GenomeNet

Database: Pfam
Entry: Fox-1_C
LinkDB: Fox-1_C
Original site: Fox-1_C 
#=GF ID   Fox-1_C
#=GF AC   PF12414.8
#=GF DE   Calcitonin gene-related peptide regulator C terminal
#=GF AU   Gavin OL;
#=GF SE   Prosite
#=GF GA   25.00 25.00;
#=GF TC   26.10 25.10;
#=GF NC   20.30 24.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   17101796
#=GF RT   Role for Fox-1/Fox-2 in mediating the neuronal pathway of
#=GF RT   calcitonin/calcitonin gene-related peptide alternative RNA
#=GF RT   processing.
#=GF RA   Zhou HL, Baraniak AP, Lou H;
#=GF RL   Mol Cell Biol. 2007;27:830-841.
#=GF DR   INTERPRO; IPR025670;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain family is found in eukaryotes, and is typically
#=GF CC   between 69 and 99 amino acids in length. The family is found in
#=GF CC   association with Pfam:PF00076. This family is the C terminal of
#=GF CC   Fox-1, a protein involved in the regulation of calcitonin
#=GF CC   gene-related peptide to mediate the neuron-specific splicing
#=GF CC   pattern. Fox-1, with Fox-2, functions to repress exon 4
#=GF CC   inclusion.
#=GF SQ   663
#=GS A0A099Z397_TINGU/245-334  AC A0A099Z397.1
#=GS L5LNC9_MYODS/242-339      AC L5LNC9.1
#=GS A0A1D5Q6R7_MACMU/252-328  AC A0A1D5Q6R7.1
#=GS A0A1D5QDN2_MACMU/233-330  AC A0A1D5QDN2.1
#=GS A0A1U7RYA0_ALLSI/251-348  AC A0A1U7RYA0.1
#=GS F7I2V7_CALJA/208-297      AC F7I2V7.1
#=GS A0A2D0S5V0_ICTPU/226-316  AC A0A2D0S5V0.1
#=GS A0A2K5KCS3_COLAP/208-344  AC A0A2K5KCS3.1
#=GS A0A2K5M5Y0_CERAT/296-386  AC A0A2K5M5Y0.1
#=GS A0A0R4IT73_DANRE/221-311  AC A0A0R4IT73.1
#=GS D4A2H6_RAT/208-346        AC D4A2H6.1
#=GS G3W5N1_SARHA/206-297      AC G3W5N1.1
#=GS G1KS80_ANOCA/254-343      AC G1KS80.2
#=GS A0A2D0QD35_ICTPU/251-341  AC A0A2D0QD35.1
#=GS V8PF00_OPHHA/170-267      AC V8PF00.1
#=GS F6UZW2_XENTR/256-362      AC F6UZW2.1
#=GS A0A1S3FWY8_DIPOR/252-349  AC A0A1S3FWY8.1
#=GS A0A1D5RKL3_MACMU/296-386  AC A0A1D5RKL3.1
#=GS A0A1S3FWF2_DIPOR/321-399  AC A0A1S3FWF2.1
#=GS A0A2K5M622_CERAT/270-360  AC A0A2K5M622.1
#=GS A0A2I3NFD5_PAPAN/207-337  AC A0A2I3NFD5.1
#=GS A0A2I3SVA2_PANTR/231-305  AC A0A2I3SVA2.1
#=GS A0A1U7TQC2_TARSY/256-353  AC A0A1U7TQC2.1
#=GS W5NY52_SHEEP/239-332      AC W5NY52.1
#=GS A0A287DCV9_ICTTR/255-345  AC A0A287DCV9.1
#=GS A0A2I0MJ82_COLLI/227-324  AC A0A2I0MJ82.1
#=GS A0A1S2ZNG8_ERIEU/266-355  AC A0A1S2ZNG8.1
#=GS A0A1U7T7D9_TARSY/236-315  AC A0A1U7T7D9.1
#=GS A0A2K5M625_CERAT/231-320  AC A0A2K5M625.1
#=GS A0A1S3N4P9_SALSA/265-364  AC A0A1S3N4P9.1
#=GS A0A1S3EQZ8_DIPOR/217-306  AC A0A1S3EQZ8.1
#=GS A0A2I2YG89_GORGO/233-330  AC A0A2I2YG89.1
#=GS G3U5V8_LOXAF/301-358      AC G3U5V8.1
#=GS A0A2I4CZD5_9TELE/380-449  AC A0A2I4CZD5.1
#=GS RFOX2_MOUSE/324-421       AC Q8BP71.2
#=GS A0A286ZXS1_PIG/273-363    AC A0A286ZXS1.1
#=GS A0A1S3RY52_SALSA/265-359  AC A0A1S3RY52.1
#=GS G1RG65_NOMLE/273-363      AC G1RG65.1
#=GS H2MJ98_ORYLA/249-335      AC H2MJ98.1
#=GS A0A1S3SVJ0_SALSA/241-331  AC A0A1S3SVJ0.1
#=GS A0A218UNT6_9PASE/253-343  AC A0A218UNT6.1
#=GS M3YMA3_MUSPF/278-375      AC M3YMA3.1
#=GS K7EJX6_HUMAN/1-46         AC K7EJX6.1
#=GS I3JNP3_ORENI/262-369      AC I3JNP3.1
#=GS A0A091G5A7_9AVES/234-323  AC A0A091G5A7.1
#=GS F6QHZ4_MACMU/251-348      AC F6QHZ4.2
#=GS A0A091PQS8_LEPDC/123-208  AC A0A091PQS8.1
#=GS A0A1S3N609_SALSA/261-360  AC A0A1S3N609.1
#=GS A0A286XW96_CAVPO/253-342  AC A0A286XW96.1
#=GS A0A091UL47_NIPNI/232-321  AC A0A091UL47.1
#=GS A0A226ML19_CALSU/226-298  AC A0A226ML19.1
#=GS A0A1S3RA65_SALSA/197-301  AC A0A1S3RA65.1
#=GS A0A0Q3PZ38_AMAAE/207-253  AC A0A0Q3PZ38.1
#=GS G1SF90_RABIT/274-372      AC G1SF90.2
#=GS A0A0F8AML1_LARCR/284-392  AC A0A0F8AML1.1
#=GS H2L5M6_ORYLA/295-386      AC H2L5M6.1
#=GS I3K4K9_ORENI/261-352      AC I3K4K9.1
#=GS A0A0A0APK7_CHAVO/246-335  AC A0A0A0APK7.1
#=GS H0XPW4_OTOGA/253-342      AC H0XPW4.1
#=GS A0A1L8EM85_XENLA/207-295  AC A0A1L8EM85.1
#=GS RFOX3_HUMAN/208-297       AC A6NFN3.4
#=GS H2SGZ8_TAKRU/261-349      AC H2SGZ8.1
#=GS A0A2K5J7X5_COLAP/252-328  AC A0A2K5J7X5.1
#=GS A0A2I4CZF2_9TELE/374-479  AC A0A2I4CZF2.1
#=GS A0A1D5PL64_CHICK/235-325  AC A0A1D5PL64.1
#=GS H2UBQ1_TAKRU/255-343      AC H2UBQ1.1
#=GS A0A091L9Z4_CATAU/244-301  AC A0A091L9Z4.1
#=GS A0A1S3WNQ0_ERIEU/207-297  AC A0A1S3WNQ0.1
#=GS A0A2I3N332_PAPAN/233-330  AC A0A2I3N332.1
#=GS A0A1S3N5Z9_SALSA/269-363  AC A0A1S3N5Z9.1
#=GS H0VIW7_CAVPO/248-337      AC H0VIW7.2
#=GS A0A2K5N0K6_CERAT/233-330  AC A0A2K5N0K6.1
#=GS A0A2I2Z094_GORGO/296-386  AC A0A2I2Z094.1
#=GS A0A2K5KYU6_CERAT/208-283  AC A0A2K5KYU6.1
#=GS A0A1U7TSA6_TARSY/252-326  AC A0A1U7TSA6.1
#=GS A0A1S3Q3B8_SALSA/344-403  AC A0A1S3Q3B8.1
#=GS RFOX3_MOUSE/208-345       AC Q8BIF2.2
#=GS U3KCT9_FICAL/255-347      AC U3KCT9.1
#=GS A0A2I3SC88_PANTR/231-320  AC A0A2I3SC88.1
#=GS A0A1U8CMD1_MESAU/278-337  AC A0A1U8CMD1.1
#=GS A0A087X2B1_HUMAN/231-320  AC A0A087X2B1.1
#=GS A0A1U8DED7_ALLSI/289-378  AC A0A1U8DED7.1
#=GS A0A1L8EXD3_XENLA/88-178   AC A0A1L8EXD3.1
#=GS A0A2K5J806_COLAP/231-305  AC A0A2K5J806.1
#=GS A0A091NXD6_9PASS/230-323  AC A0A091NXD6.1
#=GS A0A093IY67_FULGA/244-301  AC A0A093IY67.1
#=GS A0A2I4BYT7_9TELE/316-425  AC A0A2I4BYT7.1
#=GS H2UUP2_TAKRU/257-349      AC H2UUP2.1
#=GS A0A2I0MJ80_COLLI/258-356  AC A0A2I0MJ80.1
#=GS F7I9Y0_CALJA/240-329      AC F7I9Y0.1
#=GS A0A0D9S496_CHLSB/208-297  AC A0A0D9S496.1
#=GS A0A1S3EQZ5_DIPOR/275-364  AC A0A1S3EQZ5.1
#=GS A0A0P7ZAM4_9TELE/95-185   AC A0A0P7ZAM4.1
#=GS H2UBQ2_TAKRU/269-357      AC H2UBQ2.1
#=GS A0A1S3FUV3_DIPOR/321-418  AC A0A1S3FUV3.1
#=GS A0A093I4L3_STRCA/244-341  AC A0A093I4L3.1
#=GS A0A1S3RYY3_SALSA/261-360  AC A0A1S3RYY3.1
#=GS A0A091JC81_EGRGA/246-335  AC A0A091JC81.1
#=GS A0A286ZMC4_PIG/251-330    AC A0A286ZMC4.1
#=GS A0A1V4KVE5_PATFA/91-180   AC A0A1V4KVE5.1
#=GS G3R9Z2_GORGO/177-313      AC G3R9Z2.2
#=GS A0A091P7X3_HALAL/244-340  AC A0A091P7X3.1
#=GS A0A2D0QAJ2_ICTPU/251-336  AC A0A2D0QAJ2.1
#=GS A0A2K5J7Z5_COLAP/251-348  AC A0A2K5J7Z5.1
#=GS RFOX1_PONAB/253-342       AC Q5NVN8.1
#=GS L7MZV0_ANOCA/144-239      AC L7MZV0.1
#=GS A0A087QXA5_APTFO/134-223  AC A0A087QXA5.1
#=GS A0A093CAC8_TAUER/163-252  AC A0A093CAC8.1
#=GS G3TVD2_LOXAF/254-344      AC G3TVD2.1
#=GS H2R1U0_PANTR/296-386      AC H2R1U0.2
#=GS A0A2D0QAL7_ICTPU/205-294  AC A0A2D0QAL7.1
#=GS A0A2K5M5Z8_CERAT/296-385  AC A0A2K5M5Z8.1
#=GS H3D131_TETNG/257-345      AC H3D131.1
#=GS A0A0Q3M1A6_AMAAE/223-291  AC A0A0Q3M1A6.1
#=GS F6V6G6_HORSE/256-353      AC F6V6G6.1
#=GS RFOX3_BOVIN/177-313       AC Q0VD23.1
#=GS F6T0W2_HORSE/273-363      AC F6T0W2.1
#=GS A0A1U7THU2_TARSY/252-328  AC A0A1U7THU2.1
#=GS A0A1V4KTI4_PATFA/231-320  AC A0A1V4KTI4.1
#=GS F1N700_BOVIN/314-403      AC F1N700.2
#=GS A0A2I3HBJ5_NOMLE/252-329  AC A0A2I3HBJ5.1
#=GS G3NBT6_GASAC/211-345      AC G3NBT6.1
#=GS A0A1U8CZ79_MESAU/274-353  AC A0A1U8CZ79.1
#=GS A0A2I0M457_COLLI/233-322  AC A0A2I0M457.1
#=GS A0A1S3S4I8_SALSA/325-371  AC A0A1S3S4I8.1
#=GS G3T7K4_LOXAF/163-253      AC G3T7K4.1
#=GS A0A091FIM5_CORBR/244-341  AC A0A091FIM5.1
#=GS A0A093GH09_DRYPU/245-334  AC A0A093GH09.1
#=GS G1KSS4_ANOCA/323-420      AC G1KSS4.2
#=GS A0A1U7RCL0_ALLSI/273-363  AC A0A1U7RCL0.1
#=GS RFOX2_RAT/307-404         AC A1A5R1.1
#=GS A0A2I0MJ84_COLLI/258-355  AC A0A2I0MJ84.1
#=GS A0A093F4Y5_GAVST/244-301  AC A0A093F4Y5.1
#=GS A0A2I0MJ91_COLLI/248-346  AC A0A2I0MJ91.1
#=GS A0A093NTW3_PYGAD/246-335  AC A0A093NTW3.1
#=GS A0A1S3Q3A0_SALSA/336-440  AC A0A1S3Q3A0.1
#=GS A0A091PWJ2_HALAL/246-335  AC A0A091PWJ2.1
#=GS A0A1U7SS45_ALLSI/221-310  AC A0A1U7SS45.1
#=GS A0A091CYD2_FUKDA/372-462  AC A0A091CYD2.1
#=GS A0A1S3RDD8_SALSA/91-182   AC A0A1S3RDD8.1
#=GS G7PFB1_MACFA/264-361      AC G7PFB1.1
#=GS H2SGZ9_TAKRU/256-344      AC H2SGZ9.1
#=GS RFOX1_HUMAN/253-342       AC Q9NWB1.2
#=GS M7AVJ5_CHEMY/209-297      AC M7AVJ5.1
#=GS A0A2I4BDG2_9TELE/250-338  AC A0A2I4BDG2.1
#=GS U3ILX2_ANAPL/170-255      AC U3ILX2.1
#=GS A0A2K5IU09_COLAP/296-386  AC A0A2K5IU09.1
#=GS G3P9G0_GASAC/261-354      AC G3P9G0.1
#=GS A0A0R4IV43_DANRE/250-340  AC A0A0R4IV43.1
#=GS B7Z1U7_HUMAN/296-385      AC B7Z1U7.1
#=GS A0A287BS62_PIG/273-364    AC A0A287BS62.1
#=GS A0A286Y5H6_CAVPO/208-347  AC A0A286Y5H6.1
#=GS F1MWC7_BOVIN/233-323      AC F1MWC7.2
#=GS H2S1W8_TAKRU/101-171      AC H2S1W8.1
#=GS A0A1D5QZW6_MACMU/210-300  AC A0A1D5QZW6.1
#=GS A0A1D5PKC0_CHICK/207-289  AC A0A1D5PKC0.1
#=GS F1NCA4_CHICK/252-349      AC F1NCA4.2
#=GS A0A2K5N0J9_CERAT/274-372  AC A0A2K5N0J9.1
#=GS A0A2I3TFB9_PANTR/296-385  AC A0A2I3TFB9.1
#=GS A0A2D0S510_ICTPU/267-373  AC A0A2D0S510.1
#=GS A0A2D0QNU8_ICTPU/228-323  AC A0A2D0QNU8.1
#=GS A0A2K5M647_CERAT/254-327  AC A0A2K5M647.1
#=GS A0A1A6H5H4_NEOLE/1-33     AC A0A1A6H5H4.1
#=GS W5K4I4_ASTMX/174-263      AC W5K4I4.1
#=GS A0A1S3Q385_SALSA/343-447  AC A0A1S3Q385.1
#=GS G3UNN2_LOXAF/164-253      AC G3UNN2.1
#=GS G3RL28_GORGO/273-363      AC G3RL28.1
#=GS RFOX2_BOVIN/269-366       AC A6QPR6.2
#=GS A0A1U7T7E4_TARSY/252-349  AC A0A1U7T7E4.1
#=GS A0A1S3FWY3_DIPOR/324-421  AC A0A1S3FWY3.1
#=GS A0A091MSS9_9PASS/246-335  AC A0A091MSS9.1
#=GS A0A2I3N265_PAPAN/262-360  AC A0A2I3N265.1
#=GS A0A2I4BDF5_9TELE/264-352  AC A0A2I4BDF5.1
#=GS G1M6I5_AILME/246-335      AC G1M6I5.1
#=GS A0A2I0LIN0_COLLI/91-180   AC A0A2I0LIN0.1
#=GS H2M6M4_ORYLA/259-352      AC H2M6M4.1
#=GS A0A0Q3M9K1_AMAAE/273-362  AC A0A0Q3M9K1.1
#=GS H2NQ24_PONAB/273-363      AC H2NQ24.2
#=GS A0A0A0A9X3_CHAVO/244-301  AC A0A0A0A9X3.1
#=GS F1SPT7_PIG/274-371        AC F1SPT7.3
#=GS H9EP63_MACMU/208-297      AC H9EP63.1
#=GS H2SH00_TAKRU/210-349      AC H2SH00.1
#=GS G3RHU4_GORGO/252-324      AC G3RHU4.2
#=GS A0A2I3M1W8_PAPAN/256-354  AC A0A2I3M1W8.1
#=GS A0A1S3ESC7_DIPOR/275-364  AC A0A1S3ESC7.1
#=GS A0A2I3MHB2_PAPAN/231-305  AC A0A2I3MHB2.1
#=GS H2LHA2_ORYLA/9-114        AC H2LHA2.1
#=GS A0A287D4W1_ICTTR/209-282  AC A0A287D4W1.1
#=GS A0A091KRE3_9GRUI/163-252  AC A0A091KRE3.1
#=GS A0A2I2ZMK5_GORGO/208-344  AC A0A2I2ZMK5.1
#=GS A0A287B6K6_PIG/251-314    AC A0A287B6K6.1
#=GS A0A2K5N122_CERAT/252-328  AC A0A2K5N122.1
#=GS A0A1A6GLU0_NEOLE/262-335  AC A0A1A6GLU0.1
#=GS A0A1V4KTJ8_PATFA/258-347  AC A0A1V4KTJ8.1
#=GS A0A286YA75_DANRE/268-358  AC A0A286YA75.1
#=GS G3THD0_LOXAF/208-344      AC G3THD0.1
#=GS A0A2I0MJ88_COLLI/227-325  AC A0A2I0MJ88.1
#=GS A0A2K5KCR3_COLAP/177-313  AC A0A2K5KCR3.1
#=GS A0A2I3HBB5_NOMLE/231-320  AC A0A2I3HBB5.1
#=GS A0A2I2ZER1_GORGO/392-482  AC A0A2I2ZER1.1
#=GS A0A1S3FUV8_DIPOR/251-348  AC A0A1S3FUV8.1
#=GS A0A096NJS9_PAPAN/326-423  AC A0A096NJS9.1
#=GS A0A2I2Y8G0_GORGO/326-423  AC A0A2I2Y8G0.1
#=GS A0A287D4C7_ICTTR/260-318  AC A0A287D4C7.1
#=GS A0A0G2JRD1_HUMAN/101-199  AC A0A0G2JRD1.1
#=GS A0A2K5IU37_COLAP/270-360  AC A0A2K5IU37.1
#=GS A0A286XLM2_CAVPO/258-355  AC A0A286XLM2.1
#=GS A0A2I3N4D5_PAPAN/326-402  AC A0A2I3N4D5.1
#=GS A0A286YEU2_HUMAN/412-502  AC A0A286YEU2.1
#=GS I3LWE2_ICTTR/273-363      AC I3LWE2.2
#=GS A0A0G2K2J4_RAT/208-299    AC A0A0G2K2J4.1
#=GS F6QHY3_MACMU/248-346      AC F6QHY3.2
#=GS A0A1D5QTX8_MACMU/285-382  AC A0A1D5QTX8.1
#=GS A0A099Z334_TINGU/244-341  AC A0A099Z334.1
#=GS A0A286XN55_CAVPO/258-356  AC A0A286XN55.1
#=GS M4AEU4_XIPMA/255-343      AC M4AEU4.1
#=GS A0A1D5QCF5_MACMU/231-300  AC A0A1D5QCF5.1
#=GS G1LKZ7_AILME/172-269      AC G1LKZ7.1
#=GS A0A087YK80_POEFO/264-352  AC A0A087YK80.2
#=GS A0A091IRJ4_EGRGA/244-301  AC A0A091IRJ4.1
#=GS I3MNN6_ICTTR/252-350      AC I3MNN6.2
#=GS W5QBE8_SHEEP/251-351      AC W5QBE8.1
#=GS A0A091FAN2_CORBR/245-334  AC A0A091FAN2.1
#=GS A0A286ZL66_PIG/325-369    AC A0A286ZL66.1
#=GS A0A2K5J7G2_COLAP/264-361  AC A0A2K5J7G2.1
#=GS A0A2I3HZ48_NOMLE/282-379  AC A0A2I3HZ48.1
#=GS G3UAX5_LOXAF/247-344      AC G3UAX5.1
#=GS H0ZKM5_TAEGU/244-341      AC H0ZKM5.1
#=GS G5B2N0_HETGA/277-367      AC G5B2N0.1
#=GS A0A2K5N131_CERAT/248-346  AC A0A2K5N131.1
#=GS A0A2D0QAI2_ICTPU/222-311  AC A0A2D0QAI2.1
#=GS A0A2K5KCR5_COLAP/208-297  AC A0A2K5KCR5.1
#=GS H0WAM5_CAVPO/281-362      AC H0WAM5.2
#=GS A0A1S3AJ29_ERIEU/251-348  AC A0A1S3AJ29.1
#=GS A0A091VU45_NIPNI/246-335  AC A0A091VU45.1
#=GS A0A2I3BRU6_MOUSE/270-300  AC A0A2I3BRU6.1
#=GS F6Q266_HORSE/273-364      AC F6Q266.1
#=GS A0A1U7THT2_TARSY/251-325  AC A0A1U7THT2.1
#=GS A0A1U7UGQ6_TARSY/233-322  AC A0A1U7UGQ6.1
#=GS A0A1V4J9N4_PATFA/258-356  AC A0A1V4J9N4.1
#=GS A0A2I0M455_COLLI/246-336  AC A0A2I0M455.1
#=GS L5KFD2_PTEAL/427-524      AC L5KFD2.1
#=GS A0A1S3Q8N1_SALSA/13-103   AC A0A1S3Q8N1.1
#=GS I3JT02_ORENI/210-337      AC I3JT02.1
#=GS A0A1S3WNQ1_ERIEU/207-343  AC A0A1S3WNQ1.1
#=GS RFOX2_XENTR/251-352       AC Q66JB7.1
#=GS A0A1S3ER00_DIPOR/208-298  AC A0A1S3ER00.1
#=GS A0A1S3Q3C3_SALSA/252-356  AC A0A1S3Q3C3.1
#=GS H2UBQ8_TAKRU/269-357      AC H2UBQ8.1
#=GS A0A1D5RDF5_MACMU/248-338  AC A0A1D5RDF5.1
#=GS A0A1S3WNY8_ERIEU/208-344  AC A0A1S3WNY8.1
#=GS A0A1S3RY43_SALSA/265-364  AC A0A1S3RY43.1
#=GS A0A091MJW5_9PASS/244-341  AC A0A091MJW5.1
#=GS A0A2I3ST32_PANTR/273-363  AC A0A2I3ST32.1
#=GS A0A2K5IU45_COLAP/273-363  AC A0A2K5IU45.1
#=GS A0A1U8CQ52_MESAU/278-375  AC A0A1U8CQ52.1
#=GS A0A1U7QL58_MESAU/209-299  AC A0A1U7QL58.1
#=GS A0A2I4CZE4_9TELE/380-485  AC A0A2I4CZE4.1
#=GS G1N8Z5_MELGA/255-291      AC G1N8Z5.2
#=GS A0A1V4J9S2_PATFA/252-349  AC A0A1V4J9S2.1
#=GS A0A1S3WNR6_ERIEU/208-344  AC A0A1S3WNR6.1
#=GS A0A087XUC4_POEFO/259-352  AC A0A087XUC4.1
#=GS A0A091FX54_9AVES/246-335  AC A0A091FX54.1
#=GS F6U1W3_MONDO/233-323      AC F6U1W3.2
#=GS A0A1S3GSX1_DIPOR/162-250  AC A0A1S3GSX1.1
#=GS A0A1S3N501_SALSA/257-356  AC A0A1S3N501.1
#=GS V8P0G6_OPHHA/16-100       AC V8P0G6.1
#=GS A0A1U7UAP0_TARSY/233-323  AC A0A1U7UAP0.1
#=GS A0A2I4BDF0_9TELE/279-367  AC A0A2I4BDF0.1
#=GS F8VZG9_HUMAN/296-386      AC F8VZG9.1
#=GS A0A2I4BK73_9TELE/261-356  AC A0A2I4BK73.1
#=GS A0A0N8K0C0_9TELE/527-571  AC A0A0N8K0C0.1
#=GS G5BY13_HETGA/259-356      AC G5BY13.1
#=GS A0A287B025_PIG/224-321    AC A0A287B025.1
#=GS I3IRZ3_DANRE/111-202      AC I3IRZ3.1
#=GS A0A093Q910_9PASS/247-336  AC A0A093Q910.1
#=GS J9P300_CANLF/251-348      AC J9P300.1
#=GS A0A2K5KYS8_CERAT/207-337  AC A0A2K5KYS8.1
#=GS A0A096NLK2_PAPAN/254-327  AC A0A096NLK2.2
#=GS A0A2I0M453_COLLI/246-335  AC A0A2I0M453.1
#=GS H3CA46_TETNG/106-160      AC H3CA46.1
#=GS I3IS43_DANRE/94-182       AC I3IS43.1
#=GS A0A2I3LID9_PAPAN/273-363  AC A0A2I3LID9.1
#=GS A0A2I3T7I1_PANTR/270-360  AC A0A2I3T7I1.1
#=GS A0A2K5KYS5_CERAT/177-307  AC A0A2K5KYS5.1
#=GS F1PJX5_CANLF/134-223      AC F1PJX5.2
#=GS H2NUX7_PONAB/202-284      AC H2NUX7.1
#=GS K7FG99_PELSI/255-344      AC K7FG99.1
#=GS A0A1S3Q4W5_SALSA/344-446  AC A0A1S3Q4W5.1
#=GS A0A1S3ETS4_DIPOR/235-326  AC A0A1S3ETS4.1
#=GS H2MJ99_ORYLA/181-220      AC H2MJ99.1
#=GS A0A1S3RY40_SALSA/269-363  AC A0A1S3RY40.1
#=GS F7EBQ1_MACMU/252-341      AC F7EBQ1.2
#=GS H3BM62_HUMAN/1-55         AC H3BM62.1
#=GS A0A2D0Q9F3_ICTPU/220-309  AC A0A2D0Q9F3.1
#=GS RFOX1_BOVIN/234-324       AC Q17QD3.1
#=GS A0A2I3HKC6_NOMLE/295-384  AC A0A2I3HKC6.1
#=GS A0A2K5M5W6_CERAT/409-499  AC A0A2K5M5W6.1
#=GS W5MI56_LEPOC/254-343      AC W5MI56.1
#=GS W5UL91_ICTPU/227-316      AC W5UL91.1
#=GS A0A2D0QC41_ICTPU/245-334  AC A0A2D0QC41.1
#=GS A0A2I3STY5_PANTR/288-387  AC A0A2I3STY5.1
#=GS A0A091K7I8_COLST/244-341  AC A0A091K7I8.1
#=GS I3N5W6_ICTTR/210-282      AC I3N5W6.2
#=GS W5N3A0_LEPOC/267-357      AC W5N3A0.1
#=GS A0A2K5IU78_COLAP/231-320  AC A0A2K5IU78.1
#=GS M7B5C9_CHEMY/257-354      AC M7B5C9.1
#=GS W5KW05_ASTMX/322-428      AC W5KW05.1
#=GS A0A1S3AIT1_ERIEU/232-329  AC A0A1S3AIT1.1
#=GS A0A2I3TPX1_PANTR/210-300  AC A0A2I3TPX1.1
#=GS A0A1D5Q780_MACMU/296-385  AC A0A1D5Q780.1
#=GS A0A091N6B4_APAVI/244-341  AC A0A091N6B4.1
#=GS A0A093SXV0_9PASS/244-301  AC A0A093SXV0.1
#=GS A0A1D5Q718_MACMU/231-305  AC A0A1D5Q718.1
#=GS A0A2K5IUP0_COLAP/210-300  AC A0A2K5IUP0.1
#=GS A0A1S3ETR9_DIPOR/275-365  AC A0A1S3ETR9.1
#=GS F7H3L9_CALJA/325-422      AC F7H3L9.1
#=GS A0A1S3FVE5_DIPOR/320-417  AC A0A1S3FVE5.1
#=GS A0A1U8CMC6_MESAU/274-371  AC A0A1U8CMC6.1
#=GS A0A1U7TQB5_TARSY/256-330  AC A0A1U7TQB5.1
#=GS A0A2I2UQ86_FELCA/258-356  AC A0A2I2UQ86.1
#=GS A0A2I3LQ09_PAPAN/270-360  AC A0A2I3LQ09.1
#=GS W5LJI4_ASTMX/90-134       AC W5LJI4.1
#=GS A0A093P8A1_PYGAD/244-341  AC A0A093P8A1.1
#=GS A0A286Y432_CAVPO/248-346  AC A0A286Y432.1
#=GS A0A091LQ75_CARIC/163-252  AC A0A091LQ75.1
#=GS A0A151NTY0_ALLMI/245-336  AC A0A151NTY0.1
#=GS A0A2I2YMY6_GORGO/231-320  AC A0A2I2YMY6.1
#=GS A0A1S3SVG7_SALSA/265-355  AC A0A1S3SVG7.1
#=GS M4ASS0_XIPMA/101-204      AC M4ASS0.1
#=GS A0A093HSU6_STRCA/246-335  AC A0A093HSU6.1
#=GS A0A1A6I067_NEOLE/219-357  AC A0A1A6I067.1
#=GS A0A1D5Q505_MACMU/231-320  AC A0A1D5Q505.1
#=GS F6QI01_MACMU/255-352      AC F6QI01.2
#=GS A0A091WJQ8_OPIHO/244-301  AC A0A091WJQ8.1
#=GS A0A1U8CMK9_MESAU/256-330  AC A0A1U8CMK9.1
#=GS K7ESF7_HUMAN/13-102       AC K7ESF7.1
#=GS U3JA78_DANRE/262-352      AC U3JA78.2
#=GS L9LB20_TUPCH/109-200      AC L9LB20.1
#=GS A0A1S3RY48_SALSA/265-359  AC A0A1S3RY48.1
#=GS A0A2I3T5L7_PANTR/177-313  AC A0A2I3T5L7.1
#=GS A0A1D5QDD4_MACMU/208-239  AC A0A1D5QDD4.1
#=GS H2SH02_TAKRU/238-315      AC H2SH02.1
#=GS A0A151MLZ5_ALLMI/31-109   AC A0A151MLZ5.1
#=GS A0A091PMK2_APAVI/247-336  AC A0A091PMK2.1
#=GS A0A2I4CZF0_9TELE/380-482  AC A0A2I4CZF0.1
#=GS J3QQZ2_HUMAN/177-313      AC J3QQZ2.1
#=GS A0A2I3TGQ4_PANTR/252-324  AC A0A2I3TGQ4.1
#=GS G7Q0G1_MACFA/196-318      AC G7Q0G1.1
#=GS G3RYN1_GORGO/208-283      AC G3RYN1.2
#=GS A0A2I0M456_COLLI/273-362  AC A0A2I0M456.1
#=GS H2T3K8_TAKRU/244-358      AC H2T3K8.1
#=GS F6QLM9_ORNAN/253-310      AC F6QLM9.2
#=GS F6YYV0_HORSE/245-336      AC F6YYV0.1
#=GS S9YAA4_CAMFR/115-195      AC S9YAA4.1
#=GS A0A1U8DW10_ALLSI/193-282  AC A0A1U8DW10.1
#=GS A0A1S3RY39_SALSA/261-360  AC A0A1S3RY39.1
#=GS H2SGZ7_TAKRU/263-352      AC H2SGZ7.1
#=GS A0A1S3AIV4_ERIEU/233-330  AC A0A1S3AIV4.1
#=GS I3ISM5_DANRE/246-303      AC I3ISM5.2
#=GS A0A093GI91_DRYPU/244-301  AC A0A093GI91.1
#=GS M3YLL6_MUSPF/265-354      AC M3YLL6.1
#=GS S9X0D9_CAMFR/249-294      AC S9X0D9.1
#=GS H2UUP4_TAKRU/113-235      AC H2UUP4.1
#=GS A0A0F8AI01_LARCR/1-79     AC A0A0F8AI01.1
#=GS H2UBQ4_TAKRU/242-330      AC H2UBQ4.1
#=GS H2UUP3_TAKRU/137-229      AC H2UUP3.1
#=GS A0A1U8CQ56_MESAU/278-341  AC A0A1U8CQ56.1
#=GS A0A1U8CXS3_MESAU/278-352  AC A0A1U8CXS3.1
#=GS A0A2I3SLN1_PANTR/248-321  AC A0A2I3SLN1.1
#=GS G3I8S9_CRIGR/252-349      AC G3I8S9.1
#=GS A0A091HFF9_BUCRH/246-343  AC A0A091HFF9.1
#=GS A0A1L8EQ14_XENLA/186-277  AC A0A1L8EQ14.1
#=GS A0A093JCM1_FULGA/163-252  AC A0A093JCM1.1
#=GS G3WU32_SARHA/251-340      AC G3WU32.1
#=GS M4ACI8_XIPMA/259-352      AC M4ACI8.1
#=GS A0A1U7RLG5_ALLSI/155-246  AC A0A1U7RLG5.1
#=GS A0A2I3MD07_PAPAN/177-307  AC A0A2I3MD07.1
#=GS H3CRM9_TETNG/140-235      AC H3CRM9.1
#=GS H3CA46_TETNG/169-240      AC H3CA46.1
#=GS F6VG49_MACMU/177-313      AC F6VG49.2
#=GS A0A091IKT3_CALAN/246-335  AC A0A091IKT3.1
#=GS A0A1D5R9S2_MACMU/232-329  AC A0A1D5R9S2.1
#=GS A0A1S3ES93_DIPOR/209-298  AC A0A1S3ES93.1
#=GS F6ZVB7_HORSE/258-347      AC F6ZVB7.1
#=GS A0A1U8CZ75_MESAU/274-348  AC A0A1U8CZ75.1
#=GS A0A1U7TDP4_TARSY/252-331  AC A0A1U7TDP4.1
#=GS A0A0D9R8Q5_CHLSB/255-345  AC A0A0D9R8Q5.1
#=GS A0A1L8GGP0_XENLA/257-359  AC A0A1L8GGP0.1
#=GS A0A2I2ZYE3_GORGO/296-385  AC A0A2I2ZYE3.1
#=GS F7D8X8_HORSE/242-316      AC F7D8X8.1
#=GS M3ZVN0_XIPMA/187-344      AC M3ZVN0.1
#=GS RFOX2_HUMAN/265-362       AC O43251.3
#=GS A0A094JZK5_ANTCR/246-335  AC A0A094JZK5.1
#=GS H0XYE1_OTOGA/230-319      AC H0XYE1.1
#=GS A0A091I6N7_CALAN/244-301  AC A0A091I6N7.1
#=GS A0A1S3N512_SALSA/257-351  AC A0A1S3N512.1
#=GS G3NVX0_GASAC/255-355      AC G3NVX0.1
#=GS A0A1S3S486_SALSA/4-66     AC A0A1S3S486.1
#=GS A0A2K5J7W6_COLAP/232-329  AC A0A2K5J7W6.1
#=GS A0A1U7R2F0_MESAU/274-372  AC A0A1U7R2F0.1
#=GS A0A1V4J9X9_PATFA/258-355  AC A0A1V4J9X9.1
#=GS A0A2D0QNT8_ICTPU/255-350  AC A0A2D0QNT8.1
#=GS G7PT23_MACFA/162-266      AC G7PT23.1
#=GS A0A1S3RZ93_SALSA/265-364  AC A0A1S3RZ93.1
#=GS A0A094KC66_9AVES/244-301  AC A0A094KC66.1
#=GS A0A1S3Q380_SALSA/344-448  AC A0A1S3Q380.1
#=GS A0A1U7TSB4_TARSY/225-304  AC A0A1U7TSB4.1
#=GS A0A1U7SLT9_TARSY/208-298  AC A0A1U7SLT9.1
#=GS A0A287B9H0_PIG/247-345    AC A0A287B9H0.1
#=GS F7DP45_MONDO/256-353      AC F7DP45.1
#=GS A0A1S3RZ97_SALSA/257-356  AC A0A1S3RZ97.1
#=GS G1KYG2_ANOCA/227-322      AC G1KYG2.2
#=GS A0A1D5PVK3_CHICK/252-341  AC A0A1D5PVK3.1
#=GS A0A093QZD6_PHACA/244-301  AC A0A093QZD6.1
#=GS A0A287BC80_PIG/164-301    AC A0A287BC80.1
#=GS A0A1D5PDT1_CHICK/176-258  AC A0A1D5PDT1.1
#=GS A0A1U7SF44_TARSY/208-345  AC A0A1U7SF44.1
#=GS B0QYV1_HUMAN/232-329      AC B0QYV1.1
#=GS A0A1S3ACU1_ERIEU/208-298  AC A0A1S3ACU1.1
#=GS A0A2I0M454_COLLI/246-335  AC A0A2I0M454.1
#=GS A0A1A6GP95_NEOLE/15-72    AC A0A1A6GP95.1
#=GS W5N392_LEPOC/227-317      AC W5N392.1
#=GS A0A1V4J998_PATFA/261-358  AC A0A1V4J998.1
#=GS F1Q2W1_CANLF/273-363      AC F1Q2W1.2
#=GS A0A2I3TXS3_PANTR/208-344  AC A0A2I3TXS3.1
#=GS A0A1D5PMS0_CHICK/262-352  AC A0A1D5PMS0.1
#=GS A0A0P7WYS9_9TELE/218-316  AC A0A0P7WYS9.1
#=GS A0A2K6EDK7_MOUSE/252-331  AC A0A2K6EDK7.1
#=GS A0A087X7Y4_POEFO/183-292  AC A0A087X7Y4.2
#=GS A0A2D0S5S9_ICTPU/268-358  AC A0A2D0S5S9.1
#=GS J3KNW3_HUMAN/258-347      AC J3KNW3.1
#=GS S7NLF6_MYOBR/296-393      AC S7NLF6.1
#=GS A0A1U7TSB9_TARSY/256-332  AC A0A1U7TSB9.1
#=GS A0A1S2ZNG9_ERIEU/266-356  AC A0A1S2ZNG9.1
#=GS A0A1S2ZNF0_ERIEU/266-356  AC A0A1S2ZNF0.1
#=GS A0A1U7THT7_TARSY/252-350  AC A0A1U7THT7.1
#=GS F1RKX4_PIG/233-323        AC F1RKX4.3
#=GS F6YTR4_XENTR/246-347      AC F6YTR4.1
#=GS A0A2I0M474_COLLI/273-363  AC A0A2I0M474.1
#=GS H0W1U4_CAVPO/177-316      AC H0W1U4.2
#=GS H3BGD1_LATCH/246-337      AC H3BGD1.1
#=GS A0A087Y8E4_POEFO/323-428  AC A0A087Y8E4.2
#=GS RFOX1_MOUSE/252-341       AC Q9JJ43.3
#=GS A0A1S3FUW1_DIPOR/256-353  AC A0A1S3FUW1.1
#=GS H3A277_LATCH/259-358      AC H3A277.1
#=GS A0A0G2JYY7_RAT/274-372    AC A0A0G2JYY7.1
#=GS U3IJ31_ANAPL/252-349      AC U3IJ31.1
#=GS A0A094KT88_ANTCR/244-341  AC A0A094KT88.1
#=GS A0A287BHD6_PIG/251-348    AC A0A287BHD6.1
#=GS F7H3R3_CALJA/233-330      AC F7H3R3.1
#=GS A0A2K5IUM5_COLAP/296-385  AC A0A2K5IUM5.1
#=GS A0A287AAV1_PIG/261-359    AC A0A287AAV1.1
#=GS H2S1W6_TAKRU/246-316      AC H2S1W6.1
#=GS A0A0D9R6Y5_CHLSB/278-352  AC A0A0D9R6Y5.1
#=GS A0A1U7TQC6_TARSY/251-348  AC A0A1U7TQC6.1
#=GS A0A091W273_NIPNI/243-300  AC A0A091W273.1
#=GS H2UBQ7_TAKRU/154-287      AC H2UBQ7.1
#=GS A0A2D0S3F9_ICTPU/336-442  AC A0A2D0S3F9.1
#=GS A0A1V4KVN2_PATFA/91-180   AC A0A1V4KVN2.1
#=GS A0A2I3N4P7_PAPAN/210-300  AC A0A2I3N4P7.1
#=GS A0A2I3MUB1_PAPAN/278-376  AC A0A2I3MUB1.1
#=GS A0A2I3T7A9_PANTR/412-502  AC A0A2I3T7A9.1
#=GS G1PTD6_MYOLU/163-252      AC G1PTD6.1
#=GS H2SGZ6_TAKRU/231-319      AC H2SGZ6.1
#=GS A0A2I3HJ98_NOMLE/251-348  AC A0A2I3HJ98.1
#=GS A0A0G2JYU0_RAT/254-345    AC A0A0G2JYU0.1
#=GS A0A091SCZ8_9GRUI/246-324  AC A0A091SCZ8.1
#=GS A0A2D0S5R2_ICTPU/262-352  AC A0A2D0S5R2.1
#=GS A0A2I2ZTX1_GORGO/210-300  AC A0A2I2ZTX1.1
#=GS A0A2D0S505_ICTPU/336-442  AC A0A2D0S505.1
#=GS A0A287AJG2_PIG/273-362    AC A0A287AJG2.1
#=GS G3VXH1_SARHA/268-365      AC G3VXH1.1
#=GS A0A2I3LP00_PAPAN/296-385  AC A0A2I3LP00.1
#=GS G1T6Y3_RABIT/275-344      AC G1T6Y3.2
#=GS A0A2I0M463_COLLI/246-336  AC A0A2I0M463.1
#=GS A0A087QIF9_APTFO/246-335  AC A0A087QIF9.1
#=GS H2T3K7_TAKRU/247-361      AC H2T3K7.1
#=GS A0A1S3SVH9_SALSA/272-362  AC A0A1S3SVH9.1
#=GS A0A2D0QRH4_ICTPU/213-308  AC A0A2D0QRH4.1
#=GS A0A1U7UTY6_TARSY/233-322  AC A0A1U7UTY6.1
#=GS A0A2D0S4D7_ICTPU/243-349  AC A0A2D0S4D7.1
#=GS A0A087QLK9_APTFO/244-301  AC A0A087QLK9.1
#=GS A0A1S3RYY1_SALSA/269-368  AC A0A1S3RYY1.1
#=GS A0A287DD64_ICTTR/178-251  AC A0A287DD64.1
#=GS H2SGZ4_TAKRU/243-331      AC H2SGZ4.1
#=GS G3VXH0_SARHA/275-372      AC G3VXH0.1
#=GS H2P476_PONAB/326-423      AC H2P476.1
#=GS A0A1L8GGP1_XENLA/259-360  AC A0A1L8GGP1.1
#=GS A0A2D0S6P0_ICTPU/237-327  AC A0A2D0S6P0.1
#=GS A0A096LSC3_POEFO/134-235  AC A0A096LSC3.1
#=GS M3YTQ2_MUSPF/273-363      AC M3YTQ2.1
#=GS A0A1S3R9U7_SALSA/264-332  AC A0A1S3R9U7.1
#=GS A0A1S3FUV6_DIPOR/325-422  AC A0A1S3FUV6.1
#=GS A0A226PNV8_COLVI/229-318  AC A0A226PNV8.1
#=GS A0A1S3N4Q3_SALSA/265-364  AC A0A1S3N4Q3.1
#=GS A0A1S3ESD3_DIPOR/204-295  AC A0A1S3ESD3.1
#=GS A0A1V4KTE6_PATFA/258-347  AC A0A1V4KTE6.1
#=GS H2UBQ5_TAKRU/268-356      AC H2UBQ5.1
#=GS A0A2K5IUK9_COLAP/339-429  AC A0A2K5IUK9.1
#=GS A0A2I2YP26_GORGO/252-324  AC A0A2I2YP26.1
#=GS A0A2I3H1P8_NOMLE/232-330  AC A0A2I3H1P8.1
#=GS A0A1U7TDP8_TARSY/256-354  AC A0A1U7TDP8.1
#=GS A0A1U8DKZ6_ALLSI/220-309  AC A0A1U8DKZ6.1
#=GS A0A2I2Y2Y5_GORGO/208-297  AC A0A2I2Y2Y5.1
#=GS F8VRS4_HUMAN/270-360      AC F8VRS4.1
#=GS F1P8W1_CANLF/265-362      AC F1P8W1.2
#=GS A0A286XQV7_CAVPO/252-350  AC A0A286XQV7.1
#=GS A0A0G2JRA5_HUMAN/264-361  AC A0A0G2JRA5.1
#=GS A0A096LZN0_POEFO/179-317  AC A0A096LZN0.1
#=GS A0A1U8CXS9_MESAU/278-357  AC A0A1U8CXS9.1
#=GS F1Q2X1_CANLF/273-364      AC F1Q2X1.2
#=GS A0A286XUA5_CAVPO/208-347  AC A0A286XUA5.1
#=GS A0A1S3RY41_SALSA/261-355  AC A0A1S3RY41.1
#=GS B7ZC11_MOUSE/91-143       AC B7ZC11.1
#=GS A0A2I4BK77_9TELE/261-355  AC A0A2I4BK77.1
#=GS A0A0F8C915_LARCR/261-354  AC A0A0F8C915.1
#=GS A0A1S3AIL6_ERIEU/252-310  AC A0A1S3AIL6.1
#=GS A0A1U8DXC6_ALLSI/176-265  AC A0A1U8DXC6.1
#=GS I3JJZ0_ORENI/238-328      AC I3JJZ0.1
#=GS A0A1S3N5B7_SALSA/261-360  AC A0A1S3N5B7.1
#=GS A0A2I3MM75_PAPAN/409-499  AC A0A2I3MM75.1
#=GS G3PTY5_GASAC/249-354      AC G3PTY5.1
#=GS H2SGZ5_TAKRU/264-352      AC H2SGZ5.1
#=GS G3WU33_SARHA/176-265      AC G3WU33.1
#=GS A0A2I0M452_COLLI/273-363  AC A0A2I0M452.1
#=GS A0A1S3RYY7_SALSA/257-351  AC A0A1S3RYY7.1
#=GS A0A2I4CZE3_9TELE/380-441  AC A0A2I4CZE3.1
#=GS H2SGZ3_TAKRU/256-344      AC H2SGZ3.1
#=GS A0A2K5N0P1_CERAT/231-305  AC A0A2K5N0P1.1
#=GS S7N4L1_MYOBR/279-401      AC S7N4L1.1
#=GS F1QZC1_DANRE/101-207      AC F1QZC1.1
#=GS A0A1S3RY42_SALSA/257-356  AC A0A1S3RY42.1
#=GS F6U870_XENTR/251-339      AC F6U870.1
#=GS A0A2I4BDG4_9TELE/243-331  AC A0A2I4BDG4.1
#=GS A0A1S3SVF4_SALSA/272-362  AC A0A1S3SVF4.1
#=GS S4R3K7_HUMAN/104-202      AC S4R3K7.1
#=GS F6UZ32_MONDO/253-342      AC F6UZ32.2
#=GS A0A2D0QC20_ICTPU/251-340  AC A0A2D0QC20.1
#=GS L5KH77_PTEAL/172-218      AC L5KH77.1
#=GS H0Z2C9_TAEGU/245-334      AC H0Z2C9.1
#=GS A0A2D0QC29_ICTPU/250-339  AC A0A2D0QC29.1
#=GS A0A0F8ACL1_LARCR/248-341  AC A0A0F8ACL1.1
#=GS A0A1S3N505_SALSA/269-368  AC A0A1S3N505.1
#=GS F5H0M1_HUMAN/210-300      AC F5H0M1.1
#=GS A0A093IGP4_EURHL/244-301  AC A0A093IGP4.1
#=GS A0A091SBL3_NESNO/102-199  AC A0A091SBL3.1
#=GS J3QRF4_HUMAN/207-343      AC J3QRF4.1
#=GS A0A2I3T592_PANTR/252-329  AC A0A2I3T592.1
#=GS A0A091GRT4_BUCRH/246-324  AC A0A091GRT4.1
#=GS H3CLA1_TETNG/141-205      AC H3CLA1.1
#=GS G3HTD6_CRIGR/208-299      AC G3HTD6.1
#=GS A0A2I3NBK9_PAPAN/326-424  AC A0A2I3NBK9.1
#=GS V8NKC7_OPHHA/179-310      AC V8NKC7.1
#=GS F6SR19_ORNAN/255-345      AC F6SR19.2
#=GS A0A1S3Q6Z3_SALSA/13-103   AC A0A1S3Q6Z3.1
#=GS M3WCL9_FELCA/256-353      AC M3WCL9.2
#=GS K7GIP0_PELSI/252-349      AC K7GIP0.1
#=GS A0A1U7UKW3_TARSY/233-322  AC A0A1U7UKW3.1
#=GS A0A287D2R9_ICTTR/253-342  AC A0A287D2R9.1
#=GS A0A151NSS8_ALLMI/255-346  AC A0A151NSS8.1
#=GS A0A2K5N126_CERAT/322-420  AC A0A2K5N126.1
#=GS A0A151NHV5_ALLMI/122-219  AC A0A151NHV5.1
#=GS I3JT01_ORENI/264-352      AC I3JT01.1
#=GS A0A091QDE8_MERNU/244-341  AC A0A091QDE8.1
#=GS RFX1L_DANRE/257-353       AC Q7ZT82.1
#=GS A0A2K5N0Q1_CERAT/251-348  AC A0A2K5N0Q1.1
#=GS A0A091I260_CALAN/238-327  AC A0A091I260.1
#=GS A0A151N6P9_ALLMI/118-207  AC A0A151N6P9.1
#=GS K7GIQ3_PELSI/256-331      AC K7GIQ3.1
#=GS A0A1U7T7D4_TARSY/256-335  AC A0A1U7T7D4.1
#=GS A0A2K5J7L9_COLAP/233-330  AC A0A2K5J7L9.1
#=GS A0A2I3FXJ2_NOMLE/233-330  AC A0A2I3FXJ2.1
#=GS A0A2I3LN24_PAPAN/231-320  AC A0A2I3LN24.1
#=GS H2UBQ3_TAKRU/251-339      AC H2UBQ3.1
#=GS A0A0P7V8B1_9TELE/246-342  AC A0A0P7V8B1.1
#=GS A0A1U8BN64_MESAU/209-346  AC A0A1U8BN64.1
#=GS A0A2I2ZL19_GORGO/270-360  AC A0A2I2ZL19.1
#=GS L9KZM2_TUPCH/343-430      AC L9KZM2.1
#=GS F7H8R7_CALJA/250-350      AC F7H8R7.1
#=GS H9G8L2_ANOCA/253-342      AC H9G8L2.1
#=GS A0A2I3MMM3_PAPAN/296-386  AC A0A2I3MMM3.1
#=GS A0A1S3Q2C1_SALSA/13-117   AC A0A1S3Q2C1.1
#=GS I3JJZ1_ORENI/255-345      AC I3JJZ1.1
#=GS A0A218ULG6_9PASE/251-340  AC A0A218ULG6.1
#=GS A0A2D0S3G4_ICTPU/326-432  AC A0A2D0S3G4.1
#=GS W5KT89_ASTMX/261-357      AC W5KT89.1
#=GS A0A096NT97_PAPAN/208-297  AC A0A096NT97.1
#=GS A0A091DZG1_FUKDA/190-282  AC A0A091DZG1.1
#=GS D3ZSL1_RAT/272-361        AC D3ZSL1.1
#=GS A0A218UYI9_9PASE/287-346  AC A0A218UYI9.1
#=GS A0A2D0S4D2_ICTPU/335-441  AC A0A2D0S4D2.1
#=GS M3VYQ8_FELCA/208-297      AC M3VYQ8.2
#=GS A0A2K5M613_CERAT/273-363  AC A0A2K5M613.1
#=GS A0A2K5M618_CERAT/273-364  AC A0A2K5M618.1
#=GS A0A1S3SVG4_SALSA/271-361  AC A0A1S3SVG4.1
#=GS A0A1S3S468_SALSA/324-370  AC A0A1S3S468.1
#=GS U3J0P2_ANAPL/255-344      AC U3J0P2.1
#=GS A0A0P7WTM9_9TELE/336-384  AC A0A0P7WTM9.1
#=GS G3W5N2_SARHA/253-342      AC G3W5N2.1
#=GS U3KF85_FICAL/258-355      AC U3KF85.1
#=GS A0A091GI64_9AVES/244-341  AC A0A091GI64.1
#=GS I3IT07_DANRE/186-274      AC I3IT07.1
#=GS A0A091EPA9_FUKDA/232-276  AC A0A091EPA9.1
#=GS A0A2I2YJ39_GORGO/231-305  AC A0A2I2YJ39.1
#=GS A0A091E8I1_CORBR/213-302  AC A0A091E8I1.1
#=GS H0XQL0_OTOGA/250-347      AC H0XQL0.1
#=GS A0A1U8BZ48_MESAU/209-346  AC A0A1U8BZ48.1
#=GS A0A1U8DKW4_ALLSI/221-310  AC A0A1U8DKW4.1
#=GS RFOX1_DANRE/228-318       AC Q642J5.1
#=GS W5L7E4_ASTMX/268-358      AC W5L7E4.1
#=GS A0A226N1F7_CALSU/229-318  AC A0A226N1F7.1
#=GS F6VG40_MACMU/208-256      AC F6VG40.2
#=GS A0A2K5J7M0_COLAP/238-341  AC A0A2K5J7M0.1
#=GS U3JN51_FICAL/255-333      AC U3JN51.1
#=GS A0A286ZN97_PIG/164-254    AC A0A286ZN97.1
#=GS A0A2K5M616_CERAT/210-300  AC A0A2K5M616.1
#=GS A0A2I3HCP8_NOMLE/412-502  AC A0A2I3HCP8.1
#=GS F7I7L6_CALJA/208-297      AC F7I7L6.1
#=GS G1NJB4_MELGA/49-146       AC G1NJB4.1
#=GS A0A1L8ETT9_XENLA/189-279  AC A0A1L8ETT9.1
#=GS F7EBP0_MACMU/273-363      AC F7EBP0.2
#=GS J9PAH3_CANLF/149-238      AC J9PAH3.1
#=GS M7BW59_CHEMY/248-337      AC M7BW59.1
#=GS L5LWH1_MYODS/172-217      AC L5LWH1.1
#=GS A0A091MSZ5_CARIC/102-199  AC A0A091MSZ5.1
#=GS A0A2K5KYQ7_CERAT/208-297  AC A0A2K5KYQ7.1
#=GS A0A2I3FTF4_NOMLE/231-305  AC A0A2I3FTF4.1
#=GS A0A2D0S3G5_ICTPU/336-404  AC A0A2D0S3G5.1
#=GS A0A287B1N9_PIG/255-329    AC A0A287B1N9.1
#=GS A0A286XFB1_CAVPO/273-363  AC A0A286XFB1.1
#=GS H2UBQ6_TAKRU/225-358      AC H2UBQ6.1
#=GS A0A1S3N4Z1_SALSA/257-356  AC A0A1S3N4Z1.1
#=GS A0A1S3SVJ5_SALSA/229-319  AC A0A1S3SVJ5.1
#=GS A0A087VDI8_BALRE/244-341  AC A0A087VDI8.1
#=GS B0QYY4_HUMAN/231-305      AC B0QYY4.1
#=GS G1NYE7_MYOLU/276-373      AC G1NYE7.1
#=GS A0A2I2USX5_FELCA/162-296  AC A0A2I2USX5.1
#=GS F1N2A9_BOVIN/273-370      AC F1N2A9.2
#=GS A0A091QVC9_9GRUI/244-301  AC A0A091QVC9.1
#=GS A0A2I3S2G7_PANTR/233-330  AC A0A2I3S2G7.1
#=GS A0A2D0S3J0_ICTPU/327-433  AC A0A2D0S3J0.1
#=GS S9X5T5_CAMFR/186-266      AC S9X5T5.1
#=GS H2SH01_TAKRU/179-318      AC H2SH01.1
#=GS A0A1U7UVD3_TARSY/233-323  AC A0A1U7UVD3.1
#=GS A0A2I3TES5_PANTR/248-347  AC A0A2I3TES5.1
#=GS A0A1S3ES88_DIPOR/275-365  AC A0A1S3ES88.1
#=GS A0A2I2Z2Y8_GORGO/251-348  AC A0A2I2Z2Y8.1
#=GS A0A1D5RBV2_MACMU/270-360  AC A0A1D5RBV2.1
#=GS I3KNI2_ORENI/269-373      AC I3KNI2.1
#=GS A0A1V4J944_PATFA/258-365  AC A0A1V4J944.1
#=GS H2QE03_PANTR/208-297      AC H2QE03.2
#=GS A0A1S3S4K3_SALSA/4-66     AC A0A1S3S4K3.1
#=GS F7HRQ0_CALJA/255-352      AC F7HRQ0.1
#=GS F7EBP5_MACMU/207-340      AC F7EBP5.2
#=GS A0A287DDI7_ICTTR/250-339  AC A0A287DDI7.1
#=GS F6QI07_MACMU/247-344      AC F6QI07.2
#=GS A0A2I0M460_COLLI/273-362  AC A0A2I0M460.1
#=GS H2RD17_PANTR/326-423      AC H2RD17.1
#=GS A0A287BC18_PIG/251-308    AC A0A287BC18.1
#=GS K7DQJ4_PANTR/251-348      AC K7DQJ4.1
#=GS H2LHA1_ORYLA/68-173       AC H2LHA1.1
#=GS A0A2D0S793_ICTPU/268-358  AC A0A2D0S793.1
A0A099Z397_TINGU/245-334             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
L5LNC9_MYODS/242-339                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........AGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1D5Q6R7_MACMU/252-328             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A1D5QDN2_MACMU/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7RYA0_ALLSI/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F7I2V7_CALJA/208-297                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2D0S5V0_ICTPU/226-316             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.AAPY.......................................................................................
A0A2K5KCS3_COLAP/208-344             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2K5M5Y0_CERAT/296-386             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A0R4IT73_DANRE/221-311             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
D4A2H6_RAT/208-346                   ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........-AA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
G3W5N1_SARHA/206-297                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
G1KS80_ANOCA/254-343                 ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRT..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2D0QD35_ICTPU/251-341             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....R.NHFVLVA.AD--ei.....................................................................................
V8PF00_OPHHA/170-267                 ......................................................................................................VPSFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F6UZW2_XENTR/256-362                 ......................................................................................................IPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPTYP.G...................................................VL.YQD..G.F.YGTE...LY..........GGY...........AAYRYTQl..psPPTSAltalpvppLTA....RMCTD.....ReYGRVY-T.ADPY.......................................................................................
A0A1S3FWY8_DIPOR/252-349             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1D5RKL3_MACMU/296-386             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3FWF2_DIPOR/321-399             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tdmhslllqpqpqllqppqpltatvmagc..........................................................
A0A2K5M622_CERAT/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I3NFD5_PAPAN/207-337             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........VS-...........-----AA.....PPGGR........---....VGSGV.....L.YGRVYAA.ADPY.......................................................................................
A0A2I3SVA2_PANTR/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A1U7TQC2_TARSY/256-353             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
W5NY52_SHEEP/239-332                 .......................................................................................ptgawpgrggagrgr----------.......--AEAGRGVAG...QRR....GGA..WPGR.GG....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A287DCV9_ICTTR/255-345             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I0MJ82_COLLI/227-324             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S2ZNG8_ERIEU/266-355             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1U7T7D9_TARSY/236-315             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........S--...........-------.....-----........---....-----.....-.-------.----aeemltshskslsgvsvpfsd..................................................................
A0A2K5M625_CERAT/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3N4P9_SALSA/265-364             .....................................................................................................f-ASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A1S3EQZ8_DIPOR/217-306             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I2YG89_GORGO/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
G3U5V8_LOXAF/301-358                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslll..............................................................................
A0A2I4CZD5_9TELE/380-449             ......................................................................................................VPGFPYPAAAaa..aaaTTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........---...........-------.....-----........---....-----.....-.-------.----tsvs...................................................................................
RFOX2_MOUSE/324-421                  ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A286ZXS1_PIG/273-363               ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.TDPY.......................................................................................
A0A1S3RY52_SALSA/265-359             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
G1RG65_NOMLE/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2MJ98_ORYLA/249-335                 .....................................................................................................v-PGFPYP---.......-----FRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQAAIPAYP.G...................................................LV.FQD..S.V.LSPR..lPQ..........GGY...........--YRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A1S3SVJ0_SALSA/241-331             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A218UNT6_9PASE/253-343             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
M3YMA3_MUSPF/278-375                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
K7EJX6_HUMAN/1-46                    .....................................................................................................x----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
I3JNP3_ORENI/262-369                 ......................................................................................................VPGFPYPTAAaa...atTAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPAIPAYP.G...................................................VV.YQD..G.F.YGAA..dLY..........GGYpaa....aaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A091G5A7_9AVES/234-323             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F6QHZ4_MACMU/251-348                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091PQS8_LEPDC/123-208             .....................................................................................................f-PGFLYPAAA.......TTAAAFQGAHP...RGQ....RRA..VYRA.VQ....-...A...V.PPTAILAYS.S...................................................VV.YQD..R.F.YRAD...LY..........GGH...........TAYRYAQ.....TATATa.....ttATA....AAYNN.....-.-------.----gf.....................................................................................
A0A1S3N609_SALSA/261-360             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A286XW96_CAVPO/253-342             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A091UL47_NIPNI/232-321             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A226ML19_CALSU/226-298             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GSF...........GV-----.....-----........---....-----.....-.-------.----ektrssydkl.............................................................................
A0A1S3RA65_SALSA/197-301             ......................................................................................................VPGFPYPSAAa....aaSTAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPALPAYP.G...................................................VV.YQD..GgF.YGAA..dLY..........GGYp.........aAAYRFAQ.....PTAVTga...taaAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A0Q3PZ38_AMAAE/207-253             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ya.....................................................................................
G1SF90_RABIT/274-372                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAH.....PPDNSpvr.vtraSPT....AALAV.....R.YGRVY-T.ADPY.......................................................................................
A0A0F8AML1_LARCR/284-392             ......................................................................................................VPGFPYPSAAaa..attAAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPAIPAYP.G...................................................VV.YQD..G.F.YGAA..dLY..........GGYpaa....aaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
H2L5M6_ORYLA/295-386                 ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAEillLQ..........GGY...........AAYRFAQ.....PATTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
I3K4K9_ORENI/261-352                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S..tA...T.TPAAVPTYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--T....ATYSD.....G.YGRVY-A.PEPY.......................................................................................
A0A0A0APK7_CHAVO/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H0XPW4_OTOGA/253-342                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1L8EM85_XENLA/207-295             ......................................................................................................VTGFPYPPAG.......-ATIAYRGAQL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....-TYSD.....S.YGRVYAA.ADPY.......................................................................................
RFOX3_HUMAN/208-297                  ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2SGZ8_TAKRU/261-349                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2K5J7X5_COLAP/252-328             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A2I4CZF2_9TELE/374-479             ......................................................................................................VPGFPYPAAAaa..aaaTTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1D5PL64_CHICK/235-325             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
H2UBQ1_TAKRU/255-343                 ......................................................................................................IPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A091L9Z4_CATAU/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1S3WNQ0_ERIEU/207-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGTHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.T...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3N332_PAPAN/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3N5Z9_SALSA/269-363             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
H0VIW7_CAVPO/248-337                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5N0K6_CERAT/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I2Z094_GORGO/296-386             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2K5KYU6_CERAT/208-283             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1U7TSA6_TARSY/252-326             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A1S3Q3B8_SALSA/344-403             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VA.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----mlriamls...............................................................................
RFOX3_MOUSE/208-345                  ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
U3KCT9_FICAL/255-347                 ............................................................................................shwprrrpsp----------.......PTAREYRGLLA...RGE....RWPccVAGV.SP....S...G...A.VPAPLSARG.V...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3SC88_PANTR/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U8CMD1_MESAU/278-337             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----pmdiplgvlhatelk........................................................................
A0A087X2B1_HUMAN/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U8DED7_ALLSI/289-378             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1L8EXD3_XENLA/88-178              ......................................................................................................VPGFPYPAAT.......AAAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5J806_COLAP/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A091NXD6_9PASS/230-323             ....................................................................................................ta--SSPWPFSL.......-SSVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IYl........gGGF...........QEETRPQ.....PSSLT........-PS....SVFAP.....S.YGRVYAA.ADPY.......................................................................................
A0A093IY67_FULGA/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A2I4BYT7_9TELE/316-425             ......................................................................................................VPGFPYPTAAaaa.attAAAAAFRGAHL...RGR....GRP..VYSA.MR....A...A...V.PQPAIPAYP.G...................................................VV.YQD..G.F.YGAA..eLY..........GGYpaa....aaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
H2UUP2_TAKRU/257-349                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNA.IR....S...A...A.APAAVPAFP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--A....ATYSD.....G.YGRVYTTaADPY.......................................................................................
A0A2I0MJ80_COLLI/258-356             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F7I9Y0_CALJA/240-329                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A0D9S496_CHLSB/208-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3EQZ5_DIPOR/275-364             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A0P7ZAM4_9TELE/95-185              ......................................................................................................VTGFPYPTAG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGTE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
H2UBQ2_TAKRU/269-357                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3FUV3_DIPOR/321-418             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A093I4L3_STRCA/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3RYY3_SALSA/261-360             .....................................................................................................f-ASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A091JC81_EGRGA/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A286ZMC4_PIG/251-330               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................Y-.--G..R.V.YTAD...PY..........HAL...........-------.....-----........---....-----.....-.-------.----apaasygvgavaslyrggysrf.................................................................
A0A1V4KVE5_PATFA/91-180              ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
G3R9Z2_GORGO/177-313                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091P7X3_HALAL/244-340             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATat...gpaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2D0QAJ2_ICTPU/251-336             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....R.E------.----raypf..................................................................................
A0A2K5J7Z5_COLAP/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
RFOX1_PONAB/253-342                  ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
L7MZV0_ANOCA/144-239                 ......................................................................................................VASIPYPMMA.......PAALAYRGA-L...RGR....GRA.tIYNP.IR....A...A...P.APSPVPAYG.S...................................................VL.YPD..G.L.YGSD...IY..........GYP...........AAYRVAQ.....TPAAAa......aTAA....AAYSD.....G.YGRVYTT.AEPY.......................................................................................
A0A087QXA5_APTFO/134-223             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A093CAC8_TAUER/163-252             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G3TVD2_LOXAF/254-344                 ......................................................................................................LTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........TAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
H2R1U0_PANTR/296-386                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2D0QAL7_ICTPU/205-294             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5M5Z8_CERAT/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H3D131_TETNG/257-345                 ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A0Q3M1A6_AMAAE/223-291             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----lteemltsrsk............................................................................
F6V6G6_HORSE/256-353                 ......................................................................................................VPGFPYPAAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
RFOX3_BOVIN/177-313                  ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F6T0W2_HORSE/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U7THU2_TARSY/252-328             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A1V4KTI4_PATFA/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F1N700_BOVIN/314-403                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3HBJ5_NOMLE/252-329             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tdmhslllqpqppllqplqpltatvmag...........................................................
G3NBT6_GASAC/211-345                 ......................................................................................................VTGFPYPGTG.......-AAV----AHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPGYG.Atddesivalllppsghrpppwlgi...qttvtavptgraspravvcpplfyVL.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1U8CZ79_MESAU/274-353             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..T.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----dmhslllqpqpqllqplqpltatvtagct..........................................................
A0A2I0M457_COLLI/233-322             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3S4I8_SALSA/325-371             ......................................................................................................VPGFPYPSAA......aSTAAAFRGAHL...RGR....GRP..MYSA.VR....A...A...V.PQPALPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
G3T7K4_LOXAF/163-253                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A091FIM5_CORBR/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A093GH09_DRYPU/245-334             ......................................................................................................MPGFPYPAAT.......-ATAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G1KSS4_ANOCA/323-420                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7RCL0_ALLSI/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.FQE..P.V.YGNK..fPQ..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
RFOX2_RAT/307-404                    ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I0MJ84_COLLI/258-355             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A093F4Y5_GAVST/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A2I0MJ91_COLLI/248-346             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A093NTW3_PYGAD/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3Q3A0_SALSA/336-440             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VM.YQE..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
A0A091PWJ2_HALAL/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U7SS45_ALLSI/221-310             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091CYD2_FUKDA/372-462             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3RDD8_SALSA/91-182              ......................................................................................................VPGFPYTAAS.......AAVAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPTYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PAAAT........--A....AAYGD.....R.NNLVLLA.AD--em.....................................................................................
G7PFB1_MACFA/264-361                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H2SGZ9_TAKRU/256-344                 ......................................................................................................LAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
RFOX1_HUMAN/253-342                  ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
M7AVJ5_CHEMY/209-297                 ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PPAAA........---....-AYSD.....S.YARVYAA.ADPY.......................................................................................
A0A2I4BDG2_9TELE/250-338             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
U3ILX2_ANAPL/170-255                 ............................................................................ppvvpnpeaaraagqaqalpreqrhg----------.......-----------...---....--P..GHDT.RR....L...R...T.PTPTGPATA.P...................................................GS.LQP..V.P.GGAR..lPQ..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....R.-------.----rrprl..................................................................................
A0A2K5IU09_COLAP/296-386             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
G3P9G0_GASAC/261-354                 ......................................................................................................VASFPYPVPT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A..aA.APTAVPGFP.G...................................................MV.YQE..G.L.YGAE...VY..........GGY..........pAAYRMAQ.....SASAA........--T....ATYSD.....G.YGRIYATaADPY.......................................................................................
A0A0R4IV43_DANRE/250-340             ......................................................................................................VPGFPYPAAT.......AAAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........TAYRYTQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
B7Z1U7_HUMAN/296-385                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A287BS62_PIG/273-364               ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A286Y5H6_CAVPO/208-347             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PAAAA........AAA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F1MWC7_BOVIN/233-323                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
H2S1W8_TAKRU/101-171                 ......................................................................................................VPGFPYSAAAaa...aaTTAATIRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........VGF...........CAF----.....-----........---....-----.....-.-------.----.......................................................................................
A0A1D5QZW6_MACMU/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1D5PKC0_CHICK/207-289             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........V--...........-------.....-SACN........NTP....LLFAP.....S.YGRVYAA.ADPY.......................................................................................
F1NCA4_CHICK/252-349                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5N0J9_CERAT/274-372             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3TFB9_PANTR/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0S510_ICTPU/267-373             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0QNU8_ICTPU/228-323             ......................................................................................................VASFPYPVPT.......-ATLAYRGSAL...RGR....GRA..VYNT.IRsaaaA...A...A.TPTAVPAYP.G...................................................VV.YQD..G.L.YGTE...VY..........GGY..........pAAYRVAQ.....SPSAT........-AT....ATYSD.....G.YGRLY-T.TDPY.......................................................................................
A0A2K5M647_CERAT/254-327             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIP---.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1A6H5H4_NEOLE/1-33                ......................................................................................................----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.TD--ei.....................................................................................
W5K4I4_ASTMX/174-263                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3Q385_SALSA/343-447             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VM.YQE..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
G3UNN2_LOXAF/164-253                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G3RL28_GORGO/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
RFOX2_BOVIN/269-366                  ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7T7E4_TARSY/252-349             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3FWY3_DIPOR/324-421             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091MSS9_9PASS/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3N265_PAPAN/262-360             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I4BDF5_9TELE/264-352             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
G1M6I5_AILME/246-335                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.AEPY.......................................................................................
A0A2I0LIN0_COLLI/91-180              ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2M6M4_ORYLA/259-352                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A...AaTPAAVPAYP.S...................................................VV.YQD..G.L.YGPE...VY..........GGY..........pTAYRVAP.....SASAA........--T....AAYSD.....G.YGRVYTTtADPY.......................................................................................
A0A0Q3M9K1_AMAAE/273-362             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2NQ24_PONAB/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A0A0A9X3_CHAVO/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
F1SPT7_PIG/274-371                   ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H9EP63_MACMU/208-297                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2SH00_TAKRU/210-349                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.AshvteplrclplcsrllprhlpktlpqqerqqfyrsrklvgemkrlqpahvVV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
G3RHU4_GORGO/252-324                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIP---.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3M1W8_PAPAN/256-354             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3ESC7_DIPOR/275-364             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3MHB2_PAPAN/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
H2LHA2_ORYLA/9-114                   ......................................................................................................VPGFPYPAAAaa...aaSTAATFRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQE..G.F.YGAA..dLY..........GGY...........ATYRYAQ.....PAAVAtpa.aaaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A287D4W1_ICTTR/209-282             .............................................................................................plppqqtpe----------.......-----------...---....---..----.--....-...-...-.-----PAYP.Tspafppl.....................................scpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091KRE3_9GRUI/163-252             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I2ZMK5_GORGO/208-344             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A287B6K6_PIG/251-314               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........N--...........-------.....-----........---....-----.....-.-------.----sltgt..................................................................................
A0A2K5N122_CERAT/252-328             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A1A6GLU0_NEOLE/262-335             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........S--...........-------.....-----........---....-----.....-.-------.----aeemltshskslsgv........................................................................
A0A1V4KTJ8_PATFA/258-347             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A286YA75_DANRE/268-358             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
G3THD0_LOXAF/208-344                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpq.....qtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........TAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2I0MJ88_COLLI/227-325             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5KCR3_COLAP/177-313             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3HBB5_NOMLE/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I2ZER1_GORGO/392-482             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3FUV8_DIPOR/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A096NJS9_PAPAN/326-423             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I2Y8G0_GORGO/326-423             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A287D4C7_ICTTR/260-318             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllq.............................................................................
A0A0G2JRD1_HUMAN/101-199             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5IU37_COLAP/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A286XLM2_CAVPO/258-355             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3N4D5_PAPAN/326-402             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A286YEU2_HUMAN/412-502             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
I3LWE2_ICTTR/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A0G2K2J4_RAT/208-299               ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........-AA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F6QHY3_MACMU/248-346                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1D5QTX8_MACMU/285-382             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A099Z334_TINGU/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A286XN55_CAVPO/258-356             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
M4AEU4_XIPMA/255-343                 ......................................................................................................ITGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1D5QCF5_MACMU/231-300             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPIES.A...................................................NC.FRS..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----nrvdmqptdmhslllqpqpp...................................................................
G1LKZ7_AILME/172-269                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A087YK80_POEFO/264-352             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A091IRJ4_EGRGA/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
I3MNN6_ICTTR/252-350                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
W5QBE8_SHEEP/251-351                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VY....GavrA...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATAT........AAT....AAAADwisfsS.YGRVY-T.ADPY.......................................................................................
A0A091FAN2_CORBR/245-334             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A286ZL66_PIG/325-369               ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A2K5J7G2_COLAP/264-361             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3HZ48_NOMLE/282-379             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
G3UAX5_LOXAF/247-344                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........KGH...........LVYGYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H0ZKM5_TAEGU/244-341                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
G5B2N0_HETGA/277-367                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5N131_CERAT/248-346             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2D0QAI2_ICTPU/222-311             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5KCR5_COLAP/208-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H0WAM5_CAVPO/281-362                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tdmhslllqlqpqllqplqpltatvmagytql.......................................................
A0A1S3AJ29_ERIEU/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091VU45_NIPNI/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3BRU6_MOUSE/270-300             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.--....-...-...-.---------.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
F6Q266_HORSE/273-364                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1U7THT2_TARSY/251-325             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A1U7UGQ6_TARSY/233-322             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1V4J9N4_PATFA/258-356             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I0M455_COLLI/246-336             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
L5KFD2_PTEAL/427-524                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3Q8N1_SALSA/13-103              ......................................................................................................VTGFPYPSTG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..A.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
I3JT02_ORENI/210-337                 ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.Aclertlirislsavglaae............tgnptspfpsfplgdpfaaeVV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1S3WNQ1_ERIEU/207-343             ......................................................................................................VTGFPYPTTG.......-TAVAYRGTHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.Taleqtlvkmpvpwaglapcplpp.....qtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
RFOX2_XENTR/251-352                  ......................................................................................................IPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPTYP.G...................................................VL.YQD..G.F.YGTE...LY..........GGY...........AAYRYTQ.....PATAAtaa.taaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3ER00_DIPOR/208-298             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.TD--ei.....................................................................................
A0A1S3Q3C3_SALSA/252-356             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VM.YQE..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
H2UBQ8_TAKRU/269-357                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.NTGCF--.----knafd..................................................................................
A0A1D5RDF5_MACMU/248-338             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3WNY8_ERIEU/208-344             ......................................................................................................VTGFPYPTTG.......-TAVAYRGTHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.Taleqtlvkmpvpwaglapcplpp.....qtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3RY43_SALSA/265-364             .....................................................................................................f-ASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A091MJW5_9PASS/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaap..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3ST32_PANTR/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5IU45_COLAP/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U8CQ52_MESAU/278-375             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7QL58_MESAU/209-299             ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....TAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A2I4CZE4_9TELE/380-485             ......................................................................................................VPGFPYPAAAaa..aaaTTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
G1N8Z5_MELGA/255-291                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PP-------.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1V4J9S2_PATFA/252-349             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3WNR6_ERIEU/208-344             ......................................................................................................VTGFPYPTTG.......-TAVAYRGTHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.Taleqtlvkmpvpwaglapcplpp.....qtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A087XUC4_POEFO/259-352             ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A...AgTPAAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pTAYRVAQ.....SASAA........--T....AAYSD.....G.YGRVYAAaADPY.......................................................................................
A0A091FX54_9AVES/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F6U1W3_MONDO/233-323                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3GSX1_DIPOR/162-250             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PTAAA........---....-AYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3N501_SALSA/257-356             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
V8P0G6_OPHHA/16-100                  ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTTAT........--A....TAYSD.....R.-------.----kmdgn..................................................................................
A0A1U7UAP0_TARSY/233-323             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I4BDF0_9TELE/279-367             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
F8VZG9_HUMAN/296-386                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I4BK73_9TELE/261-356             ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...Aa.aT.PATAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--T....AAYSD.....GrYGRVYATaADPY.......................................................................................
A0A0N8K0C0_9TELE/527-571             ......................................................................................................VTGLPYTTTG.......-TVAPYRGTHL...RGR....GRA..VYNA.FR....T...T...A.PPLPIPAYG.A...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
G5BY13_HETGA/259-356                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A287B025_PIG/224-321               ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
I3IRZ3_DANRE/111-202                 ......................................................................................................VPGFPYPAAT.......AAAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........TAYRYTQ.....PATAT........--A....AAYSD.....R.NHFVFVA.AD--ei.....................................................................................
A0A093Q910_9PASS/247-336             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
J9P300_CANLF/251-348                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5KYS8_CERAT/207-337             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........VS-...........-----AA.....PPGGR........---....EGSGV.....L.YGRVYAA.ADPY.......................................................................................
A0A096NLK2_PAPAN/254-327             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIP---.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I0M453_COLLI/246-335             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H3CA46_TETNG/106-160                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VF.FP-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----iifsllg................................................................................
I3IS43_DANRE/94-182                  ......................................................................................................VTGFPYPAAG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PATAT........---....-AYSD.....S.YGRVYAT.TDPY.......................................................................................
A0A2I3LID9_PAPAN/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3T7I1_PANTR/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2K5KYS5_CERAT/177-307             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........VS-...........-----AA.....PPGGR........---....EGSGV.....L.YGRVYAA.ADPY.......................................................................................
F1PJX5_CANLF/134-223                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2NUX7_PONAB/202-284                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....-.-------.----lawhp..................................................................................
K7FG99_PELSI/255-344                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3Q4W5_SALSA/344-446             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................IV.FQD..-.I.SSRL...PQ..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
A0A1S3ETS4_DIPOR/235-326             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.TD--ei.....................................................................................
H2MJ99_ORYLA/181-220                 ......................................................................................................VPGFPYPSAAaa..aatTAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...-.---------.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1S3RY40_SALSA/269-363             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
F7EBQ1_MACMU/252-341                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H3BM62_HUMAN/1-55                    .....................................................................................................x----------.......---------HL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.MLH..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tatpslplplplptvtvtdefm.................................................................
A0A2D0Q9F3_ICTPU/220-309             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
RFOX1_BOVIN/234-324                  ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I3HKC6_NOMLE/295-384             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5M5W6_CERAT/409-499             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
W5MI56_LEPOC/254-343                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
W5UL91_ICTPU/227-316                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0QC41_ICTPU/245-334             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3STY5_PANTR/288-387             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPSLC.L...................................................HV.CT-..S.V.CGRV...CV..........FLYt........wgERYLYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091K7I8_COLST/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
I3N5W6_ICTTR/210-282                 .............................................................................................lppqqtpep----------.......-----------...---....---..----.--....-...-...-.------AYP.Tspafppl.....................................scpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
W5N3A0_LEPOC/267-357                 ......................................................................................................LTGFPYPTTG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2K5IU78_COLAP/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
M7B5C9_CHEMY/257-354                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
W5KW05_ASTMX/322-428                 ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGA.VR....A...A...V.PQPAIPAYP.G...................................................IV.FQD..T.V.VSSR..lPQ..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1S3AIT1_ERIEU/232-329             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3TPX1_PANTR/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1D5Q780_MACMU/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A091N6B4_APAVI/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A093SXV0_9PASS/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1D5Q718_MACMU/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A2K5IUP0_COLAP/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3ETR9_DIPOR/275-365             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F7H3L9_CALJA/325-422                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3FVE5_DIPOR/320-417             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U8CMC6_MESAU/274-371             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7TQB5_TARSY/256-330             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A2I2UQ86_FELCA/258-356             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3LQ09_PAPAN/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
W5LJI4_ASTMX/90-134                  ......................................................................................................VTGFPYPPAG.......-AAVAYRGAQL...RGR....GRA..VYNT.FR....P...A...A.PPPPIPAYG.A...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A093P8A1_PYGAD/244-341             ......................................................................................................IPGFPYPTPP.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A286Y432_CAVPO/248-346             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091LQ75_CARIC/163-252             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A151NTY0_ALLMI/245-336             ......................................................................................................VASIPYPVVA.......PAALAYRGG-L...RGR....GRA..MYSP.IR....A...T...P.APSPVPAYG.S...................................................VV.YPD..G.L.YGAD...VY..........-GY...........TAYRVAQ.....PPTAA........AAA....AAYSD.....G.YGRVYTT.ADPY.......................................................................................
A0A2I2YMY6_GORGO/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3SVG7_SALSA/265-355             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
M4ASS0_XIPMA/101-204                 ......................................................................................................VPGFPYPAAAaaa.aaaSTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPAYP.G...................................................LV.FQD..-.I.SGRL...PQ..........GGY...........AAYRYAQ.....PAAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A093HSU6_STRCA/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...P.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1A6I067_NEOLE/219-357             ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........-AA....AAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A1D5Q505_MACMU/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F6QI01_MACMU/255-352                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091WJQ8_OPIHO/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1U8CMK9_MESAU/256-330             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
K7ESF7_HUMAN/13-102                  ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
U3JA78_DANRE/262-352                 ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
L9LB20_TUPCH/109-200                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYGgG...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3RY48_SALSA/265-359             .....................................................................................................f-ASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A2I3T5L7_PANTR/177-313             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1D5QDD4_MACMU/208-239             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....---..----.--....-...-...-.---------.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----vpgpgeawr..............................................................................
H2SH02_TAKRU/238-315                 ......................................................................................................LAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFS-.....-.-------.----dr.....................................................................................
A0A151MLZ5_ALLMI/31-109              ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....-.-------.----r......................................................................................
A0A091PMK2_APAVI/247-336             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I4CZF0_9TELE/380-482             ......................................................................................................VPGFPYPAAAaa..aaaTTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................LV.FQD..-.I.SGRL...PQ..........GGY...........AAYRYAQ.....PTAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
J3QQZ2_HUMAN/177-313                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3TGQ4_PANTR/252-324             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIP---.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G7Q0G1_MACFA/196-318                 ..................................lhgtvvegrkievnnatarvmtnkktvnpytngwklnpvvgavyspefyagtvllcqanqegssmysa----------.......-----------...---....---..----.--....-...-...-.-PSSLVYTS.A...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G3RYN1_GORGO/208-283                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I0M456_COLLI/273-362             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2T3K8_TAKRU/244-358                 ......................................................................................................VPGFPYPSAAaattaaaAAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQPAIPAYP.G...................................................LV.FQD..S.V.LSAR..lPQ..........GGYpaaaaaaaaaaAAYRYTQ.....PATVTg.....atPAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
F6QLM9_ORNAN/253-310                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
F6YYV0_HORSE/245-336                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........-AA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
S9YAA4_CAMFR/115-195                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................L-.---..-.-.----...GS..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1U8DW10_ALLSI/193-282             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3RY39_SALSA/261-360             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
H2SGZ7_TAKRU/263-352                 ......................................................................................................IAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE..iYQ..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1S3AIV4_ERIEU/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
I3ISM5_DANRE/246-303                 ......................................................................................................VTGFPYPAAG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A093GI91_DRYPU/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
M3YLL6_MUSPF/265-354                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
S9X0D9_CAMFR/249-294                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----y......................................................................................
H2UUP4_TAKRU/113-235                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNA.IR....S...A...A.APAAVPAFP.Gicsaiaaqpvrfafa.....................ppphthththspppsVV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--A....ATYSD.....G.YGRVYTTaADPY.......................................................................................
A0A0F8AI01_LARCR/1-79                ......................................................................................................----------.......---MAYRGTHL...RGR....GRA..VYNT.FR....A...T...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAGTA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
H2UBQ4_TAKRU/242-330                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2UUP3_TAKRU/137-229                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNA.IR....S...A...A.APAAVPAFP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--A....ATYSD.....G.YGRVYTTaADPY.......................................................................................
A0A1U8CQ56_MESAU/278-341             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........N--...........-------.....-----........---....-----.....-.-------.----sltgt..................................................................................
A0A1U8CXS3_MESAU/278-352             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A2I3SLN1_PANTR/248-321             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................ML.LCH..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----cacpwvqklrsvywtysfpfpipt...............................................................
G3I8S9_CRIGR/252-349                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091HFF9_BUCRH/246-343             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1L8EQ14_XENLA/186-277             ......................................................................................................VPGFPYPAAT......aAAAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A093JCM1_FULGA/163-252             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G3WU32_SARHA/251-340                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
M4ACI8_XIPMA/259-352                 ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A...AgAPAAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pTAYRVAQ.....SASAA........--T....AAYSD.....G.YGRVYAAaADPY.......................................................................................
A0A1U7RLG5_ALLSI/155-246             ......................................................................................................VASIPYPVVA.......PAALAYRGG-L...RGR....GRA..VYSP.IR....A...T...P.APSPVPAYG.S...................................................VV.YPD..G.L.YGAD...VY..........-GY...........TAYRVAQ.....PPTAA........AAA....AAYSD.....G.YGRVYTT.ADPY.......................................................................................
A0A2I3MD07_PAPAN/177-307             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........VS-...........-----AA.....PPGGR........---....VGSGV.....L.YGRVYAA.ADPY.......................................................................................
H3CRM9_TETNG/140-235                 ......................................................................................................VASFPYPVAA.......-PTLAYRSSAL...RGR....GRA..VYNA.IR....S...A...A.APAAVPAFP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA.......aAAA....ATYSD.....G.YGRVYATaADPY.......................................................................................
H3CA46_TETNG/169-240                 ............................................................................................nvlteirapd----------.......-----------...---....---..--CT.FI....N...A...A.APINCPGGG.C...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F6VG49_MACMU/177-313                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091IKT3_CALAN/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1D5R9S2_MACMU/232-329             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3ES93_DIPOR/209-298             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F6ZVB7_HORSE/258-347                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1U8CZ75_MESAU/274-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A1U7TDP4_TARSY/252-331             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........S--...........-------.....-----........---....-----.....-.-------.----aeemltshskslsgvsvpfsd..................................................................
A0A0D9R8Q5_CHLSB/255-345             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1L8GGP0_XENLA/257-359             ......................................................................................................IPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPTYP.G...................................................LV.LQE..P.I.LNPK..lPQ..........GGY...........AAYRYAQ.....PATAAtaa.taaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
A0A2I2ZYE3_GORGO/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F7D8X8_HORSE/242-316                 ......................................................................................................IPGFPYPAAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
M3ZVN0_XIPMA/187-344                 ............................................................kivspypnagwklspmvgavygpeiyagkgvrrlpndrsdvl----------.......-----------...---....---..----.--....-...-...T.FQPAIPTYP.Glcttpfapllplhhtlpsctfp......lrfprllctsamsapllappalsVV.YQD..G.F.YGAA..dLY..........GGYpaaa..aaaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
RFOX2_HUMAN/265-362                  ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A094JZK5_ANTCR/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H0XYE1_OTOGA/230-319                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091I6N7_CALAN/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1S3N512_SALSA/257-351             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
G3NVX0_GASAC/255-355                 ......................................................................................................LPGFPYPSAAaa...aaTTAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VV.YQD..G.F.YGAA..dLY..........WGW...........ALYRYAQ.....PTAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A1S3S486_SALSA/4-66                ................................................................................................fmelqt----------.......-----------...---....---..----.--....-...-...-.-------Y-.T...................................................IV.FQD..S.V.ISSR..lSQ..........GGYp.........aAAYRFAQ.....PTAVTga...taaAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A2K5J7W6_COLAP/232-329             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7R2F0_MESAU/274-372             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1V4J9X9_PATFA/258-355             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2D0QNT8_ICTPU/255-350             ......................................................................................................VASFPYPVPT.......-ATLAYRGSAL...RGR....GRA..VYNT.IRsaaaA...A...A.TPTAVPAYP.G...................................................VV.YQD..G.L.YGTE...VY..........GGY..........pAAYRVAQ.....SPSAT........-AT....ATYSD.....G.YGRLY-T.TDPY.......................................................................................
G7PT23_MACFA/162-266                 .................................................dadrareklngtivegrkievnnatarvmtnkktgnpytngwklnpvvgavyg----------.......-----------...---....---..----.--....-...-...-.---------.Pefy.............................................agkVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3RZ93_SALSA/265-364             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A094KC66_9AVES/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1S3Q380_SALSA/344-448             ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VM.YQE..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
A0A1U7TSB4_TARSY/225-304             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........S--...........-------.....-----........---....-----.....-.-------.----aeemltshskslsgvsvpfsd..................................................................
A0A1U7SLT9_TARSY/208-298             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A287B9H0_PIG/247-345               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F7DP45_MONDO/256-353                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3RZ97_SALSA/257-356             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
G1KYG2_ANOCA/227-322                 ......................................................................................................VASIPYPMMA.......PAALAYRGA-L...RGR....GRA.tIYNP.IR....A...A...P.APSPVPAYG.S...................................................VL.YPD..G.L.YGSD...IY..........GYP...........AAYRVAQ.....TPAAAa......aTAA....AAYSD.....G.YGRVYTT.AEPY.......................................................................................
A0A1D5PVK3_CHICK/252-341             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A093QZD6_PHACA/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A287BC80_PIG/164-301               ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwtglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1D5PDT1_CHICK/176-258             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........V--...........-------.....-SACN........NTP....LLFAP.....S.YGRVYAA.ADPY.......................................................................................
A0A1U7SF44_TARSY/208-345             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
B0QYV1_HUMAN/232-329                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3ACU1_ERIEU/208-298             ......................................................................................................VTGFPYPTTG.......-TAVAYRGTHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.T...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I0M454_COLLI/246-335             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1A6GP95_NEOLE/15-72               ..............................................................................................slwlhalv----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................--.-IE..A.V.YFTE...LV..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
W5N392_LEPOC/227-317                 ......................................................................................................VTGFPYPTTG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1V4J998_PATFA/261-358             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F1Q2W1_CANLF/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3TXS3_PANTR/208-344             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1D5PMS0_CHICK/262-352             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A0P7WYS9_9TELE/218-316             ......................................................................................................VPGFPYPTAAa....aaSTAAVFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VV.YQD..G.F.YGAA..dIY..........GGY...........AAYRYAQ.....PAAVTg......aTAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A2K6EDK7_MOUSE/252-331             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..T.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----dmhslllqpqpqllqplqpltatvtagct..........................................................
A0A087X7Y4_POEFO/183-292             ......................................................................................................VPGFPYPTAAaaa.aatTAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPTIPAYP.G...................................................VV.YQD..G.F.YGAA..dLY..........GGYpaa....aaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A2D0S5S9_ICTPU/268-358             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.AAPY.......................................................................................
J3KNW3_HUMAN/258-347                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
S7NLF6_MYOBR/296-393                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........AGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7TSB9_TARSY/256-332             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqpqppllqplqpltatvma...........................................................
A0A1S2ZNG9_ERIEU/266-356             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lVQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1S2ZNF0_ERIEU/266-356             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lVQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1U7THT7_TARSY/252-350             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F1RKX4_PIG/233-323                   ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
F6YTR4_XENTR/246-347                 ......................................................................................................IPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPTYP.G...................................................VL.YQD..G.F.YGTE...LY..........GGY...........AAYRYTQ.....PATAAtaa.taaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I0M474_COLLI/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
H0W1U4_CAVPO/177-316                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PAAAA........AAA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H3BGD1_LATCH/246-337                 ......................................................................................................LTGFPYPTAG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................IL.YLD..N.IaYKNN...IA..........GGY...........AAYRYAQ.....PAAAA........--A....TAYSD.....S.YGRVYTA.ADPY.......................................................................................
A0A087Y8E4_POEFO/323-428             ......................................................................................................VPGFPYPAAAaa..aaaSTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPAYP.G...................................................VMaYQD..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PAAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
RFOX1_MOUSE/252-341                  ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3FUW1_DIPOR/256-353             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H3A277_LATCH/259-358                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYSA.VR....A...A...V.PPTAIQAYP.G...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PATAAtaa.aataAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A0G2JYY7_RAT/274-372               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
U3IJ31_ANAPL/252-349                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A094KT88_ANTCR/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A287BHD6_PIG/251-348               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F7H3R3_CALJA/233-330                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RVR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5IUM5_COLAP/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A287AAV1_PIG/261-359               ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H2S1W6_TAKRU/246-316                 ......................................................................................................VPGFPYSAAAaa...aaTTAATIRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........VGF...........CAF----.....-----........---....-----.....-.-------.----.......................................................................................
A0A0D9R6Y5_CHLSB/278-352             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........VS-...........-------.....-----........---....-----.....-.-------.----thtgafstpspdkpa........................................................................
A0A1U7TQC6_TARSY/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091W273_NIPNI/243-300             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
H2UBQ7_TAKRU/154-287                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.Gfpavpqnvlmsqtalwatltfp......plpplqsrqdalscliccchssvVV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0S3F9_ICTPU/336-442             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1V4KVN2_PATFA/91-180              ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3N4P7_PAPAN/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I3MUB1_PAPAN/278-376             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3T7A9_PANTR/412-502             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
G1PTD6_MYOLU/163-252                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2SGZ6_TAKRU/231-319                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2I3HJ98_NOMLE/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A0G2JYU0_RAT/254-345               ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.TD--ei.....................................................................................
A0A091SCZ8_9GRUI/246-324             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....-.-------.----.......................................................................................
A0A2D0S5R2_ICTPU/262-352             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.AAPY.......................................................................................
A0A2I2ZTX1_GORGO/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2D0S505_ICTPU/336-442             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................IV.FQD..S.V.VSSR..lPQ..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A287AJG2_PIG/273-362               ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.TDPY.......................................................................................
G3VXH1_SARHA/268-365                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3LP00_PAPAN/296-385             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
G1T6Y3_RABIT/275-344                 ..........................................................................................ppqqtpepaypt----------.......-----------...---....---..----.-S....S...A...F.PPLSCPFAS.R...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....-AYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I0M463_COLLI/246-336             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A087QIF9_APTFO/246-335             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2T3K7_TAKRU/247-361                 ......................................................................................................VPGFPYPSAAaattaaaAAAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQPAIPAYP.G...................................................VV.YQD..G.F.YSAA..dLY..........GGYpaaaaaaaaaaAAYRYTQ.....PATVTg.....atPAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
A0A1S3SVH9_SALSA/272-362             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2D0QRH4_ICTPU/213-308             ......................................................................................................VASFPYPVPT.......-ATLAYRGSAL...RGR....GRA..VYNT.IRsaaaA...A...A.TPTAVPAYP.G...................................................VV.YQD..G.L.YGTE...VY..........GGY..........pAAYRVAQ.....SPSAT........-AT....ATYSD.....G.YGRLY-T.TDPY.......................................................................................
A0A1U7UTY6_TARSY/233-322             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0S4D7_ICTPU/243-349             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A087QLK9_APTFO/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A1S3RYY1_SALSA/269-368             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A287DD64_ICTTR/178-251             .............................................................................................plppqqtpe----------.......-----------...---....---..----.--....-...-...-.-----PAYP.Tspafppl.....................................scpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2SGZ4_TAKRU/243-331                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
G3VXH0_SARHA/275-372                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H2P476_PONAB/326-423                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1L8GGP1_XENLA/259-360             ......................................................................................................IPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPTYP.G...................................................VL.YQD..G.F.YGTE...LY..........GGY...........AAYRYAQ.....PATAAtaa.taaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
A0A2D0S6P0_ICTPU/237-327             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.AAPY.......................................................................................
A0A096LSC3_POEFO/134-235             ...........................................................................................ltfitlpvpgf----------.......----PYPTAHL...RGR....GRP..VYSA.VR....A...A...V.PQPTIPAYP.G...................................................LV.LQD..S.V.LSPRl.pQQ..........GGYpaa....aaaaAAYRYAQ.....PAAVTg.....atAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
M3YTQ2_MUSPF/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAA........--A....AAYSD.....R.NQYVFVA.AD--ei.....................................................................................
A0A1S3R9U7_SALSA/264-332             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........V--...........-------.....-----........---....-----.....-.-------.----stvvsfslra.............................................................................
A0A1S3FUV6_DIPOR/325-422             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A226PNV8_COLVI/229-318             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3N4Q3_SALSA/265-364             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A1S3ESD3_DIPOR/204-295             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.TD--ei.....................................................................................
A0A1V4KTE6_PATFA/258-347             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2UBQ5_TAKRU/268-356                 ......................................................................................................IPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5IUK9_COLAP/339-429             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I2YP26_GORGO/252-324             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIP---.-...................................................--.---..-.-.----...--..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I3H1P8_NOMLE/232-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G..................................................pCV.YMY..V.W.VCVF...LY..........TWG...........ERYLYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7TDP8_TARSY/256-354             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U8DKZ6_ALLSI/220-309             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I2Y2Y5_GORGO/208-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F8VRS4_HUMAN/270-360                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
F1P8W1_CANLF/265-362                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A286XQV7_CAVPO/252-350             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A0G2JRA5_HUMAN/264-361             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A096LZN0_POEFO/179-317             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.Airpeiprplpptlrpfaaagscliy.taescdraafsasycppllspttaaVV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1U8CXS9_MESAU/278-357             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..T.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----dmhslllqpqpqllqplqpltatvtagct..........................................................
F1Q2X1_CANLF/273-364                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A286XUA5_CAVPO/208-347             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PAAAA........AAA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3RY41_SALSA/261-355             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
B7ZC11_MOUSE/91-143                  ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................AL.EQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tlvk...................................................................................
A0A2I4BK77_9TELE/261-355             ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...Aa.aT.PATAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SASAA........--T....AAYSD.....G.YGRVYATaADPY.......................................................................................
A0A0F8C915_LARCR/261-354             ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A...AaTPAAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYTTaADPY.......................................................................................
A0A1S3AIL6_ERIEU/252-310             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..T.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----dmhsqllq...............................................................................
A0A1U8DXC6_ALLSI/176-265             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
I3JJZ0_ORENI/238-328                 ......................................................................................................VAGFPYPSAG.......-AAVAYRGAHL...RGR....GRA..IYNT.FR....A...A...P.PPPPIPTYG.T...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAGTA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1S3N5B7_SALSA/261-360             .....................................................................................................f-ASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A2I3MM75_PAPAN/409-499             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
G3PTY5_GASAC/249-354                 ......................................................................................................VPGFPYPAAAaaa.aaaSTAASFRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................CG.FGK..G.R.YGYE..pHN..........GGY...........AAYRYAQ.....PTAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
H2SGZ5_TAKRU/264-352                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
G3WU33_SARHA/176-265                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I0M452_COLLI/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3RYY7_SALSA/257-351             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.G...................................................VL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A2I4CZE3_9TELE/380-441             ......................................................................................................VPGFPYPAAAaa..aaaTTAATFRGTHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VA.MR-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----rivtpsr................................................................................
H2SGZ3_TAKRU/256-344                 ......................................................................................................LAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A2K5N0P1_CERAT/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
S7N4L1_MYOBR/279-401                 ......................................................................................................MPGFPYPAAT.......-AAAAYRVTPFgprRPR....PPS..LPTE.GK....W...A...A.SGAGLPAPP.Llfahagldrptrtp.......................smqpgacsgapckeVV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
F1QZC1_DANRE/101-207                 ......................................................................................................VPGFPYPTTAaaa.aaaSTAASFRGAHL...RGR....GRP..VYGA.VR....A...A...V.PQPAIPAYP.G...................................................VV.YQD..G.F.YGAT..eLY..........SGY...........TAYRYTQ.....PTAVAspt.aaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3RY42_SALSA/257-356             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
F6U870_XENTR/251-339                 .......................................................................................mptfnikaftvqklr----------.......------RSRDM...RVT....SRE..IYYI.YK....E...S...T.GSITIAFYN.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....-AYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I4BDG4_9TELE/243-331             ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1S3SVF4_SALSA/272-362             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
S4R3K7_HUMAN/104-202                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F6UZ32_MONDO/253-342                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2D0QC20_ICTPU/251-340             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
L5KH77_PTEAL/172-218                 .....................................................................................................l----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H0Z2C9_TAEGU/245-334                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2D0QC29_ICTPU/250-339             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAA........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A0F8ACL1_LARCR/248-341             ......................................................................................................VASFPYPVAT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...A...AaTPAAVPAYP.G...................................................VV.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYTTaADPY.......................................................................................
A0A1S3N505_SALSA/269-368             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
F5H0M1_HUMAN/210-300                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A093IGP4_EURHL/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A091SBL3_NESNO/102-199             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
J3QRF4_HUMAN/207-343                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3T592_PANTR/252-329             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQP..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----tdmhslllqpqppllqplqpltatvmag...........................................................
A0A091GRT4_BUCRH/246-324             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....-.-------.----.......................................................................................
H3CLA1_TETNG/141-205                 ......................................................................................................VPGFPYPAAAaa...aaTTAATIRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA...--..........---...........-------.....-----........---....-----.....-.-------.----dly....................................................................................
G3HTD6_CRIGR/208-299                 ......................................................................................................VTSFPYPTTG.......-TTVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........-AA....AAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A2I3NBK9_PAPAN/326-424             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
V8NKC7_OPHHA/179-310                 ......................................................................................................VTGFPYPATG.......-TAVAYRGTHL...RGR....GRT..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----gamrptdtpslrqrqqkltatgxxppacgsgsnslqrqvkdaqqsnngvnkyegvtaefmqlltltttllallpptasapwlvytee
F6SR19_ORNAN/255-345                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3Q6Z3_SALSA/13-103              ......................................................................................................VTGFPYPSTG.......-AAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..A.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
M3WCL9_FELCA/256-353                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
K7GIP0_PELSI/252-349                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U7UKW3_TARSY/233-322             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A287D2R9_ICTTR/253-342             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A151NSS8_ALLMI/255-346             ......................................................................................................VASIPYPVVA.......PAALAYRGG-L...RGR....GRA..MYSP.IR....A...T...P.APSPVPAYG.S...................................................VV.YPD..G.L.YGAD...VY..........-GY...........TAYRVAQ.....PPTAA........AAA....AAYSD.....G.YGRVYTT.ADPY.......................................................................................
A0A2K5N126_CERAT/322-420             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................IV.LQE..P.I.ISAK..iPQ..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A151NHV5_ALLMI/122-219             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
I3JT01_ORENI/264-352                 ......................................................................................................VTGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A091QDE8_MERNU/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
RFX1L_DANRE/257-353                  ......................................................................................................VASFPYPVPT.......-PTLAYRGSGL...RGR....GRA..VYNT.IR....S...AaaaA.TPAAVPAYP.G...................................................VV.YQE..G.L.YGAE...VY..........GGY..........pATYRVAQ.....SASAA........-AT....ATYSD.....G.YGRVYATaTDPY.......................................................................................
A0A2K5N0Q1_CERAT/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091I260_CALAN/238-327             ..................................................................................................hpcv----PWDLSP.......-AGVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A151N6P9_ALLMI/118-207             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
K7GIQ3_PELSI/256-331                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........Y--...........-------.....-----........---....-----.....-.-------.----tqiefvnhsrsnevdmq......................................................................
A0A1U7T7D4_TARSY/256-335             ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........S--...........-------.....-----........---....-----.....-.-------.----aeemltshskslsgvsvpfsd..................................................................
A0A2K5J7L9_COLAP/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3FXJ2_NOMLE/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I3LN24_PAPAN/231-320             ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2UBQ3_TAKRU/251-339                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A0P7V8B1_9TELE/246-342             ......................................................................................................VASFPYPVAT.......-PTLAYRGSTL...RGR....GRA..VYNXxIRs..aA...A...A.TPAAVPAYP.G...................................................VV.YQD..G.L.YSAE...VY..........GGY..........pAAYRVAQ.....SASAA........-AA....ATYSD.....G.YGRVYTAtADPY.......................................................................................
A0A1U8BN64_MESAU/209-346             ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....TAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A2I2ZL19_GORGO/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
L9KZM2_TUPCH/343-430                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....--YSD.....S.YGRVYAA.ADPY.......................................................................................
F7H8R7_CALJA/250-350                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQpgfpyPTAAT........TAAafrgAHYSD.....G.YGRVY-T.ADPY.......................................................................................
H9G8L2_ANOCA/253-342                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTTAT........--A....AAYSD.....S.YGRLY-A.ADPY.......................................................................................
A0A2I3MMM3_PAPAN/296-386             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3Q2C1_SALSA/13-117              ......................................................................................................VPGFPYPAAAaq...aaTAAATFRGAHL...RGR....GRP..VYSA.VR....A...A...L.PQQAIPTYP.G...................................................VM.YQE..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PTAVAspa.gaaaAAA....AAYSD.....G.YGRVY-T.TDPY.......................................................................................
I3JJZ1_ORENI/255-345                 ......................................................................................................MAGFPYPSAG.......-AAVAYRGAHL...RGR....GRA..IYNT.FR....A...A...P.PPPPIPTYG.T...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAGTA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A218ULG6_9PASE/251-340             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2D0S3G4_ICTPU/326-432             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
W5KT89_ASTMX/261-357                 ......................................................................................................VASFPYPVPT.......-PTLAYRGSAL...RGR....GRA..VYNT.IR....S...AataA.TPAAVPAYP.G...................................................VV.YQE..G.L.YGTE...VY..........GGY..........pATYRVAQ.....SPSAA........-AT....AAYSD.....G.YGRVYATaTDPY.......................................................................................
A0A096NT97_PAPAN/208-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A091DZG1_FUKDA/190-282             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PAAAA........AAA....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
D3ZSL1_RAT/272-361                   ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A218UYI9_9PASE/287-346             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslllqq............................................................................
A0A2D0S4D2_ICTPU/335-441             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
M3VYQ8_FELCA/208-297                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A2K5M613_CERAT/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2K5M618_CERAT/273-364             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A1S3SVG4_SALSA/271-361             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1S3S468_SALSA/324-370             ......................................................................................................VPGFPYPSAA......aSTAAAFRGAHL...RGR....GRP..MYSA.VR....A...A...V.PQPALPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
U3J0P2_ANAPL/255-344                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A0P7WTM9_9TELE/336-384             ......................................................................................................VPGFPYPTAAa....aaTTAAAFRGAHL...RGR....GRP..VYSA.VR....A...A...V.PQPAIPAYP.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----r......................................................................................
G3W5N2_SARHA/253-342                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
U3KF85_FICAL/258-355                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091GI64_9AVES/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
I3IT07_DANRE/186-274                 ......................................................................................................VTGFPYPAAG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYTQ.....PATAT........---....-AYSD.....S.YGRVYAT.TDPY.......................................................................................
A0A091EPA9_FUKDA/232-276             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A2I2YJ39_GORGO/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A091E8I1_CORBR/213-302             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H0XQL0_OTOGA/250-347                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1U8BZ48_MESAU/209-346             ......................................................................................................VTSFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--T....TAYSD.....S.YGRVYAA.TDPY.......................................................................................
A0A1U8DKW4_ALLSI/221-310             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
RFOX1_DANRE/228-318                  ......................................................................................................VPGFPYPAAT.......AAAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPHIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........TAYRYTQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
W5L7E4_ASTMX/268-358                 ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A226N1F7_CALSU/229-318             ......................................................................................................VTGFPYPATG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F6VG40_MACMU/208-256                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGRvpgpGEG..NGEA.LR....S...A...A.---------.-...................................................--.---..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----fpdlgvyaaa.............................................................................
A0A2K5J7M0_COLAP/238-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G..................................................pCV.YTYvrL.C.VGGC...VF..........--Fct......pggERYLYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
U3JN51_FICAL/255-333                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....-.-------.----.......................................................................................
A0A286ZN97_PIG/164-254               ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2K5M616_CERAT/210-300             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I3HCP8_NOMLE/412-502             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
F7I7L6_CALJA/208-297                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
G1NJB4_MELGA/49-146                  ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1L8ETT9_XENLA/189-279             ......................................................................................................VTGFPYPPAG.......-ATIAYRGAQL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
F7EBP0_MACMU/273-363                 ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
J9PAH3_CANLF/149-238                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
M7BW59_CHEMY/248-337                 ......................................................................................................VPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
L5LWH1_MYODS/172-217                 ...............................................................................................eklhgtv----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................--.---..-.V.EGRK...IE..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A091MSZ5_CARIC/102-199             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2K5KYQ7_CERAT/208-297             ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A2I3FTF4_NOMLE/231-305             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A2D0S3G5_ICTPU/336-404             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........---...........-------.....-----........---....-----.....-.-------.----nsvs...................................................................................
A0A287B1N9_PIG/255-329               ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
A0A286XFB1_CAVPO/273-363             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2UBQ6_TAKRU/225-358                 ......................................................................................................VPGFPYPAAS.......--AAAYRGAHL...RGR....GRT..VFNT.FR....A...A...A.PPPHIPAYG.Gfpavpqnvlmsqtalwatltfp......plpplqsrqdalscliccchssvVV.YQD..G.F.YGAD...IY..........GGY...........ATYRYAQ.....PAAAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A1S3N4Z1_SALSA/257-356             ......................................................................................................VASFPYPVAA.......-PTLAYRGSPL...RGR....GRA..VYNT.IRs..aA...A...A.APTAMPAYP.Gms..............................................pfsVL.YQD..G.L.YGAE...VY..........GGY..........pAAYRVAQ.....SPSAA........--T....ATYSD.....G.YGRVYAAaTDPY.......................................................................................
A0A1S3SVJ5_SALSA/229-319             ......................................................................................................VAGFPYPSTG.......-ATVAYRGAHF...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAATA........--A....TAYSD.....S.YGRVYAT.ADPY.......................................................................................
A0A087VDI8_BALRE/244-341             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
B0QYY4_HUMAN/231-305                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........IES...........-------.....-----........---....-----.....-.-------.----ancfrsnrvdmqpt.........................................................................
G1NYE7_MYOLU/276-373                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........AGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I2USX5_FELCA/162-296             dadrareklhgtvvegrkievnnatarvmtnkktvnpytngwklnpvvgavyspefyagtvllcqanqegssmysapsslvytsaskptvvalflwaplcwa----------.......-----------...---....---..----.--....-...-...-.---------.-...................................................--.---..-.-.----...-P..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F1N2A9_BOVIN/273-370                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPAAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A091QVC9_9GRUI/244-301             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........---...........-------.....-----........---....-----.....-.-------.----.......................................................................................
A0A2I3S2G7_PANTR/233-330             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2D0S3J0_ICTPU/327-433             ......................................................................................................VPGFPYPTAAaa..aaaTTAATFRGAHL...RGR....GRP..VYGT.VR....A...A...I.PQPAIPAYP.G...................................................VV.YQD..G.F.YGPA..dLY..........GGY...........AAYRYAQ.....PTAVAgptaaaaaAAA....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
S9X5T5_CAMFR/186-266                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................L-.---..-.-.----...GS..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
H2SH01_TAKRU/179-318                 ......................................................................................................VAGFPYPATG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....T...A...P.PPPPIPAYG.AshvteplrclplcsrllprhlpktlpqqerqqfyrsrklvgemkrlqpahvVV.YQD..G.F.YGAE...IY..........GGY...........AAYRFAQ.....PTTTA........---....-AFSD.....S.YGRVYAT.ADPY.......................................................................................
A0A1U7UVD3_TARSY/233-323             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
A0A2I3TES5_PANTR/248-347             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPSLC.L...................................................HV.CT-..S.V.CGRV...CV..........FLYt........wgERYLYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1S3ES88_DIPOR/275-365             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRA..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQE..P.V.YGNK..lLQ..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
A0A2I2Z2Y8_GORGO/251-348             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A1D5RBV2_MACMU/270-360             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....R.NQFVFVA.AD--ei.....................................................................................
I3KNI2_ORENI/269-373                 ......................................................................................................VPGFPYPAAAaa...aaSTAATFRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQD..G.F.YGAA..dLY..........GGY...........AAYRYAQ.....PAAVAtpa..aaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A1V4J944_PATFA/258-365             ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LYepiisakipqGGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H2QE03_PANTR/208-297                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.YGRVYAA.ADPY.......................................................................................
A0A1S3S4K3_SALSA/4-66                ................................................................................................fmelqt----------.......-----------...---....---..----.--....-...-...-.-------Y-.T...................................................IV.FQD..S.V.ISSR..lSQ..........GGYp.........aAAYRFAQ.....PTAVTga...taaAAA....AAYSD.....S.YGRVY-T.TDPY.......................................................................................
F7HRQ0_CALJA/255-352                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
F7EBP5_MACMU/207-340                 ......................................................................................................VTGFPYPTTG.......-TAVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPTYG.Aaleqtlvkmpvpwaglapcplpp....qqtpepayptspafpplscpfasrVV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........---....AAYSD.....S.-------.----rvgrrrtp...............................................................................
A0A287DDI7_ICTTR/250-339             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PTPAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
F6QI07_MACMU/247-344                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A2I0M460_COLLI/273-362             ......................................................................................................MPGFPYPAAT.......-AAAAYRGAHL...RGR....GRT..VYNT.FR....A...A...A.PPPPIPAYG.G...................................................VV.YQD..G.F.YGAD...IY..........GGY...........AAYRYAQ.....PATAT........--A....AAYSD.....S.YGRVY-A.ADPY.......................................................................................
H2RD17_PANTR/326-423                 ......................................................................................................VPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
A0A287BC18_PIG/251-308               ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VD.MQ-..-.-.----...--..........---...........-------.....-----........---....-----.....-.-------.----ptdmhslll..............................................................................
K7DQJ4_PANTR/251-348                 ......................................................................................................IPGFPYPTAA.......TTAAAFRGAHL...RGR....GRT..VYGA.VR....-...A...V.PPTAIPAYP.G...................................................VV.YQD..G.F.YGAD...LY..........GGY...........AAYRYAQ.....PATATaat..aaaAAA....AAYSD.....G.YGRVY-T.ADPY.......................................................................................
H2LHA1_ORYLA/68-173                  ......................................................................................................VPGFPYPAAAaa...aaSTAATFRGAHL...RGR....ARP..VYSA.VR....A...A...V.PQPAIPTYP.G...................................................VMaYQE..G.F.YGAA..dLY..........GGY...........ATYRYAQ.....PAAVAtpa.aaaaAAA....AAYSD.....S.YGRVY-T.ADPY.......................................................................................
A0A2D0S793_ICTPU/268-358             ......................................................................................................VTGFPYPTTG.......-ATVAYRGAHL...RGR....GRA..VYNT.FR....A...A...P.PPPPIPAYG.A...................................................VV.YQD..G.F.YGAE...IY..........GGY...........AAYRYAQ.....PAAAA........--A....AAYSD.....S.YGRVYAT.AAPY.......................................................................................
#=GC seq_cons                        ......................................................................................................lPGFPYPsAu........sAAAaRGAHL...RGR....GRs..VYss.hR....u...A...s.PPssIPAYs.G...................................................VV.YQD..G.F.YGA-...lY..........GGY...........AAYRYAQ.....PssAs..........A....AAYSD.....u.YGRVY.s.ADPY.......................................................................................
//
DBGET integrated database retrieval system