SPLKSIA.KS..GAD.FC......VHM---.GFHV-....-----................------gtdtdaegidcfd...................................................
F6VC07_XENTR/1-155                   .......................................................RCLPG....RTPNLL.PRAEA.....KLLE-.........................C.QQYSEK...............................AC....CTQEQISA..HP-----...IT.NFPWGL..C........G..S..L...SP..........SCQ.KYV...SQV..Q.CLY...LCSP.HISAY....WNP...........................................DSDT..GIY.NLP..LC....SG....FCDQWFEACKDD.....LICT...-...--.....--.-.-L..........................TNETI..PRC--..A..DAC........VPYKQMFkAG..GKD.LC......NGIWGD.SLVAS....---PQ................DCSCV-s...............................................................
A0A1S3JP30_LINUN/19-188              ......................................................k-CLEG....PHHKDK.PSPEG.....DGYVE.........................C.LSWKQS...............................SC....CLANVTQE..IATHKAK..nLY.NYHWDR..C........G..T..L...SQ..........ACE.LYI...KDE..E.CFY...QCEP.ALVRF....PAA...........................................-KKG..YVK.GIP..IC....AK....YCNVWFEACKND.....LTCV...V...DW.....LA.D.FN..........................YTTGE..NHCPT..G..SQC........RTFAEVY.KN..GQG.LC......ERMWGE.AFTYE....----T................SNNCM-vmk.............................................................
G3QMX1_GORGO/36-211                  .......................................................VCMNA....KHHKTQ.PSPED.....ELYGQ.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........TCK.RHF...IQD..S.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGI..NECPA..G..ALC........STFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A151PJC7_ALLMI/26-201              .......................................................VCMDA....KHHKTK.PGPEG.....QLHNQ.........................C.TPWKDN...............................AC....CTANTSME..AHKDQSY...LY.SFNWNH..C........G..G..M...KD..........KCK.QHF...IKD..T.CFY...ECSP.NLGPW....IVQtd.......................................tsWRRE..RIL.NVP..LC....KE....DCDQWWNDCQDS.....FTCK...E...NW.....HK.G.WN..........................WTTGS..NQCPR..G..SEC........RPFKTVF.PQ..PAD.LC......EKLWSG.SYKYT....RESRG................SGRCMQ................................................................
A0A2K6MAB0_RHIBE/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NKCPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
M0RS22_MUSAM/44-195                  ..............................................stdgkpprk-----....------.VNKGP.....KDLTL.........................C.RIFRQN...............................TC....CDVAQTYP..AFLLIRR...LA.S-----..A........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RIG--....VQP...........................................----..---.GPP.iVC....AS....FCDMVFQACSSA.....YFSI...D...AK.....--.T.QA..........................L--SP..CGL-S..D..TIC........GRATEWA.SN..GTE.LC......HF----.-----....-----................------agfavqpdrqsieghdepfcy...........................................
A0A3Q7WCW2_URSAR/27-188              ..................................................qcldf-----....--RPPF.RPPQP.....LR--F.........................C.AQYSAF...............................GC....CTPEQDAA..LARRFGA...LAaRVD---..-........A..A..E...WA..........ACA.GYA...LDL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRGL.....FRHL...S...PD.....RE.L.WA..........................LEGNR.aKF---..-..--C........RYLS---.LD..DTD.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2I0AFQ7_9ASPA/44-195              ............................................sfegkppkkva-----....------.-K-GS.....RDLAL.........................C.RVFRES...............................TC....CDVSQTYP..ALLSIRR...LA.S-----..S........G..E..G...SE..........DCL.HLW...ELL..E.CSI...-CDP.RVG--....IQP...........................................----..---.GLP.vIC....AT....FCNMILQACSNA.....YFSI...-...DL.....KN.Q.VL..........................S---P..CGL-S..D..IVC........GRASEWA.SN..GTE.LC......RLA---.-----....-----................------gfsvqedlvgnqgaddpfcf............................................
A0A445F9J6_GLYSO/74-235              ......................................vcvsqggrfppfksegg-----....-----A.PKNGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LA.S-----..T........G..E..A...TQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.-----....-----................------gfrvkpsdivdiaseetscyg...........................................
V7BGJ2_PHAVU/38-199                  ..........................................vcvsqggrfppfk-----....-SEGNA.PKKGP.....KDLTL.........................C.RIFRKK...............................TC....CDVTHTHP..ALMSVRK...LA.TT----..-........G..E..A...NP..........ECL.HLW...ELL..E.CSI...-CDP.LVG--....TRS...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LA----.-----....-----................------agfrvrssdivyiaseeascyg..........................................
A0A2K6BV46_MACNE/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G3TWH6_LOXAF/35-210                  .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWRKN...............................AC....CSVNTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ECK.RHF...IQD..T.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQNWWEACRTS.....YTCK...N...NW.....HK.G.WD..........................WTSGV..NECPV..G..TTC........HTFEFYF.PT..PAD.LC......ERLWSH.SYKVS....NYSRG................SGRCIQ................................................................
C3YX07_BRAFL/83-216                  ...................................................ycsl-----....-FTNRA.PHPEH.....KLVK-.........................C.SWFHND...............................AC....CYQEEVDR..IFPTVVP...-P.------..-........R..G..A...NQ..........NCT.DHL...YYL..M.C-Y...ICSP.RQHLF....YRD...........................................----..--E.VVT..IC....EE....LCNRLFEACANA.....TLKG...Q...RI.....GE.Q.Y-..........................-SSGR..DYC--..-..---........-------.--..---.--......------.-----....-----................------vsrkfrvdrqssgscyshnfsive........................................
A0A2K5Q8K1_CEBCA/59-215              ......................................................a-C---....GGSRPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagPC....CPSEMDTT..ETSGPRT...--.--YPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3B4BF19_9GOBI/26-204              .......................................................MCMDA....KHHKTT.PGPEG.....ELYLQ.........................C.APWRDN...............................AC....CTANTSSE..AHQDNSY...LY.NFNWNH..C........G..I..M...SP..........QCK.KHF...IQD..TlCFVimiLCAC.FFLTLd.gsIRS...........................................WRKQ..RIV.NVP..LC....LE....DCHIWWEDCKND.....VTCK...T...DW.....HK.G.WD..........................WSSGT..NKCPK..D..TQC........RKWTDVF.PT..PKA.MC......EQIWSN.SYLYT....THSNT................SGRCMQ................................................................
A0A2G8KPA3_STIJA/48-220              .......................................................RCMAG....ISHKDF.PGPEP.....NLHDQ.........................C.APWADR...............................AC....CDPVTTFQ..FHTHET-...WY.NFDWNH..C.......eK..E..L...SA..........SCQ.RWM...VQD..L.CFY...ECSP.NVAPW....LVEhr.......................................isIRDE..RFV.GVP..LC....KS....ECDLWFSACKND.....YTCK...D...DW.....SK.G.WN..........................WTTGT..NKCPE..G..SQC........STFQDTF.ET..AEN.FC......QNLWGG.SFEVV....---DD................EEQCM-f...............................................................
F1RS40_PIG/38-220                    .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLDSK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..R.CAL...-CSP.HSQSL....FHSp........................................erEALG..RDP.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQMEEY.DKVEDi..sRKHKH................NCFCIQ................................................................
A0A1S3SZ67_SALSA/33-194              ......................................................q-CL--....DYKPPF.QPREP.....LVF--.........................C.KEYAKF...............................GC....CDLEKDDK..ISQNFYK...IM.DY-FDY..-........-..S..G...YV..........TCA.KYI...RTI..L.C-Q...ECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRYT.....ISLL...T...DN.....NA.T.AG..........................IEEDR.nKFC--..-..---........N---FLE.LK..DRE.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A452HZX8_9SAUR/3-161               ...................................................pvaw-----....------.-----.....-----.........................C.VLWKDN...............................AC....CTANTSTE..AHQDQSY...LY.NFNWNH..C........G..V..M...PE..........KCK.QHF...IQD..T.CLY...ECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCQDA.....ITCK...E...NW.....HK.G.WN..........................WTSGT..NRCPR..G..FMC........QPFKYVF.PR..PAD.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
I3JN61_ORENI/28-209                  .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTEEQIQD..MSHVPSV..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................QRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvdgvrpcgclt..........................................
A0A087XRZ0_POEFO/26-204              .......................................................VCLQD....GKHKAT.PGAEP.....HLSE-.........................C.GLYADN...............................SC....CTEEDIQD..IAYVPSD..rNK.NEPWDK..C........G..P..L...SS..........ECE.GYL...KRV..S.CFY...RCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRLD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GTC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDQQeageag...engaegrP-----cgclt...........................................................
A0A384DES7_URSMA/30-205              .......................................................VCMDA....KHHKAK.PGPED.....KLHDQ.........................C.TPWKEK...............................AC....CSASTSQE..LHKDISL...LY.NFTWDH..C........G..K..M...EP..........ACR.RHF...IQD..N.CLY...ECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRTS.....YTCK...A...NW.....HR.G.WD..........................WTSGI..NKCPA..K..TTC........RTFEAYF.PT..PAA.LC......EGLWSD.SYQAS....NYSRG................SGRCIQ................................................................
A0A3Q2H404_HORSE/47-138              ..................................................vdlsg-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..-..-...--..........---.---...---..-.---...----.-----....---...........................................-QGE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSGGK..NRCPA..R..ARC........HPFPHYF.PT..PAD.LC......ERIWSN.SFKAS....PEHRN................SGRCLQ................................................................
H0ZR53_TAEGU/3-164                   ................................................qcldfkp-----....----PF.RPPRG.....LA--F.........................C.RRYAEF...............................GC....CDPRRDRA..LLQRFYR...LS.---ARL..D........E..R..A...YA..........ACA.GHL...QEL..L.C-Q...ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCTQVWQNCRSI.....FRAL...S...AD.....PE.L.IA..........................LENNM.aKFC--..-..---........RYLS---.LE..DTD.YC......------.-----....-----................------fphllanqnlnqnlglvtadaegclq......................................
A0A3B4EU26_9CICH/28-209              .......................................................VCLQD....GKHKAT.PSPEP.....HLTE-.........................C.SLYADN...............................SC....CTQEQIQD..ISHVPSA..nNQ.NEPWDK..C........G..S..L...SP..........ECE.GFL...KRV..L.CFY...RCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....LTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
A0A151PFV0_ALLMI/507-682             .......................................................ICMDA....KHHKAK.PGPEG.....ELHGQ.........................C.TPWKAN...............................AC....CTGNTSTE..AHQDQSY...LY.RFNWNH..C........G..V..M...PR..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IVKtd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDY.....VTCK...E...NW.....HK.G.WN..........................WATGT..NHCPW..G..TVC........RPFKQVF.PR..AAD.LC......EKIWSD.SYKYT....TAPRG................SGRCIQ................................................................
A0A1S3S497_SALSA/29-207              .......................................................ACLQD....GRKKAT.PSQEP.....HLKE-.........................C.TIYAEN...............................AC....CSEDDIQD..LHPMTSE...-K.NSPWDK..C........G..K..L...SP..........KCE.DFL...KRV..T.CFY...RCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..QNC--..T..GNC........VPYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDEEE................------ereggegisngnggrpcgclt...........................................
A0A3Q2D8Y1_CYPVA/29-204              .......................................................MCMDA....KHHKVA.PGPEG.....ALYSQ.........................C.APWRDN...............................AC....CTANTSEE..AHEDNSY...LY.NFNWNH..C........G..A..M...SQ..........KCK.KHF...IQD..T.CFY...ECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.NVP..LC....KE....DCEKWWEDCKDD.....FTCM...T...NW.....HK.G.WD..........................WTSGT..NKCPT..G..SKC........RKWTEVY.AT..PKS.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A199VVS9_ANACO/42-190              ..............................................fsnegkppr-----....------.RAPKG....pRDLTL.........................C.RVFRQN...............................TC....CDVTQTYP..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.QVG--....IRP...........................................----..---.GPP.tIC....AS....FCDMVFEACSNA.....YYSV...-...D-.....IK.N.QL..........................LSPCG.lNDI--..-..-VC........GRASEWV.SN..GTE.LC......RLA---.-----....-----................------gfavqpannnagfesv................................................
A0A091DG56_FUKDA/12-187              .......................................................VCMNA....RHHKRE.PGPED.....KLFVQ.........................C.IPWKDN...............................AC....CTATTSWQ..AHLTESQ...LH.NFSLIH..C........G..L..L...TP..........SCQ.NHF...IQA..T.CFY...ECSP.NLGPW....IQPvg.......................................skGREE..RVL.GVP..LC....RE....DCEQWWADCSSS.....YTCK...S...NW.....HG.G.WD..........................WSQGK..SRCPA..G..ALC........HPFPAYF.PT..PAD.LC......EKIWSN.SFKAS....PEHRN................SGRCLQ................................................................
H2NEK0_PONAB/36-211                  .......................................................VCMNA....KHHKAQ.PSPED.....KLYGQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSH...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..S.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTLGI..NECPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A2K5LBM4_CERAT/47-222              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........LTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I2ZAL4_GORGO/3-164               .................................................paatev-----....------.-----.....----Q.........................C.SPWKKN...............................AC....CTASTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..ALC........RTFESYF.PT..PAA.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3P9NEK5_POERE/35-196              ..............................................qcldfkppf-----....------.--RPD.....RDLEF.........................C.IMYREF...............................GC....CDRQKDQE..LMARYY-...--.RIMENV..T........E..R..G...HK..........TCA.GFM...LEL..L.C-Q...ECSP.FAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNQCRSI.....IPFL...S...DY.....TP.L.--..........................-----..NQA-K..D..DQN........RFCKLLE.LD..DAD.YCy....pHLLSNH.KLNRNl..gRVQKD................SDGCLQ................................................................
A0A3P8WD03_CYNSE/28-209              .......................................................VCLQD....GVHKAT.PGPE-.....RHLGE.........................C.ALYADN...............................SC....CSGDDIRD..ISHVPSA..aNS.NEPWDK..C........G..P..I...SS..........QCE.GFL...KRV..S.CFY...RCSP.DAARW....PHP...........................................HQRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....VTCA...-...--.....-R.N.WA..........................TDPRG..QNC--..T..GAC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDTD................------dtgeaaqaagegdggrpcgclt..........................................
A0A3Q1BQR2_AMPOC/37-210              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....LGLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledsespqqfanltatieedrrkfcdflelkdqqycypnvltntelnanlglvredpkgcle..
A0A2K5HD22_COLAP/36-211              .......................................................VCMNA....KHHKEK.PGPED.....KLHEQ.........................C.RPWKKN...............................AC....CSTNTSQE..AHKDVSY...LY.RFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRTS.....YTCK...S...NW.....HK.G.WN..........................WTSGF..NECPV..G..AAC........QPFHFYF.PT..PTV.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A2K5XKY8_MANLE/30-205              .......................................................VCMDA....KHHKTK.PGPED.....KLHDQ.........................C.SPWKKN...............................AC....CTANTSQE..LHKDTSR...LY.NFNWDH..C........G..K..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHTS.....HTCK...S...NW.....HR.G.WD..........................WTSGV..NKCPA..G..APC........RTFESYF.PT..PVA.LC......EGLWSH.SYKVS....NYSRG................SGCCIQ................................................................
A0A401Q2K9_SCYTO/37-207              .......................................................RCLDG....SAPRRL.KKRDR.....RLLALdas...................gyiC.HKLYSR..............................lSC....CPMNRQQS..VD--PKV...FS.------..-........V..T..N...NT..........ECA.RLL...EEI..K.CAQ...-CSP.YAQNL....FHLpd.......................................qeEASN..NEL.DFP.vLC....RE....FCKQFYFACRSH.....VAG-...-...-L.....FQ.T.TS..........................DEFCN.lYSAKN..N..GMCf.....pdSTRKQVQ.GP..ASN.YL......NQMDEY.HKMEQ....-----................------inrfnki.........................................................
A0A3Q1DFP0_AMPOC/37-210              ............................................cchpqcldykp-----....----PF.QPHQ-.....PLVF-.........................C.KEYSKF...............................GC....CDVEKDEQ..ISHRFYT..iME.N--FDH..S........G..Y..V...--..........TCG.RYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRYT.....LGLL...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ledsespqqfanltatieedrrkfcdflelkdqqycypnvltntelnanlglvredpkgcle..
A0A3Q7TM33_VULVU/30-205              .......................................................VCMDA....KHHKAK.PGPED.....KLHAQ.........................C.TPWRKK...............................AC....CTVSTSQE..LHKDTSR...LY.NFTWDH..C........G..K..M...EP..........ACK.RHF...IQD..N.CLY...ECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....RE....DCEQWWQDCRTS.....YTCK...S...NW.....HR.G.WN..........................WTSGV..NKCPA..R..ATC........RTFEAYF.PT..PAA.LC......EGIWDH.SYKAT....NYSRG................SGRCIQ................................................................
G1R639_NOMLE/26-208                  .......................................................ICMNA....KHHKRA.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A093FXR0_DRYPU/29-178              .......................................................VCMDA....KHHKTK.PGPEG.....KLYEQ.........................C.SPWKDN...............................AC....CTANTTAE..AHRDQSY...LY.SFNWNH..C........G..V..M...PP..........KCK.RHF...IQD..T.CLY...ECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKDF.....VTCK...E...NW.....HK.G.WN..........................WATGA..GSWPW..G..SMM........DTVEQTS.P-..---.--......------.-----....-----................------qp..............................................................
M4F6A3_BRARP/38-198                  ..................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDLTM.........................C.RVFRKR...............................TC....CSPAQTTP..AFVAVRN...LA.TH----..-........G..E..A...SQ..........DCL.HLF...ELL..E.CSI...-CNP.DVG--....TQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKDA.....YFSS...N...AL.....--.-.-T..........................QTIGP..CGVND..D..IIC........VKASNWE.SN..GTS.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
F6V730_CALJA/36-211                  .......................................................VCMDA....KHHKEK.PGPED.....KLHEQ.........................C.RPWRKN...............................AC....CSTNTSQE..AHKDVSY...LY.NFNWNH..C........G..E..M...AP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCNTS.....KTCK...S...NW.....HK.G.WN..........................WTSGS..NKCPV..G..AAC........LPFHSYF.PT..PTA.LC......NEIWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A3Q2DAP0_CYPVA/38-210              ...........................................chpqcldykppf-----....------.-EPQQ.....QLVF-.........................C.KDYTKF...............................GC....CDLQKDEE..ISRKFHS..iMK.NFD---..-........S..L..G...SK..........TCG.EYI...RSI..L.C-Q...ECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSSYWLQCRYT.....LSLL...L...E-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------dmgnpqqfanwtasieedrnrfcdflelkdkqycypnvltdaelnanlglvredpkgcle....
A0A287BC44_PIG/27-202                .......................................................ICMNA....KPHKPE.PSPED.....KLYEE.........................C.IPWKHN...............................AC....CTADTSWE..AHLDVAL...LY.NFSLVH..C........G..L..M...MP..........GCQ.KHF...LQA..I.CFY...ECSP.NLGPW....IQQvr.......................................gaGWGE..RIL.DAP..LC....QE....DCEEWWADCRTS.....YTCK...S...NW.....LG.G.WT..........................WSRGK..HRCPA..R..ALC........HPFPHYF.PT..PAD.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
A0A2K5CPZ0_AOTNA/34-104              .......................................................VCMDA....KYHKAQ.PGPED.....NLYDQ.........................C.SPWRKN...............................AC....CTADTSQE..LHKDTSR...LY.NFNWEH..C........G..K..M...EP..........ACK.RHF...IQD..N.C--...----.-----....---...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------l...............................................................
A0A3B6PKA1_WHEAT/44-197              ...........................................fssegkppgkaa-----....------.--KGR.....RDLAL.........................C.RIFRQN...............................TC....CDVTQTFP..ALLSVRK...LS.S-----..T........G..E..G...SG..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSEA.....YFSI...-...--.....-D.T.KT..........................QALSP..CGL-G..D..ILC........GKAHKWV.SN..GTE.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A7REX3_NEMVE/16-184                  .......................................................TCIEG....PLHKSK.PGPEG.....PDYAE.........................C.FPWKEN...............................SC....CTADFTIQ..LAKDRVE..sLY.NLTYNH..C........G..N..L...SQ..........RCE.AFV...KNE..E.CFW...QCEP.NLIKW....HKS...........................................--SG..IID.RAP..IC....GS....YCDAWFLACQDD.....MTCV...Q...DW.....LN.G.FN..........................YTSST..YTCPV..K..NKC........RTFKEIF.KS..GEV.LC......NTMWGS.SFKYE....---AS................NKNCM-vm..............................................................
B7PZS9_IXOSC/69-157                  ...................................................dvtt-----....-LSTQK.PGPES.....SLYGH.........................C.TPWKNE...............................AC....CTENTTRD..VHHTAMY...--.GFSLDF..Cee...qtgQ..K..M...RD..........VCK.KHF...HRD..L.CFY...ECEP.NIGPW....VVK...........................................----..---.---..--....--....------------.....----...-...--.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------vfrr............................................................
H0ZCK8_TAEGU/21-188                  ......................................................g-CLEG....DTQKLK.PGPEP.....NMQE-.........................C.TLYSKS...............................SC....CYADFTEQ..LAHSPVI..kIG.DSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.DAARW....IHP...........................................NDTA..AIR.AVP..LC....QS....FCDDWYEACKDD.....SICV...R...NW.....LT.D.WE..........................WDERG.eNHC--..N..NKC........IPYREMY.AN..GTD.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
B3RPR0_TRIAD/63-205                  ......................................................y-C--T....YFNNRL.AKRQP.....QLTN-.........................C.PWFQEN...............................AC....CTQPEVDL..IFADRPL...-P.------..-........L..N..L...PP..........ECS.RLF...DQL..M.C-Y...ICSP.DQHLF....YNQ...........................................----..TRQ.TLT..VC....LD....FCNQIYSVCQDA.....LWKG...L...P-.....IK.H.W-..........................YRSGD..EFCRA..R..---........-------.--..---.--......------.-----....-----................------rydvathhcmnvteiivssaisnhycls....................................
A0A3B5B2E8_9TELE/23-198              .......................................................MCMDA....KHHKEE.PGPEG.....QLYQQ.........................C.SPWRDN...............................AC....CKANTTEE..AHNDNSY...LY.NFNWNH..C........G..A..M...SP..........NCK.KHF...VQD..T.CFY...ECSP.HLGPW....IKPad.......................................vsWRKE..RIL.DVP..LC....KE....DCESWWDDCKDD.....FTCK...T...NW.....HK.G.WD..........................WSSGI..NQCPA..D..RQC........RKWSDVF.PT..PKS.MC......EQIWSN.SYLYT....TLTKN................SGRCMQ................................................................
A0A2T7PWW2_POMCA/308-444             ...................................................ycsf-----....-FNNRA.PEVQR.....GLKN-.........................C.TWFKES...............................SC....CRQEEIDA..TFGRVKP...LR.------..-........-..G..A...SP..........ECQ.RYT...NYL..M.C-Y...ICSP.DQSLF....YLM...........................................----..--E.SLT..VC....EE....FCNAWYDACRTA.....ILKG...S...V-.....IR.D.L-..........................YDNGR..SFC--..-..---........-------.--..---.--......------.-----....-----................------asrrfkvdtvkngrcfffdarqdknga.....................................
A0A2U3VUE8_ODORO/27-183              ......................................................a-C---....GGSRPL.PAMSR.....RHHRL.........................V.ADLGTGqlh.........................lagSC....CPSEMDTP..EASDPGM...VP.----ER..C........G..D..P...SP..........GCE.SFL...GHL..Q.VAL...HSRF.RLLLL...gIRQ...........................................----..---.EQP..LC....SE....LCDVWFATCEND.....ITC-...-...--.....GP.T.WL..........................SLLEK..RDC--..E..PGC........TTYEQTF.AD..GAD.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
K7F2T6_PELSI/31-206                  .......................................................VCMDA....KHHKTQ.PGPEG.....ALHGQ.........................C.APWKDN...............................AC....CTAQTSTE..AHKDQSY...LY.SFNWHH..C........G..V..M...PE..........KCR.QHF...IQD..K.CLY...ECSP.NLGPW....IQQad.......................................ssWRRQ..RIL.HVP..LC....KE....DCEQWWEDCKDA.....RTCK...E...NW.....HK.G.WN..........................WTTGT..NRCPR..G..SRC........RPFWSVF.PR..PAD.LC......EKIWSN.SYKYT....QEHRG................SGRCIQ................................................................
JUNO_HUMAN/26-208                    .......................................................ICMNA....KHHKRV.PSPED.....KLYEE.........................C.IPWKDN...............................AC....CTLTTSWE..AHLDVSP...LY.NFSLFH..C........G..L..L...MP..........GCR.KHF...IQA..I.CFY...ECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRMS.....YTCK...S...NW.....RG.G.WD..........................WSQGK..NRCPK..G..AQC........LPFSHYF.PT..PAD.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
#=GR JUNO_HUMAN/26-208         SS    .......................................................B--SS....SSS-SS.-B--S.....---GG.........................G.GGGTTS...............................BS....S-HHHHHH..HTSSS-T...TT.S--TTT..T........S..B..-...-H..........HHH.HHH...HHH..H.HHH...HH-S.B-GGG....EEESSS--................................TT-------E..EE-.-EE..E-....HH....HHHHHHHHHTTS.....EES-...S...-T.....TS.-.-B..........................-TTSS..-B--T..T..---........EEHHHHS.SS..HHH.HH......HHTTTT.SEEE-....SS-TT................SSSSB-................................................................
D7M5H4_ARALL/37-198                  .................................vcvskggrfppyesegkppksv-----....------.-GRGS.....KDLTL.........................C.RVFRKR...............................TC....CTAVQTNP..AFVAVRN...LA.TY----..-........G..E..A...SQ..........ECL.ELF...ELL..E.CSI...-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKDA.....YFAS...N...AL.....--.-.--..........................TRVIG.pCGVND..D..IVC........VKASNWE.SN..GTA.FC......EAA---.GFAVQ...tNHDSR................EKPCY-g...............................................................
A0A2G2W863_CAPBA/38-189              ..............................................rfsnegkpp-----....----RK.VKKGP.....RDLNL.........................C.RVFRGK...............................TC....CDVTQTHP..ALISIRR...LA.-----S..T........G..E..A...SQ..........ECL.HLW...EML..E.CSI...-CDP.RVG--....MQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSNA.....YFAI...D...A-.....KT.Q.VL..........................AP---..CAV-N..D..FVC........GRASEWI.SN..GTE.LC......HV-AGF.SVKSM....SDDPE................EVSCY-g...............................................................
A0A067EZ42_CITSI/29-149              .........................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDLTL.........................C.RVFRKK...............................TC....CDAAQTHP..ALLSIRK...LA.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSI...-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSNA.....YFSM...D...A-.....--.-.--..........................-----..-----..-..---........-------.--..---.--......------.-----....-----................------ktqvlllny.......................................................
H2ML72_ORYLA/28-204                  .......................................................ACLQD....GKHKAK.PSPEP.....YLTE-.........................C.GLYADN...............................SC....CTSDDIQD..ISHVPSV..sNK.NEPWDK..C........G..P..L...SS..........EYVfSLC...DQC..E.GFL...---K.HASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRMD.....MTCA...-...--.....-R.N.WA..........................RDPRG..HNC--..T..GNC........VQYQQMY.QH..GRD.LC......ESLWGD.AFMTV....EDDPQeqgeag...esevegrP-----cgclt...........................................................
A0A151U4S3_CAJCA/26-187              ........................................vcvsqggrfppfkse-----....---GNP.PKRGP.....KDLFL.........................C.RIFRKK...............................TC....CDVTHTHP..ALLSVRK...LV.S-----..T........G..E..A...SQ..........ECL.HLW...ELL..E.CSV...-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSNA.....YFSM...-...DV.....KT.Q.IL..........................APCGV..NDF--..-..-VC........GRAAEWV.SN..GTD.LC......LAA---.-----....-----................------gfrvkpsdivhiaseetscyg...........................................
A0A2K5DR85_AOTNA/38-220              .......................................................RCLNG....NPPKRL.KRRDR.....RMMSQlells...............ggemlC.GGFYPR..............................lSC....CLRSDSPG..LGRLENK...IF.S-----..-........V..T..N...NT..........ECG.KLL...EEI..K.CAL...-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCF.yYARKD..G..GLCf.....pdFPRKQVR.GP..ASN.YL......DQLEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
L9LDL7_TUPCH/33-165                  .......................................................VCMDA....KHHKQE.PGPEE.....KLHGQ.........................C.SPWKNN...............................AC....CSINTSHE..AHRNISY...LY.NFNWDH..C........G..K..M...EP..........ACK.QHF...IQD..T.CLY...ECSP.NLGPW....IQKvd.......................................qsWRRE..RIL.NVP..LC....KE....DCERWWEDCRSS.....FTCK...S...NW.....HK.G.WN..........................WTSGE..-----..-..---........-------.--..---.--......------.-----....-----................------sp..............................................................
A0A369SFE9_9METZ/63-205              ......................................................y-C--T....YFNNRL.AKRQP.....QLTN-.........................C.PWFQEN...............................AC....CTQPEVDL..IFADRPL...-P.------..-........L..N..L...PP..........ECS.RLF...DQL..M.C-Y...ICSP.DQYLF....YNQ...........................................----..TRQ.TLT..VC....LD....FCNQIYSVCQDA.....LWKG...L...P-.....IK.H.W-..........................YRSGD..EFCRA..R..---........-------.--..---.--......------.-----....-----................------rydvathhcmnvteiivssaisnhycls....................................
A0A2Y9M495_DELLE/54-204              ......................................................a-C---....GGSHPL.PARSQ.....RHHRL.........................A.SNLGTS...............................QL....HLAEMNTP..EASDPGI...VS.----GS..C........G..E..L...SP..........GCE.SFL...GHL..Q.VAL...RSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCESD.....TIC-...-...--.....CP.T.WL..........................PLLEK..RGC--..E..PGC........TTYGQTF.AD..GAE.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
F7DID7_HORSE/26-207                  .......................................................VCMNT....QHHKRE.PGPED.....KLHKE.........................C.IPWKDS...............................AC....CTANTSWK..AHLNVSL...LY.NFSLVH..C........G..L..M...MP..........GCQ.RHF...IQA..V.CFY...ECSP.NLGPW....IQQvgrwg.................................qegrsGQGE..RIL.DAP..LC....RE....DCEQWWEDCRTS.....YTCK...S...NW.....HG.G.WD..........................WSGGK..NRCPA..R..ARC........HPFPHYF.PT..PAD.LC......ERIWSN.SFKAS....PEHRN................SGRCLQ................................................................
F7F2B5_MACMU/37-193                  ......................................................a-C---....GGSHPL.QARSQ.....RHHGL.........................A.ADLGKGklh.........................lagTC....CPSEMDAT..EISGPGN...--.--HPER..C........G..V..P...SP..........ECE.SFL...EHL..Q.RAL...RSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCEDD.....ITC-...-...--.....GP.T.WL..........................PLSEK..RGC--..E..PSC........LTYGQTF.AD..GTD.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
L5K5G6_PTEAL/61-206                  .......................................................ICMDA....KHHKTK.PGSED.....KLHDQ.........................C.SPWKKN...............................AC....CSVSTSQE..LHRDTSL...LY.NFNWDH..C........G..Q..M...EP..........ACK.RHF...IQD..T.CLY...ECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQSWWEACRTS.....YTCK...S...DW.....HK.G.WN..........................WTSGD..DR---..-..---........-------.--..---.--......------.-----....-----................------vlclgnearamph...................................................
A0A2P6N040_9MYCE/20-164              .................................................qcyyns-----....------.-TPTP.....RSNQQ.........................C.SWYNRA...............................TC....CQQASISS..FRSDPLS...LE.------..C........G..E..P...VR..........SCA.EHM...VSL..L.CGF...SCSP.RFGLY....LNE...........................................----..TSG.RVK..VC....HN....WAFKMWYDCKQA.....FVKT...E...TS.....VG.N.I-..........................-----..-NF--..-..GAC........HRISDKY.SN..EYD.FF......------.-----....-----................------ingfnmdvagphalagkecfn...........................................
A0A0D9YUD5_9ORYZ/49-201              .........................................fssegkrpgraakg-----....------.----R.....RDLAL.........................C.RVFRQN...............................TC....CDVSQTFS..ALLSVRK...LA.S-----..T........G..E..G...SQ..........ECL.HLW...ELL..E.CSI...-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSEA.....YFAI...-...D-.....VK.T.QA..........................LSPCG..--L-G..D..ILC........GKAHKWV.SN..GTE.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
A0A3L8SF87_CHLGU/3-123               .....................................................sv-----....------.-----.....-----.........................-.------...............................--....--------..-------...--.------..-........-..T..N...NT..........ECA.KLL...EEI..K.CAH...-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRGH.....IPG-...-...-F.....LQ.T.TA..........................DEFCY.yYARKD..G..GVCf.....pdFPRKQVR.GP..ASN.SL......DHVEEY.DKEEE....-----................------isscnlsk........................................................
A0A3P8WT43_CYNSE/20-192              .............................................chpqcldykp-----....----PF.EPRQP.....LA--F.........................C.KEYSKF...............................GC....CDLEKDEE..ISKSFYS..iME.N--FDH..S........G..Y..V...--..........TCG.KYI...RSI..L.C-Q...ECSP.YAAHL....FDA..........................................eDANT..PMR.LLP.gLC....GD....YCFDYWNQCRYT.....LSLL...L...EN.....MG.S.PQ..........................QFSNL..TAILE..E..DRT........KFCDFLE.LR..DKQ.YCy....pNVLTNE.ELNANl..gSVREN................TKGCL-e...............................................................
A0A1V4JXD0_PATFA/88-255              ......................................................g-CLEG....DTHKLK.PSPEP.....KMHE-.........................C.TLYSKS...............................SC....CHADFTEQ..LAHSPVI..kVN.NSYWNR..C........G..Q..L...SK..........SCE.DFT...KKI..E.CFY...RCSP.HAAHW....INR...........................................NNAA..AIQ.SVP..LC....QS....FCDDWYEACKDD.....STCV...R...NW.....L