GenomeNet

Database: Pfam
Entry: GAGA_bind
LinkDB: GAGA_bind
Original site: GAGA_bind 
#=GF ID   GAGA_bind
#=GF AC   PF06217.14
#=GF DE   GAGA binding protein-like family
#=GF PI   DUF1004; 
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_10604 (release 9.0)
#=GF GA   26.60 26.60;
#=GF TC   26.60 26.70;
#=GF NC   25.80 25.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12177492
#=GF RT   Identification of a soybean protein that interacts with GAGA
#=GF RT   element dinucleotide repeat DNA. 
#=GF RA   Sangwan I, O'Brian MR; 
#=GF RL   Plant Physiol 2002;129:1788-1794.
#=GF DR   INTERPRO; IPR010409;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family includes gbp a protein from Soybean that binds to
#=GF CC   GAGA element dinucleotide repeat DNA [1]. It seems likely that
#=GF CC   the this domain mediates DNA binding. This putative domain
#=GF CC   contains several conserved cysteines and a histidine suggesting
#=GF CC   this may be a zinc-binding DNA interaction domain.
#=GF SQ   932
#=GS A0A0E0IP28_ORYNI/1-310    AC A0A0E0IP28.1
#=GS A0A022RL12_ERYGU/86-246   AC A0A022RL12.1
#=GS M4EYR7_BRARP/215-371      AC M4EYR7.1
#=GS A0A2G3DBS5_CAPCH/3-215    AC A0A2G3DBS5.1
#=GS A0A151RQK4_CAJCA/1-122    AC A0A151RQK4.1
#=GS A0A176WT74_MARPO/1-172    AC A0A176WT74.1
#=GS A0A124SDN7_CYNCS/36-340   AC A0A124SDN7.1
#=GS A0A2G2XLY3_CAPBA/2-215    AC A0A2G2XLY3.1
#=GS A0A200QQB1_9MAGN/1-341    AC A0A200QQB1.1
#=GS A0A453IJT9_AEGTS/2-206    AC A0A453IJT9.1
#=GS I1I323_BRADI/1-334        AC I1I323.1
#=GS A0A5P1FB67_ASPOF/1-280    AC A0A5P1FB67.1
#=GS M0SA08_MUSAM/1-54         AC M0SA08.1
#=GS A0A2G9GH24_9LAMI/1-323    AC A0A2G9GH24.1
#=GS A0A5D2RZY3_GOSMU/1-310    AC A0A5D2RZY3.1
#=GS A0A2K1Y8K3_POPTR/1-256    AC A0A2K1Y8K3.1
#=GS A0A6A3B3W9_HIBSY/1-282    AC A0A6A3B3W9.1
#=GS A0A200PYF4_9MAGN/1-275    AC A0A200PYF4.1
#=GS A0A4V4H3U7_MUSBA/1-297    AC A0A4V4H3U7.1
#=GS A0A392MHE1_9FABA/1-343    AC A0A392MHE1.1
#=GS A0A5C7H7B9_9ROSI/1-326    AC A0A5C7H7B9.1
#=GS A0A0D3BJA8_BRAOL/1-47     AC A0A0D3BJA8.1
#=GS A0A2P5F7S9_TREOI/1-337    AC A0A2P5F7S9.1
#=GS A0A1S3VA54_VIGRR/1-283    AC A0A1S3VA54.1
#=GS A0A0B0NBJ2_GOSAR/1-310    AC A0A0B0NBJ2.1
#=GS A0A2H5NS64_CITUN/56-390   AC A0A2H5NS64.1
#=GS A0A2G2ZZN4_CAPAN/2-71     AC A0A2G2ZZN4.1
#=GS A0A0D9VRN8_9ORYZ/229-304  AC A0A0D9VRN8.1
#=GS A0A5J5AI49_9ASTE/1-281    AC A0A5J5AI49.1
#=GS A0A6A4PPS3_LUPAL/1-336    AC A0A6A4PPS3.1
#=GS A0A5D2S2X1_GOSMU/1-187    AC A0A5D2S2X1.1
#=GS A0A1U8KTS0_GOSHI/1-310    AC A0A1U8KTS0.1
#=GS A0A2G2X786_CAPBA/65-114   AC A0A2G2X786.1
#=GS A0A6P9E7R0_JUGRE/6-299    AC A0A6P9E7R0.1
#=GS A0A5B6X0K1_9ROSI/1-310    AC A0A5B6X0K1.1
#=GS A0A445D1C4_ARAHY/1-283    AC A0A445D1C4.1
#=GS A0A5D2Y9N7_GOSMU/75-122   AC A0A5D2Y9N7.1
#=GS A0A4U5QLS2_POPAL/1-284    AC A0A4U5QLS2.1
#=GS A0A0L9V970_PHAAN/1-337    AC A0A0L9V970.1
#=GS H1ZN90_SOLLC/6-219        AC H1ZN90.1
#=GS A0A540M1I3_MALBA/1-339    AC A0A540M1I3.1
#=GS A0A0D3DXB4_BRAOL/1-279    AC A0A0D3DXB4.1
#=GS BPC5_ARATH/1-283          AC F4JUI3.1
#=GS A0A0K9R6K0_SPIOL/76-241   AC A0A0K9R6K0.1
#=GS A0A1S3X692_TOBAC/8-224    AC A0A1S3X692.1
#=GS A0A1S3UIK1_VIGRR/1-279    AC A0A1S3UIK1.1
#=GS A0A0B2QBP8_GLYSO/1-317    AC A0A0B2QBP8.1
#=GS F2E947_HORVV/1-350        AC F2E947.1
#=GS R0GR44_9BRAS/1-339        AC R0GR44.1
#=GS A0A166IE21_DAUCS/40-343   AC A0A166IE21.1
#=GS A0A5D3AEP1_GOSMU/1-336    AC A0A5D3AEP1.1
#=GS A0A068TRR3_COFCA/1-308    AC A0A068TRR3.1
#=GS M1AJB5_SOLTU/12-219       AC M1AJB5.1
#=GS A0A5D2WG87_GOSMU/1-212    AC A0A5D2WG87.1
#=GS A0A2J6LVH0_LACSA/1-303    AC A0A2J6LVH0.1
#=GS A0A5J5AET6_9ASTE/1-241    AC A0A5J5AET6.1
#=GS A0A5E4GB85_PRUDU/1-311    AC A0A5E4GB85.1
#=GS A0A2H3X057_PHODC/1-319    AC A0A2H3X057.1
#=GS A0A2R6R1J8_ACTCC/1-301    AC A0A2R6R1J8.1
#=GS A0A078JVC6_BRANA/1-325    AC A0A078JVC6.1
#=GS A0A0D3C0Y8_BRAOL/1-284    AC A0A0D3C0Y8.1
#=GS H1ZN86_SOLLC/1-281        AC H1ZN86.1
#=GS A0A0D3ANU4_BRAOL/157-315  AC A0A0D3ANU4.1
#=GS A0A2P5EE11_TREOI/1-279    AC A0A2P5EE11.1
#=GS V4U5W1_9ROSI/132-423      AC V4U5W1.1
#=GS BPC7_ARATH/5-226          AC O82286.1
#=GS A0A0D3HAK7_9ORYZ/1-280    AC A0A0D3HAK7.1
#=GS A0A067DNK4_CITSI/1-292    AC A0A067DNK4.1
#=GS A0A444FHH9_ENSVE/2-326    AC A0A444FHH9.1
#=GS A0A151RFM5_CAJCA/1-98     AC A0A151RFM5.1
#=GS A0A2K1XHD7_POPTR/1-196    AC A0A2K1XHD7.1
#=GS A0A022QNC4_ERYGU/1-287    AC A0A022QNC4.1
#=GS A0A3B6JJM0_WHEAT/1-346    AC A0A3B6JJM0.1
#=GS A0A1R3HQA6_9ROSI/1-282    AC A0A1R3HQA6.1
#=GS A0A199VT54_ANACO/2-173    AC A0A199VT54.1
#=GS A0A6A3ARE0_HIBSY/34-187   AC A0A6A3ARE0.1
#=GS A0A200QZH7_9MAGN/6-217    AC A0A200QZH7.1
#=GS A0A200QRR6_9MAGN/1-145    AC A0A200QRR6.1
#=GS I1KP40_SOYBN/1-317        AC I1KP40.1
#=GS A0A200PX88_9MAGN/1-284    AC A0A200PX88.1
#=GS A0A6A5MU15_LUPAL/135-394  AC A0A6A5MU15.1
#=GS A0A2P5XDL7_GOSBA/1-282    AC A0A2P5XDL7.1
#=GS A0A4P1QY16_LUPAN/1-334    AC A0A4P1QY16.1
#=GS A0A5N6NWF4_9ASTR/1-350    AC A0A5N6NWF4.1
#=GS A0A6A3BGV6_HIBSY/149-204  AC A0A6A3BGV6.1
#=GS A0A2R6PCM4_ACTCC/1-298    AC A0A2R6PCM4.1
#=GS A0A287PD86_HORVV/21-269   AC A0A287PD86.1
#=GS A0A4U6USA2_SETVI/2-329    AC A0A4U6USA2.1
#=GS H1ZN52_POPTR/1-284        AC H1ZN52.1
#=GS D7KXV6_ARALL/1-55         AC D7KXV6.1
#=GS R0HUS9_9BRAS/5-229        AC R0HUS9.1
#=GS A0A2H3ZHQ5_PHODC/1-343    AC A0A2H3ZHQ5.1
#=GS A0A5D2TZ83_GOSMU/84-131   AC A0A5D2TZ83.1
#=GS A0A6D2IY19_9BRAS/1-275    AC A0A6D2IY19.1
#=GS A0A2U1LDF2_ARTAN/13-183   AC A0A2U1LDF2.1
#=GS A0A5D2VHR1_GOSMU/1-282    AC A0A5D2VHR1.1
#=GS A0A1S3UNQ2_VIGRR/1-311    AC A0A1S3UNQ2.1
#=GS B9H4J8_POPTR/1-335        AC B9H4J8.1
#=GS M4CGS2_BRARP/3-138        AC M4CGS2.1
#=GS BPC2_ARATH/1-279          AC Q9LDE2.1
#=GS A0A059CE00_EUCGR/1-323    AC A0A059CE00.1
#=GS A0A2K1Y8J8_POPTR/1-284    AC A0A2K1Y8J8.1
#=GS A0A199UF85_ANACO/1-318    AC A0A199UF85.1
#=GS A0A0E0QVN8_ORYRU/1-341    AC A0A0E0QVN8.1
#=GS A0A444CP00_ENSVE/182-473  AC A0A444CP00.1
#=GS A0A6A6M7K2_HEVBR/31-228   AC A0A6A6M7K2.1
#=GS BBRA_ORYSJ/1-341          AC P0DH88.1
#=GS A0A1U8KKC4_GOSHI/1-336    AC A0A1U8KKC4.1
#=GS A0A103Y7V8_CYNCS/1-309    AC A0A103Y7V8.1
#=GS M4D5X9_BRARP/1-287        AC M4D5X9.1
#=GS C6TF36_SOYBN/1-279        AC C6TF36.1
#=GS A0A6A2Z5W0_HIBSY/1-282    AC A0A6A2Z5W0.1
#=GS U5FRS0_POPTR/5-288        AC U5FRS0.1
#=GS A0A2G3CA60_CAPCH/1-310    AC A0A2G3CA60.1
#=GS A0A3N7FSX5_POPTR/1-279    AC A0A3N7FSX5.1
#=GS A0A397YLH8_BRACM/1-273    AC A0A397YLH8.1
#=GS A0A2R6Q3A7_ACTCC/10-237   AC A0A2R6Q3A7.1
#=GS H1ZN85_TOBAC/1-333        AC H1ZN85.1
#=GS A0A067KPK2_JATCU/1-337    AC A0A067KPK2.1
#=GS A0A200PSG5_9MAGN/13-304   AC A0A200PSG5.1
#=GS A0A0L9UUL1_PHAAN/1-180    AC A0A0L9UUL1.1
#=GS A0A2J6JNF7_LACSA/1-199    AC A0A2J6JNF7.1
#=GS M0SVB2_MUSAM/1-284        AC M0SVB2.1
#=GS A0A2R6PIK7_ACTCC/3-187    AC A0A2R6PIK7.1
#=GS A0A498HKG4_MALDO/12-290   AC A0A498HKG4.1
#=GS A0A1U8E0B4_CAPAN/1-313    AC A0A1U8E0B4.1
#=GS A0A1U8BID1_NELNU/1-284    AC A0A1U8BID1.1
#=GS A0A5D2WG48_GOSMU/1-310    AC A0A5D2WG48.1
#=GS A0A251SBK0_HELAN/55-352   AC A0A251SBK0.1
#=GS A0A2I0WW46_9ASPA/1-290    AC A0A2I0WW46.1
#=GS A0A4U5QLD9_POPAL/1-317    AC A0A4U5QLD9.1
#=GS A0A0K9R5U0_SPIOL/1-309    AC A0A0K9R5U0.1
#=GS A0A368QQ32_SETIT/2-329    AC A0A368QQ32.1
#=GS A0A0S3RAS6_PHAAN/1-337    AC A0A0S3RAS6.1
#=GS A0A251L2F5_MANES/1-310    AC A0A251L2F5.1
#=GS A0A397YJF4_BRACM/1-285    AC A0A397YJF4.1
#=GS M0RQS4_MUSAM/1-270        AC M0RQS4.1
#=GS A0A5A7VPX9_CUCME/13-292   AC A0A5A7VPX9.1
#=GS A0A0S3R114_PHAAN/60-338   AC A0A0S3R114.1
#=GS A0A2R6VWT1_MARPO/2-290    AC A0A2R6VWT1.1
#=GS A0A0D9XHC1_9ORYZ/1-338    AC A0A0D9XHC1.1
#=GS A0A0Q3FA07_BRADI/1-333    AC A0A0Q3FA07.1
#=GS A0A1J7I8B8_LUPAN/1-335    AC A0A1J7I8B8.1
#=GS A0A1U7YND6_NICSY/1-333    AC A0A1U7YND6.1
#=GS A0A022PZW2_ERYGU/1-42     AC A0A022PZW2.1
#=GS A0A2I4E7H8_JUGRE/1-315    AC A0A2I4E7H8.1
#=GS A0A6A2ZN91_HIBSY/30-250   AC A0A6A2ZN91.1
#=GS A0A2R6RBR4_ACTCC/1-301    AC A0A2R6RBR4.1
#=GS A0A5D2ZZZ0_GOSMU/27-306   AC A0A5D2ZZZ0.1
#=GS D7LHX4_ARALL/4-226        AC D7LHX4.1
#=GS H1ZN83_TOBAC/1-282        AC H1ZN83.1
#=GS A0A2I0AKJ2_9ASPA/62-352   AC A0A2I0AKJ2.1
#=GS A0A453IJI2_AEGTS/1-227    AC A0A453IJI2.1
#=GS A0A397Z737_BRACM/1-262    AC A0A397Z737.1
#=GS A0A4S8ICK5_MUSBA/1-280    AC A0A4S8ICK5.1
#=GS A0A565B0P1_9BRAS/118-264  AC A0A565B0P1.1
#=GS A0A5A7QJP1_STRAF/1-287    AC A0A5A7QJP1.1
#=GS A0A2G3D804_CAPCH/2-301    AC A0A2G3D804.1
#=GS A0A2G2YE13_CAPAN/4-120    AC A0A2G2YE13.1
#=GS A0A5C7HIZ4_9ROSI/176-455  AC A0A5C7HIZ4.1
#=GS A0A2C9VYP5_MANES/1-345    AC A0A2C9VYP5.1
#=GS A0A6A3CD06_HIBSY/1-309    AC A0A6A3CD06.1
#=GS A0A1U8NC14_GOSHI/40-234   AC A0A1U8NC14.1
#=GS M0RWT5_MUSAM/1-126        AC M0RWT5.1
#=GS A0A453QIV9_AEGTS/1-331    AC A0A453QIV9.1
#=GS A0A2I0B9A4_9ASPA/12-77    AC A0A2I0B9A4.1
#=GS A0A3B6HR63_WHEAT/1-348    AC A0A3B6HR63.1
#=GS A0A5A7QYU7_STRAF/1-266    AC A0A5A7QYU7.1
#=GS A0A0E0EVC4_9ORYZ/1-238    AC A0A0E0EVC4.1
#=GS W9R7S8_9ROSA/1-312        AC W9R7S8.1
#=GS A0A6A3AFT5_HIBSY/29-268   AC A0A6A3AFT5.1
#=GS A0A0D3CUW8_BRAOL/1-339    AC A0A0D3CUW8.1
#=GS A0A0K9PCF2_ZOSMR/109-276  AC A0A0K9PCF2.1
#=GS A0A1R3K7R1_9ROSI/2-278    AC A0A1R3K7R1.1
#=GS A0A5J5AIA9_9ASTE/1-253    AC A0A5J5AIA9.1
#=GS A0A4U6VRZ8_SETVI/1-341    AC A0A4U6VRZ8.1
#=GS A0A5A7RIJ6_STRAF/195-325  AC A0A5A7RIJ6.1
#=GS A0A5B6V2N9_9ROSI/1-282    AC A0A5B6V2N9.1
#=GS A0A5N5KN19_9ROSI/88-135   AC A0A5N5KN19.1
#=GS I1H191_BRADI/1-327        AC I1H191.1
#=GS M0SRV2_MUSAM/53-346       AC M0SRV2.1
#=GS A0A1S2YEV7_CICAR/1-308    AC A0A1S2YEV7.1
#=GS A0A068UB08_COFCA/1-282    AC A0A068UB08.1
#=GS M5VNL8_PRUPE/20-330       AC M5VNL8.1
#=GS A0A5J5B1H7_9ASTE/1-275    AC A0A5J5B1H7.1
#=GS A0A0K9PBT5_ZOSMR/24-232   AC A0A0K9PBT5.1
#=GS A0A0D2S501_GOSRA/1-253    AC A0A0D2S501.1
#=GS A0A2U1KTK9_ARTAN/1-298    AC A0A2U1KTK9.1
#=GS V7ARX6_PHAVU/1-337        AC V7ARX6.1
#=GS M4EBN7_BRARP/321-589      AC M4EBN7.1
#=GS A0A328D5U3_9ASTE/1-286    AC A0A328D5U3.1
#=GS A0A3N7FX19_POPTR/7-290    AC A0A3N7FX19.1
#=GS D7LPX4_ARALL/1-280        AC D7LPX4.1
#=GS A0A4S8KEA9_MUSBA/22-367   AC A0A4S8KEA9.1
#=GS A0A4S8IDC8_MUSBA/1-285    AC A0A4S8IDC8.1
#=GS A0A2H3XVC6_PHODC/1-271    AC A0A2H3XVC6.1
#=GS A0A2U1NCT7_ARTAN/2-271    AC A0A2U1NCT7.1
#=GS A0A1S3CSG1_CUCME/1-280    AC A0A1S3CSG1.1
#=GS A0A151RRJ6_CAJCA/92-262   AC A0A151RRJ6.1
#=GS A0A6A5MCX1_LUPAL/62-334   AC A0A6A5MCX1.1
#=GS A0A2R6R3J7_ACTCC/1-314    AC A0A2R6R3J7.1
#=GS A0A446RJA1_TRITD/5-326    AC A0A446RJA1.1
#=GS A0A3B6I1C6_WHEAT/1-331    AC A0A3B6I1C6.1
#=GS A0A5N5L5G5_9ROSI/5-283    AC A0A5N5L5G5.1
#=GS A0A445KV51_GLYSO/192-550  AC A0A445KV51.1
#=GS A0A1S3CSF6_CUCME/1-277    AC A0A1S3CSF6.1
#=GS A0A2G2ZGY4_CAPAN/10-292   AC A0A2G2ZGY4.1
#=GS A0A4U6T8X6_SETVI/1-359    AC A0A4U6T8X6.1
#=GS A0A199V3D0_ANACO/1-246    AC A0A199V3D0.1
#=GS A0A0A0KJH7_CUCSA/1-279    AC A0A0A0KJH7.1
#=GS V4M1G3_EUTSA/1-291        AC V4M1G3.1
#=GS A0A2G2YPY1_CAPAN/2-301    AC A0A2G2YPY1.1
#=GS A0A0E0IP29_ORYNI/1-342    AC A0A0E0IP29.1
#=GS A0A200R2H5_9MAGN/1-85     AC A0A200R2H5.1
#=GS A0A1S4AUE2_TOBAC/1-274    AC A0A1S4AUE2.1
#=GS M0T639_MUSAM/1-118        AC M0T639.1
#=GS D7KVR8_ARALL/95-265       AC D7KVR8.1
#=GS A0A4D9ARJ6_SALSN/3-323    AC A0A4D9ARJ6.1
#=GS A0A251T2N6_HELAN/1-120    AC A0A251T2N6.1
#=GS A0A2G3AFR7_CAPAN/2-215    AC A0A2G3AFR7.1
#=GS V4TA25_9ROSI/61-395       AC V4TA25.1
#=GS A0A4D8Z0T1_SALSN/1-302    AC A0A4D8Z0T1.1
#=GS V4TFC0_9ROSI/1-335        AC V4TFC0.1
#=GS A0A0L9UU47_PHAAN/135-228  AC A0A0L9UU47.1
#=GS A0A0E0B769_9ORYZ/1-331    AC A0A0E0B769.1
#=GS A0A498J8T5_MALDO/1-339    AC A0A498J8T5.1
#=GS A0A2K1Y8J9_POPTR/1-284    AC A0A2K1Y8J9.2
#=GS A0A5E4GAZ6_PRUDU/20-330   AC A0A5E4GAZ6.1
#=GS A0A1U8MSE2_GOSHI/1-310    AC A0A1U8MSE2.1
#=GS A0A1E5UQI0_9POAL/1-294    AC A0A1E5UQI0.1
#=GS A0A444F7W4_ENSVE/1-315    AC A0A444F7W4.1
#=GS A0A4P1RW76_LUPAN/70-337   AC A0A4P1RW76.1
#=GS A0A0D3DUK0_BRAOL/1-300    AC A0A0D3DUK0.1
#=GS A0A2I0JB64_PUNGR/1-298    AC A0A2I0JB64.1
#=GS M0ZVN7_SOLTU/1-285        AC M0ZVN7.1
#=GS A0A0E0IP33_ORYNI/5-234    AC A0A0E0IP33.1
#=GS A0A103XB59_CYNCS/1-176    AC A0A103XB59.1
#=GS A0A1S3XFH8_TOBAC/1-186    AC A0A1S3XFH8.1
#=GS A0A078FIC2_BRANA/60-195   AC A0A078FIC2.1
#=GS A0A2U1NCW0_ARTAN/1-296    AC A0A2U1NCW0.1
#=GS A0A2G3B897_CAPCH/2-91     AC A0A2G3B897.1
#=GS A0A2I4G898_JUGRE/14-293   AC A0A2I4G898.1
#=GS A0A6A2W8T4_HIBSY/1-336    AC A0A6A2W8T4.1
#=GS M5XDN6_PRUPE/1-278        AC M5XDN6.1
#=GS A0A2U1P1U4_ARTAN/1-296    AC A0A2U1P1U4.1
#=GS A0A5D2W6H1_GOSMU/1-336    AC A0A5D2W6H1.1
#=GS A0A0E0EVC1_9ORYZ/1-42     AC A0A0E0EVC1.1
#=GS A0A4P1R340_LUPAN/1-306    AC A0A4P1R340.1
#=GS A0A443P953_9MAGN/1-283    AC A0A443P953.1
#=GS A0A0S3QXT1_PHAAN/1-312    AC A0A0S3QXT1.1
#=GS A0A078HW26_BRANA/1-287    AC A0A078HW26.1
#=GS A0A6A3BJ17_HIBSY/104-224  AC A0A6A3BJ17.1
#=GS A0A251K9F6_MANES/1-314    AC A0A251K9F6.1
#=GS A0A2I0JBN1_PUNGR/1-94     AC A0A2I0JBN1.1
#=GS A0A067DHJ2_CITSI/1-311    AC A0A067DHJ2.1
#=GS A0A2H5NS32_CITUN/86-418   AC A0A2H5NS32.1
#=GS A0A2P6PQ67_ROSCH/1-310    AC A0A2P6PQ67.1
#=GS A0A1U8INQ5_GOSHI/1-282    AC A0A1U8INQ5.1
#=GS A0A5P1FIW7_ASPOF/91-311   AC A0A5P1FIW7.1
#=GS A0A1R3IXY8_COCAP/6-328    AC A0A1R3IXY8.1
#=GS A0A5N5KN19_9ROSI/2-90     AC A0A5N5KN19.1
#=GS A0A068UT92_COFCA/39-233   AC A0A068UT92.1
#=GS A0A446S9U4_TRITD/1-349    AC A0A446S9U4.1
#=GS A0A4D9AAH7_SALSN/1-305    AC A0A4D9AAH7.1
#=GS A0A1S3BIS4_CUCME/1-313    AC A0A1S3BIS4.1
#=GS A0A540N5P0_MALBA/1-311    AC A0A540N5P0.1
#=GS A0A287VJM0_HORVV/1-307    AC A0A287VJM0.1
#=GS A0A0E0EVB9_9ORYZ/53-371   AC A0A0E0EVB9.1
#=GS A0A2G9H9T0_9LAMI/1-302    AC A0A2G9H9T0.1
#=GS I1KJA4_SOYBN/1-282        AC I1KJA4.1
#=GS A0A0E0M518_ORYPU/79-427   AC A0A0E0M518.1
#=GS A0A1S3UBA0_VIGRR/1-283    AC A0A1S3UBA0.1
#=GS A0A6A6M8S5_HEVBR/2-113    AC A0A6A6M8S5.1
#=GS B8BFL6_ORYSI/1-342        AC B8BFL6.1
#=GS A0A287PE82_HORVV/22-154   AC A0A287PE82.1
#=GS A0A1U8GAV9_CAPAN/1-324    AC A0A1U8GAV9.1
#=GS M4EXP6_BRARP/1-262        AC M4EXP6.1
#=GS A0A392QS79_9FABA/13-145   AC A0A392QS79.1
#=GS A0A2P5YSC2_GOSBA/1-336    AC A0A2P5YSC2.1
#=GS A0A5D2SJC5_GOSMU/39-234   AC A0A5D2SJC5.1
#=GS A0A1U8KTQ0_GOSHI/47-356   AC A0A1U8KTQ0.1
#=GS A0A4P1RFJ1_LUPAN/69-337   AC A0A4P1RFJ1.1
#=GS A0A5D2VGT2_GOSMU/1-282    AC A0A5D2VGT2.1
#=GS H1ZN44_POPTR/1-320        AC H1ZN44.1
#=GS A0A5D2VYG2_GOSMU/1-280    AC A0A5D2VYG2.1
#=GS A0A2T7END6_9POAL/1-336    AC A0A2T7END6.1
#=GS A0A0B0PPB9_GOSAR/48-244   AC A0A0B0PPB9.1
#=GS A0A199W2C5_ANACO/15-346   AC A0A199W2C5.1
#=GS A0A2R6R032_ACTCC/10-322   AC A0A2R6R032.1
#=GS A0A200R2I6_9MAGN/2-141    AC A0A200R2I6.1
#=GS A0A2H3ZJS8_PHODC/1-351    AC A0A2H3ZJS8.1
#=GS A0A6A6MVR1_HEVBR/1-232    AC A0A6A6MVR1.1
#=GS A0A0P0XRW0_ORYSJ/54-343   AC A0A0P0XRW0.1
#=GS A0A453IJI6_AEGTS/1-93     AC A0A453IJI6.1
#=GS A0A022QDD9_ERYGU/1-309    AC A0A022QDD9.1
#=GS A0A540MGV9_MALBA/1-340    AC A0A540MGV9.1
#=GS A0A1S3U723_VIGRR/1-337    AC A0A1S3U723.1
#=GS A0A394DE27_LUPAN/1-281    AC A0A394DE27.1
#=GS A0A251RTZ6_HELAN/54-359   AC A0A251RTZ6.1
#=GS A0A068TKY0_COFCA/1-312    AC A0A068TKY0.1
#=GS A0A0A0K147_CUCSA/1-313    AC A0A0A0K147.1
#=GS A0A0L9VI05_PHAAN/1-283    AC A0A0L9VI05.1
#=GS A0A2G2ZCT7_CAPAN/1-310    AC A0A2G2ZCT7.1
#=GS A0A443N9H0_9MAGN/1-284    AC A0A443N9H0.1
#=GS A0A5E4F301_PRUDU/1-337    AC A0A5E4F301.1
#=GS A0A2G5EK89_AQUCA/1-341    AC A0A2G5EK89.1
#=GS M0RLG3_MUSAM/1-86         AC M0RLG3.1
#=GS A0A151RFM5_CAJCA/92-255   AC A0A151RFM5.1
#=GS A0A5N5G3M3_9ROSA/1-279    AC A0A5N5G3M3.1
#=GS M0T1D8_MUSAM/1-66         AC M0T1D8.1
#=GS A0A2H9ZRP2_9ASPA/1-335    AC A0A2H9ZRP2.1
#=GS A0A2H3XRU5_PHODC/1-277    AC A0A2H3XRU5.1
#=GS A0A067HAT9_CITSI/1-335    AC A0A067HAT9.1
#=GS M4D2L7_BRARP/1-285        AC M4D2L7.1
#=GS A0A0J8B6K9_BETVU/1-280    AC A0A0J8B6K9.1
#=GS A0A078IRI7_BRANA/1-273    AC A0A078IRI7.1
#=GS M0SA08_MUSAM/52-220       AC M0SA08.1
#=GS A0A022Q3T7_ERYGU/1-135    AC A0A022Q3T7.1
#=GS A0A0E0PT04_ORYRU/1-331    AC A0A0E0PT04.1
#=GS V4M9X7_EUTSA/1-295        AC V4M9X7.1
#=GS K4ABT0_SETIT/1-359        AC K4ABT0.1
#=GS A0A4U5Q572_POPAL/54-388   AC A0A4U5Q572.1
#=GS A0A2C9UFY2_MANES/1-279    AC A0A2C9UFY2.1
#=GS R0HH84_9BRAS/1-284        AC R0HH84.1
#=GS A0A2K1Y8J6_POPTR/1-284    AC A0A2K1Y8J6.1
#=GS A0A2H3YFY8_PHODC/1-279    AC A0A2H3YFY8.1
#=GS A0A6A5M8U9_LUPAL/14-350   AC A0A6A5M8U9.1
#=GS A0A6A3BJ17_HIBSY/11-104   AC A0A6A3BJ17.1
#=GS A0A0D3BWP6_BRAOL/1-219    AC A0A0D3BWP6.1
#=GS A0A6A3CMI7_HIBSY/1-83     AC A0A6A3CMI7.1
#=GS A0A0E0IP31_ORYNI/1-329    AC A0A0E0IP31.1
#=GS V7CRJ4_PHAVU/1-312        AC V7CRJ4.1
#=GS A0A5N5LQ19_9ROSI/24-303   AC A0A5N5LQ19.1
#=GS M0U0N5_MUSAM/91-225       AC M0U0N5.1
#=GS A0A1D6EKS7_MAIZE/9-80     AC A0A1D6EKS7.1
#=GS A0A4U5Q6S9_POPAL/1-320    AC A0A4U5Q6S9.1
#=GS B4F7V9_MAIZE/1-348        AC B4F7V9.1
#=GS A0A5J5BWJ6_9ASTE/1-246    AC A0A5J5BWJ6.1
#=GS U5CWE0_AMBTC/1-94         AC U5CWE0.1
#=GS A0A6G1EWY3_9ORYZ/1-335    AC A0A6G1EWY3.1
#=GS S8E434_9LAMI/1-284        AC S8E434.1
#=GS A0A1S3UIJ9_VIGRR/60-338   AC A0A1S3UIJ9.2
#=GS A0A2Z7BPF1_9LAMI/1-309    AC A0A2Z7BPF1.1
#=GS A0A397ZHJ5_BRACM/1-311    AC A0A397ZHJ5.1
#=GS A0A314XN37_PRUYE/9-223    AC A0A314XN37.1
#=GS A0A0D3DW89_BRAOL/1-106    AC A0A0D3DW89.1
#=GS A0A445DLQ6_ARAHY/1-275    AC A0A445DLQ6.1
#=GS A0A4D8Z459_SALSN/1-288    AC A0A4D8Z459.1
#=GS A0A087HNI9_ARAAL/1-272    AC A0A087HNI9.1
#=GS B9RZ34_RICCO/6-230        AC B9RZ34.1
#=GS A0A067L8I4_JATCU/4-230    AC A0A067L8I4.1
#=GS A0A2I0WBB0_9ASPA/21-311   AC A0A2I0WBB0.1
#=GS A0A0B0NBF7_GOSAR/1-336    AC A0A0B0NBF7.1
#=GS M0TCN9_MUSAM/2-184        AC M0TCN9.1
#=GS A0A1R3JF42_9ROSI/8-232    AC A0A1R3JF42.1
#=GS A0A446WZG7_TRITD/1-330    AC A0A446WZG7.1
#=GS A0A445C1Y0_ARAHY/1-315    AC A0A445C1Y0.1
#=GS A0A2P5XDL7_GOSBA/285-566  AC A0A2P5XDL7.1
#=GS M0RLG3_MUSAM/81-224       AC M0RLG3.1
#=GS A0A2G3CF61_CAPCH/10-292   AC A0A2G3CF61.1
#=GS A0A5N6QP07_9ROSI/2-290    AC A0A5N6QP07.1
#=GS A0A4D9A1R0_SALSN/1-300    AC A0A4D9A1R0.1
#=GS A0A5N5NPJ7_9ROSI/1-363    AC A0A5N5NPJ7.1
#=GS A0A498JUJ2_MALDO/1-311    AC A0A498JUJ2.1
#=GS I1K6R5_SOYBN/1-317        AC I1K6R5.1
#=GS D7MFP8_ARALL/23-282       AC D7MFP8.1
#=GS A0A4V6D249_SETVI/1-316    AC A0A4V6D249.1
#=GS A0A0E0QVN9_ORYRU/1-290    AC A0A0E0QVN9.1
#=GS A0A059AVZ4_EUCGR/1-285    AC A0A059AVZ4.1
#=GS A0A0D3GCC3_9ORYZ/1-331    AC A0A0D3GCC3.1
#=GS A0A0K9R4Q4_SPIOL/1-278    AC A0A0K9R4Q4.1
#=GS A0A5C7I8A9_9ROSI/1-315    AC A0A5C7I8A9.1
#=GS A0A2R6PZN3_ACTCC/1-308    AC A0A2R6PZN3.1
#=GS A0A2I4ENY7_JUGRE/1-337    AC A0A2I4ENY7.2
#=GS A0A5D2S4A2_GOSMU/1-211    AC A0A5D2S4A2.1
#=GS A0A0D3DPQ3_BRAOL/1-271    AC A0A0D3DPQ3.1
#=GS A0A2H3XTM7_PHODC/1-276    AC A0A2H3XTM7.1
#=GS A0A3B6IT63_WHEAT/1-349    AC A0A3B6IT63.1
#=GS A0A2J6M965_LACSA/1-290    AC A0A2J6M965.1
#=GS A0A1U8KKL4_GOSHI/1-311    AC A0A1U8KKL4.1
#=GS A0A427B317_ENSVE/1-279    AC A0A427B317.1
#=GS A0A2G9HBJ5_9LAMI/1-280    AC A0A2G9HBJ5.1
#=GS A0A2R6RIS5_ACTCC/1-299    AC A0A2R6RIS5.1
#=GS A0A2R6XFD0_MARPO/97-401   AC A0A2R6XFD0.1
#=GS A0A5N6PUE6_9ASTR/1-292    AC A0A5N6PUE6.1
#=GS A0A1E5V748_9POAL/72-415   AC A0A1E5V748.1
#=GS A0A1U7Z932_NELNU/1-277    AC A0A1U7Z932.1
#=GS M4CTH5_BRARP/1-296        AC M4CTH5.1
#=GS A0A445JC15_GLYSO/1-279    AC A0A445JC15.1
#=GS A0A151T2P1_CAJCA/1-278    AC A0A151T2P1.1
#=GS A0A1S4CDX5_TOBAC/1-309    AC A0A1S4CDX5.1
#=GS A0A2I0INV4_PUNGR/1-94     AC A0A2I0INV4.1
#=GS A0A1Q3C349_CEPFO/1-152    AC A0A1Q3C349.1
#=GS A0A5A7VKB5_CUCME/1-277    AC A0A5A7VKB5.1
#=GS BBRD_ORYSJ/1-331          AC Q5VSA8.1
#=GS A0A368PY20_SETIT/1-341    AC A0A368PY20.1
#=GS A0A0D2Q547_GOSRA/1-336    AC A0A0D2Q547.1
#=GS M4END8_BRARP/1-286        AC M4END8.1
#=GS A0A5J5ARF5_9ASTE/25-147   AC A0A5J5ARF5.1
#=GS A0A078I0K6_BRANA/1-282    AC A0A078I0K6.1
#=GS A0A2P5XDJ8_GOSBA/1-282    AC A0A2P5XDJ8.1
#=GS B2Z458_VITVI/1-337        AC B2Z458.1
#=GS A0A6D2LAV7_9BRAS/56-258   AC A0A6D2LAV7.1
#=GS A0A5P1FQI4_ASPOF/1-225    AC A0A5P1FQI4.1
#=GS A0A1J7HNR7_LUPAN/1-286    AC A0A1J7HNR7.1
#=GS A0A5J5BWQ5_9ASTE/2-306    AC A0A5J5BWQ5.1
#=GS Q8LKV1_SOYBN/1-282        AC Q8LKV1.1
#=GS A0A1U8L3Y7_GOSHI/1-282    AC A0A1U8L3Y7.1
#=GS V7CPG3_PHAVU/64-342       AC V7CPG3.1
#=GS A0A1U8AMF6_NELNU/1-329    AC A0A1U8AMF6.1
#=GS D7KCI3_ARALL/1-277        AC D7KCI3.1
#=GS A0A2J6KJR6_LACSA/1-330    AC A0A2J6KJR6.1
#=GS B9GQZ0_POPTR/1-336        AC B9GQZ0.2
#=GS G7I6G1_MEDTR/1-340        AC G7I6G1.1
#=GS A0A0K9RZC6_SPIOL/36-231   AC A0A0K9RZC6.1
#=GS A0A0D2PW98_GOSRA/1-211    AC A0A0D2PW98.1
#=GS A0A2I4H7T8_JUGRE/4-233    AC A0A2I4H7T8.1
#=GS A0A2G3BW01_CAPCH/1-313    AC A0A2G3BW01.1
#=GS A0A5D2WFM6_GOSMU/1-149    AC A0A5D2WFM6.1
#=GS A0A4S4DY60_CAMSI/8-289    AC A0A4S4DY60.1
#=GS Q2PQR3_9BRAS/1-277        AC Q2PQR3.1
#=GS A0A3L6TEV9_PANMI/1-363    AC A0A3L6TEV9.1
#=GS I1L405_SOYBN/1-282        AC I1L405.1
#=GS M4E2L2_BRARP/16-270       AC M4E2L2.1
#=GS A0A4D9A1R0_SALSN/310-601  AC A0A4D9A1R0.1
#=GS A0A398ACT8_BRACM/121-278  AC A0A398ACT8.1
#=GS A0A6A3BGV6_HIBSY/43-155   AC A0A6A3BGV6.1
#=GS A0A1D6KJP9_MAIZE/1-289    AC A0A1D6KJP9.1
#=GS A0A5A7PWA9_STRAF/1-300    AC A0A5A7PWA9.1
#=GS A0A2P5YAF1_GOSBA/1-280    AC A0A2P5YAF1.1
#=GS A0A199VFR6_ANACO/1-302    AC A0A199VFR6.1
#=GS A0A5D3CKW8_CUCME/1-313    AC A0A5D3CKW8.1
#=GS A0A397ZKB7_BRACM/1-287    AC A0A397ZKB7.1
#=GS I1K7L4_SOYBN/1-337        AC I1K7L4.1
#=GS A0A5J5ASN2_9ASTE/1-103    AC A0A5J5ASN2.1
#=GS A0A0B2PNG6_GLYSO/1-337    AC A0A0B2PNG6.1
#=GS A0A2G5ET17_AQUCA/1-270    AC A0A2G5ET17.1
#=GS M0U343_MUSAM/48-174       AC M0U343.1
#=GS A0A0E0B770_9ORYZ/54-339   AC A0A0E0B770.1
#=GS A0A199UVC2_ANACO/1-207    AC A0A199UVC2.1
#=GS A0A498HR19_MALDO/1-340    AC A0A498HR19.1
#=GS A0A453QJ47_AEGTS/34-354   AC A0A453QJ47.1
#=GS A0A4Y7K3U6_PAPSO/1-340    AC A0A4Y7K3U6.1
#=GS A0A2R6RMM6_ACTCC/1-309    AC A0A2R6RMM6.1
#=GS A0A2H5QGA0_CITUN/1-311    AC A0A2H5QGA0.1
#=GS A0A565C4J3_9BRAS/40-334   AC A0A565C4J3.1
#=GS A0A0D9VPE7_9ORYZ/1-94     AC A0A0D9VPE7.1
#=GS A0A2I0ISZ8_PUNGR/1-144    AC A0A2I0ISZ8.1
#=GS A0A5N6MKS1_9ASTR/1-260    AC A0A5N6MKS1.1
#=GS A0A2G2X786_CAPBA/2-67     AC A0A2G2X786.1
#=GS A0A5D2ZQ20_GOSMU/1-282    AC A0A5D2ZQ20.1
#=GS A0A5J5AQ73_9ASTE/1-281    AC A0A5J5AQ73.1
#=GS A0A6A6M8R2_HEVBR/1-337    AC A0A6A6M8R2.1
#=GS A0A0D9XHB9_9ORYZ/1-338    AC A0A0D9XHB9.1
#=GS E0CPJ5_VITVI/2-106        AC E0CPJ5.1
#=GS A0A4U5MNH1_POPAL/1-284    AC A0A4U5MNH1.1
#=GS A0A078HWN9_BRANA/1-296    AC A0A078HWN9.1
#=GS A0A6G1DMV0_9ORYZ/69-392   AC A0A6G1DMV0.1
#=GS A0A1U8M6S5_GOSHI/1-282    AC A0A1U8M6S5.1
#=GS A0A5N6NVY4_9ASTR/1-350    AC A0A5N6NVY4.1
#=GS A0A0E0EVC0_9ORYZ/1-42     AC A0A0E0EVC0.1
#=GS D7LL18_ARALL/1-296        AC D7LL18.1
#=GS A0A2G9GYT6_9LAMI/1-295    AC A0A2G9GYT6.1
#=GS A0A6D2IG05_9BRAS/20-213   AC A0A6D2IG05.1
#=GS A0A1U7V3X9_NICSY/1-282    AC A0A1U7V3X9.1
#=GS A0A1R3HVQ4_COCAP/1-303    AC A0A1R3HVQ4.1
#=GS B8BFL7_ORYSI/1-342        AC B8BFL7.1
#=GS A0A200Q549_9MAGN/71-155   AC A0A200Q549.1
#=GS C5Z506_SORBI/1-348        AC C5Z506.1
#=GS M0T1D8_MUSAM/50-225       AC M0T1D8.1
#=GS A0A4S4E922_CAMSI/26-338   AC A0A4S4E922.1
#=GS A0A5D2S131_GOSMU/1-285    AC A0A5D2S131.1
#=GS A0A0D3CA79_BRAOL/1-269    AC A0A0D3CA79.1
#=GS A0A5D2WXK6_GOSMU/42-234   AC A0A5D2WXK6.1
#=GS A0A565CFF4_9BRAS/2-291    AC A0A565CFF4.1
#=GS A0A3L6PFL1_PANMI/1-328    AC A0A3L6PFL1.1
#=GS A0A6A4Q7M0_LUPAL/1-306    AC A0A6A4Q7M0.1
#=GS BPC3_ARATH/83-269         AC Q9C9X6.1
#=GS W1P7C9_AMBTC/48-356       AC W1P7C9.1
#=GS A0A176VG35_MARPO/100-404  AC A0A176VG35.1
#=GS A0A2K3N7D6_TRIPR/9-295    AC A0A2K3N7D6.1
#=GS A0A565BLX3_9BRAS/7-229    AC A0A565BLX3.1
#=GS A0A5B6VDB9_9ROSI/1-336    AC A0A5B6VDB9.1
#=GS A0A2I4GJ26_JUGRE/15-233   AC A0A2I4GJ26.1
#=GS A0A1S4APZ0_TOBAC/1-252    AC A0A1S4APZ0.1
#=GS A0A3N6S4M6_BRACR/1-176    AC A0A3N6S4M6.1
#=GS H1ZN97_SOLTU/1-323        AC H1ZN97.1
#=GS A0A0D2R6V3_GOSRA/91-138   AC A0A0D2R6V3.1
#=GS A0A0D2Q3Y8_GOSRA/1-190    AC A0A0D2Q3Y8.1
#=GS I1JT52_SOYBN/1-338        AC I1JT52.1
#=GS A0A2Z7B8S9_9LAMI/1-280    AC A0A2Z7B8S9.1
#=GS U5CWY4_AMBTC/1-196        AC U5CWY4.1
#=GS A0A368PXT8_SETIT/1-341    AC A0A368PXT8.1
#=GS A0A565C1V1_9BRAS/1-341    AC A0A565C1V1.1
#=GS A0A392N9P6_9FABA/1-94     AC A0A392N9P6.1
#=GS A0A2I0IS76_PUNGR/1-108    AC A0A2I0IS76.1
#=GS A0A3S3MKL4_9MAGN/1-340    AC A0A3S3MKL4.1
#=GS A0A397Y1T4_BRACM/1-296    AC A0A397Y1T4.1
#=GS A0A2G2WRQ8_CAPBA/1-283    AC A0A2G2WRQ8.1
#=GS A0A022R8S9_ERYGU/1-341    AC A0A022R8S9.1
#=GS V4MTY3_EUTSA/1-278        AC V4MTY3.1
#=GS A0A5D2WAA6_GOSMU/1-282    AC A0A5D2WAA6.1
#=GS A0A251U8C7_HELAN/1-297    AC A0A251U8C7.1
#=GS A0A199UIX2_ANACO/1-280    AC A0A199UIX2.1
#=GS A0A2G5F6N1_AQUCA/1-288    AC A0A2G5F6N1.1
#=GS A0A0K9PN01_ZOSMR/1-299    AC A0A0K9PN01.1
#=GS A0A397ZXL8_BRACM/28-229   AC A0A397ZXL8.1
#=GS A0A078I334_BRANA/302-570  AC A0A078I334.1
#=GS A0A3Q7F6X9_SOLLC/1-300    AC A0A3Q7F6X9.1
#=GS A0A5P1F8K9_ASPOF/1-363    AC A0A5P1F8K9.1
#=GS A0A1U8AGT5_NELNU/1-283    AC A0A1U8AGT5.1
#=GS M5XE43_PRUPE/1-337        AC M5XE43.1
#=GS A0A1S4AUL0_TOBAC/1-306    AC A0A1S4AUL0.1
#=GS A0A0D3DIF6_BRAOL/1-269    AC A0A0D3DIF6.1
#=GS A0A0E0HKD4_ORYNI/1-331    AC A0A0E0HKD4.1
#=GS A0A2G5EN89_AQUCA/1-343    AC A0A2G5EN89.1
#=GS A0A2H5NS33_CITUN/23-357   AC A0A2H5NS33.1
#=GS B9RG56_RICCO/1-314        AC B9RG56.1
#=GS A0A4D8YJH3_SALSN/1-292    AC A0A4D8YJH3.1
#=GS A0A4D8ZPE6_SALSN/2-327    AC A0A4D8ZPE6.1
#=GS A0A199UD04_ANACO/1-279    AC A0A199UD04.1
#=GS A0A1R3IZ11_COCAP/410-674  AC A0A1R3IZ11.1
#=GS A0A0S3TBV9_PHAAN/1-283    AC A0A0S3TBV9.1
#=GS A0A2U1LP63_ARTAN/1-273    AC A0A2U1LP63.1
#=GS A0A4P1RQN4_LUPAN/1-221    AC A0A4P1RQN4.1
#=GS A0A061G7A0_THECC/7-236    AC A0A061G7A0.1
#=GS A0A5A7RIQ8_STRAF/1-300    AC A0A5A7RIQ8.1
#=GS A0A2J6LFC6_LACSA/1-295    AC A0A2J6LFC6.1
#=GS A0A2C9U605_MANES/1-280    AC A0A2C9U605.1
#=GS A0A6A4N5Z9_LUPAL/1-335    AC A0A6A4N5Z9.1
#=GS A0A444YGC4_ARAHY/1-339    AC A0A444YGC4.1
#=GS A0A444GC96_ENSVE/1-283    AC A0A444GC96.1
#=GS A0A200PRX2_9MAGN/1-143    AC A0A200PRX2.1
#=GS A0A078FCL6_BRANA/1-279    AC A0A078FCL6.1
#=GS A0A4U5QKH1_POPAL/1-284    AC A0A4U5QKH1.1
#=GS A0A1U8KYL5_GOSHI/1-336    AC A0A1U8KYL5.1
#=GS A0A1J6JJF0_NICAT/1-313    AC A0A1J6JJF0.1
#=GS G7LI34_MEDTR/1-312        AC G7LI34.2
#=GS A0A4P1R441_LUPAN/1-338    AC A0A4P1R441.1
#=GS A0A0A0LLL3_CUCSA/1-338    AC A0A0A0LLL3.1
#=GS A0A3L6TF08_PANMI/1-342    AC A0A3L6TF08.1
#=GS A0A2G9HRG8_9LAMI/129-194  AC A0A2G9HRG8.1
#=GS A0A4U5M4Q4_POPAL/19-297   AC A0A4U5M4Q4.1
#=GS A0A0L9VHR7_PHAAN/1-283    AC A0A0L9VHR7.1
#=GS A0A5N5LG96_9ROSI/1-321    AC A0A5N5LG96.1
#=GS D7MS41_ARALL/1-332        AC D7MS41.1
#=GS A0A2H3YTL8_PHODC/74-427   AC A0A2H3YTL8.1
#=GS A0A2K3PLB5_TRIPR/1-282    AC A0A2K3PLB5.1
#=GS A0A6A2YA02_HIBSY/1-198    AC A0A6A2YA02.1
#=GS B2Z456_VITVI/1-307        AC B2Z456.1
#=GS A0A1S4A1E5_TOBAC/1-282    AC A0A1S4A1E5.1
#=GS A0A5N6N5G5_9ASTR/11-196   AC A0A5N6N5G5.1
#=GS A0A161YE95_DAUCS/1-294    AC A0A161YE95.1
#=GS A0A061DYQ6_THECC/1-310    AC A0A061DYQ6.1
#=GS A0A314US08_PRUYE/79-389   AC A0A314US08.1
#=GS A0A392N575_9FABA/1-282    AC A0A392N575.1
#=GS A0A6A5NKI8_LUPAL/1-337    AC A0A6A5NKI8.1
#=GS A0A6A3BT02_HIBSY/1-284    AC A0A6A3BT02.1
#=GS A0A2I4HAQ6_JUGRE/1-280    AC A0A2I4HAQ6.1
#=GS A0A4S4E5Z2_CAMSI/101-412  AC A0A4S4E5Z2.1
#=GS A0A444E869_ENSVE/5-345    AC A0A444E869.1
#=GS A0A0D3HAK6_9ORYZ/1-342    AC A0A0D3HAK6.1
#=GS J3MAZ1_ORYBR/1-330        AC J3MAZ1.1
#=GS A0A4D9AJW2_SALSN/1-315    AC A0A4D9AJW2.1
#=GS A0A1R3GRU4_COCAP/1-282    AC A0A1R3GRU4.1
#=GS A0A4U5NJT2_POPAL/1-279    AC A0A4U5NJT2.1
#=GS K7L5P7_SOYBN/1-279        AC K7L5P7.1
#=GS B9S3E4_RICCO/1-36         AC B9S3E4.1
#=GS A0A4U5MN81_POPAL/1-244    AC A0A4U5MN81.1
#=GS A0A1U8ASZ1_NELNU/1-284    AC A0A1U8ASZ1.1
#=GS A0A1U8NCK4_GOSHI/42-234   AC A0A1U8NCK4.1
#=GS A0A067H1J8_CITSI/23-357   AC A0A067H1J8.1
#=GS A0A251S3H4_HELAN/2-275    AC A0A251S3H4.1
#=GS A0A1J7HYI5_LUPAN/2-306    AC A0A1J7HYI5.1
#=GS A0A398AGY9_BRACM/1-287    AC A0A398AGY9.1
#=GS A0A0E0IP32_ORYNI/1-342    AC A0A0E0IP32.1
#=GS A0A1S2Z1J0_CICAR/1-288    AC A0A1S2Z1J0.1
#=GS A0A5N6LH65_9ASTR/1-304    AC A0A5N6LH65.1
#=GS A0A2G2V792_CAPBA/1-310    AC A0A2G2V792.1
#=GS A0A6A5NJV6_LUPAL/1-281    AC A0A6A5NJV6.1
#=GS A0A2I0I162_PUNGR/1-94     AC A0A2I0I162.1
#=GS A0A0L9UU47_PHAAN/1-150    AC A0A0L9UU47.1
#=GS A0A5P1EMS0_ASPOF/1-279    AC A0A5P1EMS0.1
#=GS A0A1U8KXT0_GOSHI/1-289    AC A0A1U8KXT0.1
#=GS A0A5N5HKP0_9ROSA/1-339    AC A0A5N5HKP0.1
#=GS A0A0D3HAK5_9ORYZ/1-342    AC A0A0D3HAK5.1
#=GS BBRC_ORYSJ/1-290          AC Q7XH85.2
#=GS H1ZN91_SOLLC/1-323        AC H1ZN91.1
#=GS A0A2G3BFJ0_CAPCH/1-207    AC A0A2G3BFJ0.1
#=GS A0A2G2XG90_CAPBA/101-414  AC A0A2G2XG90.1
#=GS A0A151RQK4_CAJCA/108-238  AC A0A151RQK4.1
#=GS A0A453IJ74_AEGTS/1-92     AC A0A453IJ74.1
#=GS A0A0E0DW52_9ORYZ/1-331    AC A0A0E0DW52.1
#=GS A0A5D2ZSH7_GOSMU/1-282    AC A0A5D2ZSH7.1
#=GS A0A5A7VDN8_CUCME/1-338    AC A0A5A7VDN8.1
#=GS M4EDF3_BRARP/1-279        AC M4EDF3.1
#=GS M0S854_MUSAM/76-210       AC M0S854.1
#=GS A0A5E4F3B1_PRUDU/30-366   AC A0A5E4F3B1.1
#=GS A0A2I0XBD4_9ASPA/1-312    AC A0A2I0XBD4.1
#=GS A0A1Q3C548_CEPFO/54-335   AC A0A1Q3C548.1
#=GS A0A1S3BBW9_CUCME/1-338    AC A0A1S3BBW9.1
#=GS A0A498ITJ6_MALDO/1-298    AC A0A498ITJ6.1
#=GS A0A078JRW0_BRANA/1-284    AC A0A078JRW0.1
#=GS A0A2R6R6U2_ACTCC/1-296    AC A0A2R6R6U2.1
#=GS A0A078FN78_BRANA/1-286    AC A0A078FN78.1
#=GS A0A4S4EG24_CAMSI/2-269    AC A0A4S4EG24.1
#=GS A0A175YQL4_DAUCS/1-287    AC A0A175YQL4.1
#=GS A0A6A2ZG71_HIBSY/1-336    AC A0A6A2ZG71.1
#=GS A0A1S4AAE8_TOBAC/1-332    AC A0A1S4AAE8.1
#=GS A0A445KNR8_GLYSO/1-279    AC A0A445KNR8.1
#=GS A0A3N6RK03_BRACR/1-269    AC A0A3N6RK03.1
#=GS A0A0D9WLD5_9ORYZ/1-331    AC A0A0D9WLD5.1
#=GS A0A200QQX0_9MAGN/1-326    AC A0A200QQX0.1
#=GS M0ZWF8_SOLTU/5-320        AC M0ZWF8.1
#=GS A0A1U8AU50_NELNU/1-322    AC A0A1U8AU50.1
#=GS A0A251UNX4_HELAN/1-316    AC A0A251UNX4.1
#=GS A0A5C7HBI0_9ROSI/24-215   AC A0A5C7HBI0.1
#=GS A0A0E0IP30_ORYNI/1-342    AC A0A0E0IP30.1
#=GS A0A067K5V2_JATCU/1-318    AC A0A067K5V2.1
#=GS A0A540L8E0_MALBA/1-311    AC A0A540L8E0.1
#=GS A0A0K9P6X8_ZOSMR/19-309   AC A0A0K9P6X8.1
#=GS R0HTS8_9BRAS/43-336       AC R0HTS8.1
#=GS A0A2H3XU47_PHODC/47-303   AC A0A2H3XU47.1
#=GS A0A1S3X6F2_TOBAC/42-270   AC A0A1S3X6F2.1
#=GS A0A2P6PZ01_ROSCH/1-342    AC A0A2P6PZ01.1
#=GS A0A444ZYT1_ARAHY/1-303    AC A0A444ZYT1.1
#=GS A0A5J5AMR9_9ASTE/1-299    AC A0A5J5AMR9.1
#=GS A0A067KPQ0_JATCU/4-278    AC A0A067KPQ0.1
#=GS A0A2R6S2P0_ACTCC/1-294    AC A0A2R6S2P0.1
#=GS A0A1U7V4R1_NICSY/1-309    AC A0A1U7V4R1.1
#=GS A0A2G9H957_9LAMI/3-167    AC A0A2G9H957.1
#=GS A0A5N5HAD8_9ROSA/1-279    AC A0A5N5HAD8.1
#=GS V4KPA5_EUTSA/1-164        AC V4KPA5.1
#=GS A0A5N5N220_9ROSI/1-313    AC A0A5N5N220.1
#=GS A0A061FDZ3_THECC/1-336    AC A0A061FDZ3.1
#=GS A0A1E5UWH8_9POAL/1-371    AC A0A1E5UWH8.1
#=GS A0A068UIH3_COFCA/1-332    AC A0A068UIH3.1
#=GS A0A3B6TI19_WHEAT/1-331    AC A0A3B6TI19.1
#=GS A0A0S3TC91_PHAAN/1-283    AC A0A0S3TC91.1
#=GS A0A5J5B4K1_9ASTE/1-124    AC A0A5J5B4K1.1
#=GS A0A2R6XFD8_MARPO/59-363   AC A0A2R6XFD8.1
#=GS A0A0E0B768_9ORYZ/1-341    AC A0A0E0B768.1
#=GS B9S7E0_RICCO/1-283        AC B9S7E0.1
#=GS V4KBG9_EUTSA/1-281        AC V4KBG9.1
#=GS A0A1S2Y5R8_CICAR/1-338    AC A0A1S2Y5R8.1
#=GS A0A1Q3BQ07_CEPFO/1-337    AC A0A1Q3BQ07.1
#=GS A0A6A4PIQ5_LUPAL/1-305    AC A0A6A4PIQ5.1
#=GS A0A0P0VV53_ORYSJ/1-34     AC A0A0P0VV53.1
#=GS A0A2R6Q264_ACTCC/1-299    AC A0A2R6Q264.1
#=GS A0A445JV22_GLYSO/1-283    AC A0A445JV22.1
#=GS A0A5D2WGI1_GOSMU/1-168    AC A0A5D2WGI1.1
#=GS A2Y8V8_ORYSI/1-274        AC A2Y8V8.1
#=GS A0A2I4DVH4_JUGRE/18-353   AC A0A2I4DVH4.1
#=GS A8D197_POPTR/1-279        AC A8D197.1
#=GS A0A2R6R5R7_ACTCC/1-287    AC A0A2R6R5R7.1
#=GS A0A287PDI9_HORVV/1-252    AC A0A287PDI9.1
#=GS A0A068U164_COFCA/5-323    AC A0A068U164.1
#=GS A0A0D9VRN8_9ORYZ/1-231    AC A0A0D9VRN8.1
#=GS A0A0D2M2M1_GOSRA/1-310    AC A0A0D2M2M1.1
#=GS A0A1B6QAK9_SORBI/128-245  AC A0A1B6QAK9.1
#=GS A0A445J846_GLYSO/1-317    AC A0A445J846.1
#=GS A0A0J8B270_BETVU/1-290    AC A0A0J8B270.1
#=GS A0A2U1L8C2_ARTAN/1-308    AC A0A2U1L8C2.1
#=GS A0A5B6USA8_9ROSI/104-303  AC A0A5B6USA8.1
#=GS F2EFE4_HORVV/1-331        AC F2EFE4.1
#=GS A0A2H3Z0M0_PHODC/1-272    AC A0A2H3Z0M0.1
#=GS V4LNN2_EUTSA/1-346        AC V4LNN2.1
#=GS A0A0K9NSA6_ZOSMR/1-347    AC A0A0K9NSA6.1
#=GS A0A078JDV9_BRANA/16-270   AC A0A078JDV9.1
#=GS A0A453IK27_AEGTS/22-154   AC A0A453IK27.1
#=GS A0A251RRH8_HELAN/1-308    AC A0A251RRH8.1
#=GS A0A5A7PA49_STRAF/32-122   AC A0A5A7PA49.1
#=GS A0A4V4HA68_MUSBA/1-305    AC A0A4V4HA68.1
#=GS A0A445JV61_GLYSO/19-300   AC A0A445JV61.1
#=GS A0A1U7XIZ5_NICSY/1-301    AC A0A1U7XIZ5.1
#=GS A0A2G3CQW4_CAPCH/1-324    AC A0A2G3CQW4.1
#=GS A0A2P5DBV2_PARAD/1-337    AC A0A2P5DBV2.1
#=GS A0A2I4DVH5_JUGRE/1-336    AC A0A2I4DVH5.1
#=GS A0A444EGE8_ENSVE/1-280    AC A0A444EGE8.1
#=GS A0A2P5E133_PARAD/1-279    AC A0A2P5E133.1
#=GS A0A4S4ER25_CAMSI/12-232   AC A0A4S4ER25.1
#=GS A0A6D2IT74_9BRAS/1-291    AC A0A6D2IT74.1
#=GS A0A287PD37_HORVV/1-291    AC A0A287PD37.1
#=GS A0A2P5FQ73_TREOI/1-312    AC A0A2P5FQ73.1
#=GS A0A1S3CS99_CUCME/38-314   AC A0A1S3CS99.1
#=GS A0A2T7CF75_9POAL/1-361    AC A0A2T7CF75.1
#=GS A0A022PVV9_ERYGU/1-321    AC A0A022PVV9.1
#=GS A0A4D8XS11_SALSN/1-312    AC A0A4D8XS11.1
#=GS A0A4D8YID8_SALSN/1-302    AC A0A4D8YID8.1
#=GS A0A2J6KCK3_LACSA/11-189   AC A0A2J6KCK3.1
#=GS A0A3N6S0L1_BRACR/1-277    AC A0A3N6S0L1.1
#=GS A0A2H3YSX0_PHODC/92-445   AC A0A2H3YSX0.1
#=GS A0A0D2RM42_GOSRA/1-280    AC A0A0D2RM42.1
#=GS K3XYG4_SETIT/1-304        AC K3XYG4.1
#=GS A0A2I0ACJ6_9ASPA/1-279    AC A0A2I0ACJ6.1
#=GS A0A2I0BCX1_9ASPA/1-300    AC A0A2I0BCX1.1
#=GS A0A251L259_MANES/1-315    AC A0A251L259.1
#=GS M4DJK8_BRARP/1-273        AC M4DJK8.1
#=GS A0A0E0IP29_ORYNI/484-825  AC A0A0E0IP29.1
#=GS B9HVQ7_POPTR/1-279        AC B9HVQ7.1
#=GS V4UBU4_9ROSI/1-311        AC V4UBU4.1
#=GS A0A2I0B4R7_9ASPA/1-289    AC A0A2I0B4R7.1
#=GS A0A2K1Y8K0_POPTR/27-302   AC A0A2K1Y8K0.1
#=GS A0A453IJT4_AEGTS/1-346    AC A0A453IJT4.1
#=GS A0A5N5K0B8_9ROSI/5-288    AC A0A5N5K0B8.1
#=GS A0A446QQ33_TRITD/1-348    AC A0A446QQ33.1
#=GS A0A2J6LX66_LACSA/1-314    AC A0A2J6LX66.1
#=GS M0T639_MUSAM/110-272      AC M0T639.1
#=GS B9R849_RICCO/1-339        AC B9R849.1
#=GS V7C5Q6_PHAVU/1-283        AC V7C5Q6.1
#=GS A0A5N6RU51_9ROSI/1-284    AC A0A5N6RU51.1
#=GS A0A2I4GBW9_JUGRE/1-315    AC A0A2I4GBW9.1
#=GS A0A5A7R7I6_STRAF/1-73     AC A0A5A7R7I6.1
#=GS H1ZN55_POPTR/1-284        AC H1ZN55.1
#=GS A0A6A5MPS7_LUPAL/1-287    AC A0A6A5MPS7.1
#=GS S8E3W5_9LAMI/1-241        AC S8E3W5.1
#=GS A0A1U8KYJ5_GOSHI/47-257   AC A0A1U8KYJ5.1
#=GS H1ZN95_SOLTU/1-281        AC H1ZN95.1
#=GS A0A397YEY1_BRACM/1-279    AC A0A397YEY1.1
#=GS A0A6A6LW61_HEVBR/1-282    AC A0A6A6LW61.1
#=GS A0A328DPD4_9ASTE/1-280    AC A0A328DPD4.1
#=GS A0A1U8A5C2_NELNU/42-324   AC A0A1U8A5C2.1
#=GS A0A059ANB0_EUCGR/1-314    AC A0A059ANB0.1
#=GS A0A1S3XSA2_TOBAC/1-313    AC A0A1S3XSA2.1
#=GS A0A540LSY3_MALBA/12-290   AC A0A540LSY3.1
#=GS A0A328DQC8_9ASTE/1-287    AC A0A328DQC8.1
#=GS A0A2Z7CP44_9LAMI/1-280    AC A0A2Z7CP44.1
#=GS A0A2G2XNH6_CAPBA/1-313    AC A0A2G2XNH6.1
#=GS A0A4Y7JQ18_PAPSO/1-301    AC A0A4Y7JQ18.1
#=GS C5X4B5_SORBI/1-349        AC C5X4B5.1
#=GS A0A565ARR8_9BRAS/1-267    AC A0A565ARR8.1
#=GS R0FWU3_9BRAS/1-294        AC R0FWU3.1
#=GS M5W6Q0_PRUPE/1-311        AC M5W6Q0.1
#=GS A0A397YEP1_BRACM/26-298   AC A0A397YEP1.1
#=GS A0A3S4NSM7_9MAGN/1-280    AC A0A3S4NSM7.1
#=GS A0A498I8A5_MALDO/35-313   AC A0A498I8A5.1
#=GS A0A251R859_PRUPE/1-278    AC A0A251R859.1
#=GS M0U0N5_MUSAM/1-101        AC M0U0N5.1
#=GS A0A164SP12_DAUCS/129-356  AC A0A164SP12.1
#=GS A0A3B6RBY6_WHEAT/1-331    AC A0A3B6RBY6.1
#=GS A0A5J4ZU74_9ASTE/21-224   AC A0A5J4ZU74.1
#=GS A0A5D2ZVP4_GOSMU/1-280    AC A0A5D2ZVP4.1
#=GS A0A2P5VQV3_GOSBA/42-234   AC A0A2P5VQV3.1
#=GS A0A5J5B491_9ASTE/1-139    AC A0A5J5B491.1
#=GS A0A3Q7HUZ5_SOLLC/1-292    AC A0A3Q7HUZ5.1
#=GS A0A3N7GMY9_POPTR/31-285   AC A0A3N7GMY9.1
#=GS A0A2K3P0I5_TRIPR/1-312    AC A0A2K3P0I5.1
#=GS A0A1R3HYE9_9ROSI/1-311    AC A0A1R3HYE9.1
#=GS A0A0D2TAR1_GOSRA/40-234   AC A0A0D2TAR1.1
#=GS A0A2G3D805_CAPCH/2-91     AC A0A2G3D805.1
#=GS A0A151RRJ6_CAJCA/1-115    AC A0A151RRJ6.1
#=GS H1ZN84_TOBAC/1-301        AC H1ZN84.1
#=GS A0A0L9TJ38_PHAAN/1-312    AC A0A0L9TJ38.1
#=GS A0A0E0L7C1_ORYPU/1-331    AC A0A0E0L7C1.1
#=GS A0A078HTT9_BRANA/266-534  AC A0A078HTT9.1
#=GS A0A166IUT0_DAUCS/1-286    AC A0A166IUT0.1
#=GS A0A4S4DVD1_CAMSI/51-378   AC A0A4S4DVD1.1
#=GS D8TCJ2_SELML/125-266      AC D8TCJ2.1
#=GS A0A2G2X187_CAPBA/1-324    AC A0A2G2X187.1
#=GS A0A059C3N5_EUCGR/6-234    AC A0A059C3N5.1
#=GS A0A4Y7JAX7_PAPSO/1-300    AC A0A4Y7JAX7.1
#=GS F6HFA4_VITVI/15-307       AC F6HFA4.1
#=GS H1ZN48_POPTR/26-224       AC H1ZN48.1
#=GS A0A2G9HQ94_9LAMI/1-308    AC A0A2G9HQ94.1
#=GS A0A1S4DPI3_TOBAC/1-301    AC A0A1S4DPI3.1
#=GS A0A251T2N6_HELAN/129-284  AC A0A251T2N6.1
#=GS A0A0L9T8A0_PHAAN/1-279    AC A0A0L9T8A0.1
#=GS A0A6A5NV11_LUPAL/1-281    AC A0A6A5NV11.1
#=GS A0A5D3ADP4_GOSMU/1-282    AC A0A5D3ADP4.1
#=GS A0A6G1CQG6_9ORYZ/1-331    AC A0A6G1CQG6.1
#=GS A0A061E9H4_THECC/1-282    AC A0A061E9H4.1
#=GS A0A4D8YE58_SALSN/1-300    AC A0A4D8YE58.1
#=GS A0A2J6JTR1_LACSA/1-300    AC A0A2J6JTR1.1
#=GS A0A5N6LS88_9ASTR/1-304    AC A0A5N6LS88.1
#=GS A0A1J6ICM6_NICAT/1-313    AC A0A1J6ICM6.1
#=GS A0A2K1Y8K5_POPTR/7-290    AC A0A2K1Y8K5.1
#=GS V4MAM5_EUTSA/8-231        AC V4MAM5.1
#=GS A0A2P5YSL2_GOSBA/15-264   AC A0A2P5YSL2.1
#=GS A0A2G9G7G5_9LAMI/1-94     AC A0A2G9G7G5.1
#=GS A0A5P1F4G2_ASPOF/35-171   AC A0A5P1F4G2.1
#=GS A0A5N5IAA1_9ROSA/1-311    AC A0A5N5IAA1.1
#=GS A8D193_POPTR/1-317        AC A8D193.1
#=GS A0A6A6LN48_HEVBR/17-268   AC A0A6A6LN48.1
#=GS A0A059BEL2_EUCGR/1-280    AC A0A059BEL2.1
#=GS A0A6D2K0I7_9BRAS/1-346    AC A0A6D2K0I7.1
#=GS A0A2G9HRG8_9LAMI/195-239  AC A0A2G9HRG8.1
#=GS A0A1D6NW48_MAIZE/44-373   AC A0A1D6NW48.1
#=GS A0A199UBE4_MANES/26-232   AC A0A199UBE4.1
#=GS F6GSS6_VITVI/1-180        AC F6GSS6.1
#=GS A0A5E4EI40_PRUDU/1-278    AC A0A5E4EI40.1
#=GS A0A176WT74_MARPO/171-258  AC A0A176WT74.1
#=GS BPC6_ARATH/1-342          AC Q8L999.1
#=GS A0A078JYI4_BRANA/1-339    AC A0A078JYI4.1
#=GS A0A2G2ZYT1_CAPAN/128-216  AC A0A2G2ZYT1.1
#=GS A0A1J6IMN7_NICAT/1-282    AC A0A1J6IMN7.1
#=GS M1CK92_SOLTU/1-311        AC M1CK92.1
#=GS A0A1Q3BZ77_CEPFO/1-315    AC A0A1Q3BZ77.1
#=GS A0A5N6NKY1_9ASTR/1-312    AC A0A5N6NKY1.1
#=GS A0A0D3B503_BRAOL/22-229   AC A0A0D3B503.1
#=GS A0A078I0R5_BRANA/1-320    AC A0A078I0R5.1
#=GS A0A314L3B5_NICAT/1-302    AC A0A314L3B5.1
#=GS M0RWT5_MUSAM/101-260      AC M0RWT5.1
#=GS A0A0B2SA82_GLYSO/1-282    AC A0A0B2SA82.1
#=GS A0A1U8B5I0_NELNU/1-321    AC A0A1U8B5I0.1
#=GS A0A314UEJ3_PRUYE/400-710  AC A0A314UEJ3.1
#=GS A0A4D8ZWH3_SALSN/35-355   AC A0A4D8ZWH3.1
#=GS A0A328DRU1_9ASTE/1-305    AC A0A328DRU1.1
#=GS A0A1U8JS95_GOSHI/1-280    AC A0A1U8JS95.1
#=GS A0A3S3N0D9_9MAGN/1-343    AC A0A3S3N0D9.1
#=GS W1PSM8_AMBTC/70-360       AC W1PSM8.1
#=GS A0A444EYT3_ENSVE/1-271    AC A0A444EYT3.1
#=GS A0A103XB59_CYNCS/170-253  AC A0A103XB59.1
#=GS A0A164YBE3_DAUCS/1-324    AC A0A164YBE3.1
#=GS A0A0D2V6T4_GOSRA/1-282    AC A0A0D2V6T4.1
#=GS J3N0K5_ORYBR/1-319        AC J3N0K5.1
#=GS A0A4P1QWB7_LUPAN/1-337    AC A0A4P1QWB7.1
#=GS A0A1S3VA46_VIGRR/1-283    AC A0A1S3VA46.1
#=GS A0A5A7RCU1_STRAF/39-254   AC A0A5A7RCU1.1
#=GS A0A1U8HWS7_GOSHI/1-280    AC A0A1U8HWS7.1
#=GS A0A445K3R1_GLYSO/147-483  AC A0A445K3R1.1
#=GS A0A151REV5_CAJCA/1-280    AC A0A151REV5.1
#=GS A0A6A2ZHN1_HIBSY/1-309    AC A0A6A2ZHN1.1
#=GS V4KPA5_EUTSA/160-212      AC V4KPA5.1
#=GS A0A0D2MA32_GOSRA/1-326    AC A0A0D2MA32.1
#=GS A0A2I4DLJ5_JUGRE/1-280    AC A0A2I4DLJ5.1
#=GS A0A076L2D6_TOBAC/1-327    AC A0A076L2D6.1
#=GS A0A5E4EI63_PRUDU/1-278    AC A0A5E4EI63.1
#=GS A0A5N6R8F3_9ROSI/1-337    AC A0A5N6R8F3.1
#=GS A0A2H5PHJ0_CITUN/132-423  AC A0A2H5PHJ0.1
#=GS BPC1_ARATH/1-283          AC Q9SKD0.1
#=GS A0A0D9XHB8_9ORYZ/1-338    AC A0A0D9XHB8.1
#=GS A0A1J6J273_NICAT/1-327    AC A0A1J6J273.1
#=GS A0A6G1DNZ7_9ORYZ/1-324    AC A0A6G1DNZ7.1
#=GS A0A444ZSL5_ARAHY/1-275    AC A0A444ZSL5.1
#=GS W9RR46_9ROSA/1-337        AC W9RR46.1
#=GS A0A0D3A0U6_BRAOL/1-282    AC A0A0D3A0U6.1
#=GS A0A2I0WCW4_9ASPA/1-299    AC A0A2I0WCW4.1
#=GS A0A6A3A3B9_HIBSY/1-310    AC A0A6A3A3B9.1
#=GS BBRB_ORYSJ/1-341          AC P0DH89.1
#=GS A0A078FIC2_BRANA/180-337  AC A0A078FIC2.1
#=GS A0A1U7YRN9_NICSY/1-313    AC A0A1U7YRN9.1
#=GS A0A6A2WF19_HIBSY/1-336    AC A0A6A2WF19.1
#=GS A0A2I4G8A5_JUGRE/1-280    AC A0A2I4G8A5.1
#=GS A0A0E0A4I0_9ORYZ/1-331    AC A0A0E0A4I0.1
#=GS A0A540LLM1_MALBA/35-313   AC A0A540LLM1.1
#=GS A0A078GAI9_BRANA/1-262    AC A0A078GAI9.1
#=GS A0A1U7Y9Y3_NICSY/1-327    AC A0A1U7Y9Y3.1
#=GS A0A5B6V2U8_9ROSI/1-256    AC A0A5B6V2U8.1
#=GS A0A565APJ2_9BRAS/1-273    AC A0A565APJ2.1
#=GS A0A2Z7CHN4_9LAMI/1-280    AC A0A2Z7CHN4.1
#=GS A0A0A0KLI8_CUCSA/1-277    AC A0A0A0KLI8.1
#=GS M4DDD6_BRARP/1-305        AC M4DDD6.1
#=GS A0A287PD58_HORVV/13-269   AC A0A287PD58.1
#=GS A0A314KWS9_NICAT/1-333    AC A0A314KWS9.1
#=GS A0A164SP12_DAUCS/1-146    AC A0A164SP12.1
#=GS A0A2R6R045_ACTCC/1-313    AC A0A2R6R045.1
#=GS A0A2K3PDZ8_TRIPR/1-343    AC A0A2K3PDZ8.1
#=GS A0A2U1MXR1_ARTAN/1-285    AC A0A2U1MXR1.1
#=GS A0A2R6Q2Y5_ACTCC/1-283    AC A0A2R6Q2Y5.1
#=GS A0A2T7E3F9_9POAL/1-328    AC A0A2T7E3F9.1
#=GS A0A3Q0HT39_PHODC/25-375   AC A0A3Q0HT39.1
#=GS A0A061DZM0_THECC/2-285    AC A0A061DZM0.1
#=GS BPC4_ARATH/1-296          AC Q8S8C6.1
#=GS A8MQG2_ARATH/1-282        AC A8MQG2.1
#=GS A0A4D8ZMS6_SALSN/1-283    AC A0A4D8ZMS6.1
#=GS A0A397YW00_BRACM/1-269    AC A0A397YW00.1
#=GS A0A397Y1R2_BRACM/1-297    AC A0A397Y1R2.1
#=GS A0A2I0VK71_9ASPA/1-348    AC A0A2I0VK71.1
#=GS A0A2I0W2F8_9ASPA/1-272    AC A0A2I0W2F8.1
#=GS D8RFN3_SELML/9-267        AC D8RFN3.1
#=GS A0A0E0KCJ0_ORYPU/1-341    AC A0A0E0KCJ0.1
#=GS A0A2R6QIF6_ACTCC/1-301    AC A0A2R6QIF6.1
#=GS A0A022R908_ERYGU/1-192    AC A0A022R908.1
#=GS W9SG76_9ROSA/1-281        AC W9SG76.1
#=GS A0A5N5FNM1_9ROSA/27-337   AC A0A5N5FNM1.1
#=GS A0A2I0JDA8_PUNGR/1-127    AC A0A2I0JDA8.1
#=GS A0A445J238_GLYSO/1-282    AC A0A445J238.1
#=GS A0A200R139_9MAGN/1-231    AC A0A200R139.1
#=GS A0A444D3U1_ENSVE/1-272    AC A0A444D3U1.1
#=GS A0A6A3CMI7_HIBSY/78-207   AC A0A6A3CMI7.1
#=GS A0A2P5AKA0_PARAD/1-315    AC A0A2P5AKA0.1
#=GS C5Z3A8_SORBI/1-329        AC C5Z3A8.1
#=GS M8ARK5_TRIUA/1-330        AC M8ARK5.1
#=GS A0A5N5HD93_9ROSA/1-279    AC A0A5N5HD93.1
#=GS R0GAL8_9BRAS/1-343        AC R0GAL8.1
#=GS A0A3L6SE24_PANMI/1-168    AC A0A3L6SE24.1
#=GS A0A394DNC2_LUPAN/1-287    AC A0A394DNC2.1
#=GS A0A200QEH7_9MAGN/1-277    AC A0A200QEH7.1
#=GS A0A1B6QAK9_SORBI/1-133    AC A0A1B6QAK9.1
#=GS K3ZSA0_SETIT/187-527      AC K3ZSA0.1
#=GS A0A4U5QIV7_POPAL/68-397   AC A0A4U5QIV7.1
#=GS A0A6A2WZN4_HIBSY/1-284    AC A0A6A2WZN4.1
#=GS A0A3L6QRW5_PANMI/1-336    AC A0A3L6QRW5.1
#=GS A0A0E0EVC2_9ORYZ/1-238    AC A0A0E0EVC2.1
#=GS A0A2P6R4C6_ROSCH/1-280    AC A0A2P6R4C6.1
#=GS C6TL72_SOYBN/1-283        AC C6TL72.1
#=GS A0A0D3BJA9_BRAOL/1-202    AC A0A0D3BJA9.1
#=GS A0A2P5WKK9_GOSBA/5-286    AC A0A2P5WKK9.1
#=GS R0GFA2_9BRAS/1-286        AC R0GFA2.1
#=GS A0A444FNL4_ENSVE/1-281    AC A0A444FNL4.1
#=GS A0A445KN44_GLYSO/12-290   AC A0A445KN44.1
#=GS A0A200Q8W0_9MAGN/70-147   AC A0A200Q8W0.1
#=GS A0A2R6RHI4_ACTCC/1-296    AC A0A2R6RHI4.1
#=GS A0A118JTG0_CYNCS/49-241   AC A0A118JTG0.1
#=GS M4EYR7_BRARP/94-230       AC M4EYR7.1
#=GS A0A2Z7BZZ8_9LAMI/1-365    AC A0A2Z7BZZ8.1
#=GS A0A444EP84_ENSVE/1-297    AC A0A444EP84.1
#=GS A0A2I0IPP5_PUNGR/1-197    AC A0A2I0IPP5.1
#=GS A0A6A2WA72_HIBSY/5-286    AC A0A6A2WA72.1
#=GS I1I324_BRADI/1-333        AC I1I324.1
#=GS A0A078H560_BRANA/1-278    AC A0A078H560.1
#=GS J3N0L7_ORYBR/1-322        AC J3N0L7.1
#=GS M0S854_MUSAM/1-58         AC M0S854.1
#=GS A0A4S4DY70_CAMSI/8-289    AC A0A4S4DY70.1
#=GS A0A6A2WUG8_HIBSY/1-282    AC A0A6A2WUG8.1
#=GS A0A0D3DW89_BRAOL/99-182   AC A0A0D3DW89.1
#=GS A0A5N5K495_9ROSI/1-277    AC A0A5N5K495.1
#=GS M0ZN10_SOLTU/1-313        AC M0ZN10.1
#=GS A0A426Y227_ENSVE/1-322    AC A0A426Y227.1
#=GS A0A5J9TN88_9POAL/216-534  AC A0A5J9TN88.1
#=GS A0A2K1JPJ5_PHYPA/367-704  AC A0A2K1JPJ5.1
#=GS A0A0D2R7M5_GOSRA/1-282    AC A0A0D2R7M5.1
#=GS A0A4D9AXE0_SALSN/1-289    AC A0A4D9AXE0.1
#=GS A0A397YMF7_BRACM/1-341    AC A0A397YMF7.1
#=GS A0A3Q7EU37_SOLLC/1-313    AC A0A3Q7EU37.1
#=GS A0A287PD31_HORVV/1-212    AC A0A287PD31.1
#=GS A0A445DTE3_ARAHY/1-303    AC A0A445DTE3.1
#=GS A0A3L6S1D2_PANMI/1-290    AC A0A3L6S1D2.1
#=GS A0A287VJ85_HORVV/7-328    AC A0A287VJ85.1
#=GS A0A6A6NHN9_HEVBR/1-296    AC A0A6A6NHN9.1
#=GS A0A445CJZ6_ARAHY/1-339    AC A0A445CJZ6.1
#=GS A0A2I0HZS8_PUNGR/1-153    AC A0A2I0HZS8.1
A0A0E0IP28_ORYNI/1-310               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQ...............................---..-..-.-.-..-.-.QQ....................................Q.H.H.HPR......--..E.H..K.M.MQQ--....................................................Q........TEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A022RL12_ERYGU/86-246              ....................................................................................................................................rnpisevptsra----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..K.....A..S.R...NVK-.........IKSS.RSSKKA..KKMGE....DLN.......RQVT-T.........................YGSK.AE.WE....DQD.LGstL....Q.M....I.R...........FDE.ST.MPV.PVCSCTGVA....RQC.YKWGKGGWQSSCCTTALSEYPLPQMPNKRHARMGGRKMSGTVFSRLLTRLGTAG.HDL.SV.PLDLKI..YWAKHGTNRYITI-t........................................
M4EYR7_BRARP/215-371                 ..............................................................................................................................peagevdeslkrrqcggg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....Q..R.A...DPKA.........KKE-.------..---RK...lRDN.......IVPRM-.........................QRER.SPlRK....SIE.MV..I....N.G....V.T...........IDI.GC.LPV.PVCSCTGLS....QQC.YRWGCGGWQSACCTTNVSMYPLPMNTKKRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SS.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A2G3DBS5_CAPCH/3-215               ...............................................................................................................................sqvnhkeetfdshfpwm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........--HQVN..F...T..P.-...A.....TK...FGSE.S.....K....P...C.....A..A.VPIRS.VA..PTG....eQNVN.A.KFK..A..K.....S..Q.K...IKKN.........MPPM.KGIRET..VSKLL....KVE.......RPENKSs......................asKKTK.GE.AR....CGEaTV..I....K.KpksvA.S...........ADF.SG.LPP.PFCSCTGVS....RKC.YKCG-GGWQSSCCTTSLSEYPLPWNPSKPGYRLTGRKMSNGAYNKLLFTLATEG.CDL.SN.PVDLKN..HWAKHGSNKFTTIK.........................................
A0A151RQK4_CAJCA/1-122               ................................................................................................................................................MDDA..G..HREngrHKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................VALLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQY-R....................................................E........TS----..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------lssgsmpscppgcqisrddlnkqla................
A0A176WT74_MARPO/1-172               ......................................................................................................................................mfcrhhtdaa----..-..---...--...................................----.-.---.........---.---V.RK.LIT.MIA.....ER...D.A...--...............AILERNS.A.Iae..........kvaARE.ERDTALL.QRD................................................................MAYADRD.SA...IE.E....RD...............................AAV..A..A.L.E..I.A.MT...................................dR.N.I.LEK......RV..A.T..K.D.SKLFQsfsmtkn.....................................ctllgaiqP........------..-...-..-.-...-.....SS...LSTS.R.....F....S...S.....I..V.AEQSD.LC..R-N.....GSSK.E.DQ-..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vglsrkrkivvkstldrtlrtkrsylsaneerghe......
A0A124SDN7_CYNCS/36-340              ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMS.PLG....dHR...D.T...KP...............FLSARET.P.Viln........pnggAAT.AAPYHHH.ARNcvvs.......................................................eapipMHYMR-E.SW...IQ.-....RE...............................RLL..H..M.L.P..G.N.PN....................................F.A.L.LPD......TS..A.S..N.S.IHMMQ....................................................Pld....stKDPGMN..V...D..D.N...A.....AI...IKGG.G.....S....S...G.....G..G.AGGDD.-A..GGS.....GPVK.K.RSS..G..T.....N..P.K...TPRA.........KKAK.KGPAVP..KENGN....PT-.......-----G.........................QRSK.VV.KR....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCTCTGTP....QQC.YRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.VN.AIDLRA..HWAKHGTNKFVTIR.........................................
A0A2G2XLY3_CAPBA/2-215               ................................................................................................................................asqvnhkeetfdshfp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........RMHQVN..F...T..P.-...A.....TK...FGSE.S.....K....P...C.....A..A.VPIRS.VA..PTG....gQNVN.A.KFK..A..K.....S..Q.K...IKKN.........MPPM.KGIRET..VSKLL....KVE.......RPENKSs......................asKKTK.GE.AR....CGE.AT..VtkkpK.S....VaS...........ADF.SG.LPP.PFCSCTGVS....RKC.YKCG-GGWQSSCCTTSLSEYPLPWNPSKPGYRLTGRKMSNGAYNKLLFTLATEG.CDL.SN.PVDLKN..HWAKHGSNKFTTIK.........................................
A0A200QQB1_9MAGN/1-341               ................................................................................................................................................MDDN..G..QREngrHKqdhy..........................kllqsQW-M.I.PPHl.......mKDP.HALT.MK.FMS.ILA.....DR...D.T...--...............AIQERNV.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.QA...IS.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DN..A.L..A.A.LEY-Rdnstvnassaptcpp......................gcpvprgtkhmhhqqH........MHHSPH..M...A..E.-...A.....HY...NSRE.M.....H....T...N.....E..A.IPISV.VS..S--.....ESPK.P.RRG..-..R.....R..T.K...DHKAis.....snKRAL.KPSRKV..GKRGG...dDLNk.....hV--TIAkpyewkneq.......cmgggsgeeNETK.PE.WR....GHD.LG..L....N.H....V.N...........FDD.SN.MPE.PVCSCTGVL....QQC.YKWGKGGWQSACCTNTLSMYPLPVVPNKRHSRLGGRKMSGSAFNKLLSRLLAEG.HDL.ST.PLDLKD..HWSRHGTNRYITIK.........................................
A0A453IJT9_AEGTS/2-206               .........................................................................................................................................havhhhp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.TD....................................F.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PLVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
I1I323_BRADI/1-334                   ................................................................................................................................................MDDD..G..SLG...MR...................................NWG-.F.FEP.........PTR.NNLG.LQ.LMS.SMP....aDR...D.T...KQ...............LLSSSP-.F.Ihqhhh....vhphapQ--.-------.--Hthhhphphphlhprdg................................cggvssgapndapsvpMNFVHNE.AW...MH.P....AHhp..........................resKIL..H..A.I.T..T.G.HAghvvht.......................vnpdptgY.G.I.IPG......TN..G.L..H.T.LQMMQ....................................................K........--AEPQ..P...P..P.-...-.....-P...PKDE.C.....I....S...P.....P..L.VEENA.GF..VTE....lPPPK.K.KQQ..R..R.....Q..P.K...SPKP.........KKAK.K-AAAP..CEDG-....---.......APKPV-.........................PRRR.GP.KK....HVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCTCTGAQ....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRHGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A5P1FB67_ASPOF/1-280               ................................................................................................................................................MDDD..G..GLN...MR...................................SWGS.Y.FEQ.........PMK.GSLG.LQ.LMS.NLT....aDR...D.T...KP...............LLSNGG-.F.L...............H-R.DRGIPEH.SAP................................................................MDFVR-D.GW...IH.H....NRd............................tnKIL..H..V.L.P..M.N.HHq..................................gF.S.M.IPD......TS..G.A..H.T.IHMLQ....................................................-........------..T...P..-.-...-.....HP...PKEE.K.....I....-...-.....A..H.ID-NS.ID..NND.....ATQK.K.RSQ..G..R.....T..I.K...APKQ.........KKPK.KVNNQG..RDDL-....---.......-SNGAI.........................SKGN.NG.KK....STD.LV..I....N.G....I.D...........LDL.SG.IPP.PVCSCTGNP....QQC.YRWGVGGWQSACCTTSISTYPLPMSSKRRGARIAGRKMSLGAFKKVLEKLAGEG.HNL.SN.PIDLKT..FWAKHGTNKFVTI-s........................................
M0SA08_MUSAM/1-54                    ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.Y.YEP.........PSK.GNLG.LR.LMS.SVV.....ER...N.A...KP...............LLSNGGF.-.I...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------hrhcsfpe.................................
A0A2G9GH24_9LAMI/1-323               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQFREnamnngnmspcppg.......................cqiprgvkhmhhpqsH........VHHQPH..M...I..E.-...T.....PY...NNRD.M.....Q....M...T.....D..T.VPVSP.IA..P--.....EPAK.S.RRA..-..K.....R..A.K...EPKQat.....psKKTS.KSSKKV..KREGD....DLNk.....tMFGKSQewksg...............pdnelGVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.AVDLKE..HWAKHGTNRYITIK.........................................
A0A5D2RZY3_GOSMU/1-310               ................................................................................................................................................MDGA..G..QLEngrCKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....D..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A2K1Y8K3_POPTR/1-256               .........................................................................................................................................maptmpe----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...KP...............FSGSRSA.A.I...............-MT.SMNGGFN.HRDigvs.......................................................rhmfpMEHMR-D.AS...ID.K....RE...............................KFH..H..V.F.T..G.N.HD....................................Y.DvV.FPE......TS..S.A..N.H.MQMFQ....................................................P........------..-...-..-.-...P.....NS...ANDE.T.....L....-...-.....D..Q.VEGAG.VV..EKE....nGPDK.K.KQR..P..K.....A..L.K...CLKA.........KKGK.RGPQVP..KPDGS....P--.......----SA.........................QQGK.SS.KK....TVE.IM..I....N.G....I.S...........MDI.SL.FPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTCISVHPLPMSMKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.AIDLRT..HWAKHGTNKFVTIK.........................................
A0A6A3B3W9_HIBSY/1-282               ................................................................................................................................................MDDD..V..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.T...KP...............FITGRDP.N.L...............-MV.TTNAAFH.PRDcvvs.......................................................eahipMNYVR-N.SW...TN.D....RE...............................KLF..S..V.F.P..AtG.PS....................................Y.G.I.LPE......TS..T.A..H.S.LSNLQ....................................................P........------..-...-..P.-...P.....DS...STRD.E.....M....V...V.....S..R.VEELP.AS..KDG.....VQPR.K.RQD..G..A.....V..P.K...MPKA.........KKPR.K----P..NENAN....S--.......----TV.........................QRSK.PA.KK....SID.FQ..I....N.G....F.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKLLEKLAAEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A200PYF4_9MAGN/1-275               ................................................................................................................................................MGDD..N..ALS...YQ...................................HWG-.Y.FEA.........PIK.GQLN.LQ.LSP.GV-.....ER...D.T...KP...............FLSGRDS.A.L...............-LL.NPNGAFR.HRDygvs.......................................................etqvpMDFSN--.GW...MN.Q....RD...............................KFL..H..V.P.S..G.N.PN....................................F.A.V.LSE......TS..S.T..Q.E.FHMLH....................................................-........---QPL..D...P..-.-...-.....--...PKDE.R.....L....-...-.....V..Q.MEEPG.-S..KKD.....GPLK.K.RLT..-..-.....-..P.K...SPKP.........KKPK.K----P..KDET-....---.......IPS-V-.........................QRSKpGR.QQ....NTG.LV..I....N.G....I.D...........MDI.MG.IPT.PVCSCTGIA....QQC.YRWGCGGWQSACCTTSLSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNL.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A4V4H3U7_MUSBA/1-297               ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.F.YEP.........PMK.GNLG.LR.LMP.SVM.....ER...D.A...KP...............LLSSGGF.-.Mrrhcgi..pepsvppNFV.R------.--Dgwrhh.....................................................gndsskNDLLR-D.GW...IH.H....NNd............................ndKNF..H..I.L.P..V.N.HQhh................................pgY.G.V.IPD......PP..T.G..H.N.LQMLQ....................................................H........------..-...P..E.-...-.....PQ...PKHD.K.....V....-...-.....S..T.MEANG.A-..KNE.....SPLK.K.RSR..G..R.....P..Q.K...SPKP.........KKPK.K-AVAP..SDDV-....-LN.......G---SL.........................SHEK.GG.RK....STG.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGKP....QQC.YRWGIGGWQSACCTTSISMHPLPLSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.TN.PIDLRT..FWAKHGTNKYVTIR.........................................
A0A392MHE1_9FABA/1-343               ................................................................................................................................................MDDR..E..NGR...HKadqy..........................ksaqgQW-L.M.QQH.........QHQ.HPSM.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.T.LQFREnalanggmsscppgc......................qisrgvkhihhlpxxX........XXXXXX..X...X..X.X...X.....XX...XTRE.L.....H....T...T.....N..A.LPEAP.IP..S--.....EVGK.P.PRR..A..K.....R..P.K...ENKSvs.....pnKKTP.KTTRKV..KKEGE....DLNk.....tMFANDEalewkssqei....inggddlnkqlPVSK.AD.WK....PQD.LA..L....N.Q....V.A...........YDD.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5C7H7B9_9ROSI/1-326               ................................................................................................................................................MDDG..G..HRE...NG...................................RHK-.A.EQY.........KA-.--AQ.GQ.IMS.LMA.....ER...D.A...--...............AVQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.TA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREsslstgnmtscppg.......................cqisrgvkhmhhqqqH........VHHIPH..M...S..E.-...A.....AY...STRE.M.....H....P...S.....D..A.LPVSP.GA..S--.....EAAK.P.RRG..-..K.....R..T.K...DPKTvs.....pnKKTS.KSPRKI..KRENE....DLNk.....iVFG--Kpnewksahel....eggdddvnkqlVVSK.TD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SS.PVDLKD..NWAKHGTNRYITIK.........................................
A0A0D3BJA8_BRAOL/1-47                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.--------------------------------MGGRKMSGNVFSRLLSRLAGQG.QDL.SS.PVDLKD..YWARHGTNRYITIK.........................................
A0A2P5F7S9_TREOI/1-337               ................................................................................................................................................MDDG..G..HREngrHKgdqy..........................kttqgQW--.M.MQH.........QPS.M---.KQ.IMG.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREnslsngnmsacppg.......................cqisrgvkhvhhplpH........VHHLQH..M...N..E.-...A.....SY...SSRE.M.....N....T...S.....D..S.LPMPA.EA..P--.....DTAK.S.RRG..-..K.....R..T.K...EPKPis.....pnKRAS.KPPRKI..KRESE....DLNk.....iAFGKSQewksgqsmv......gggddlnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.T...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTMSMYPLPSVPNKRHARVGGRKMSGSAFNKLLNRLAADG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A1S3VA54_VIGRR/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.ATNGAFH.HRDisms.......................................................hatypMEYXR-D.AW...IS.S...xXD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....A....-...-.....-..-.VEEEP.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAA....QXC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGXKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A0B0NBJ2_GOSAR/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREnaknfpfg....................................sgiqrgrtC........MHLSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A2H5NS64_CITUN/56-390              ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2G2ZZN4_CAPAN/2-71                ...............................................................................................................................qviatisddwanllemd----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......--SDKE.........................ADTQ.LT.SW....KDN.LW..L....N.Q....I.N...........FDE.SA.MPV.MVCSCTGTP....QPC.YKWGHSRWQSS-------------------------------------------.---.--.------..--------------.........................................
A0A0D9VRN8_9ORYZ/229-304             ...............................................................................................................................................i----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----NGGWQSACCTTSISTYPLPMSTKRRGVRIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A5J5AI49_9ASTE/1-281               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVT.....ER...N.T...KS...............FLSGRDH.T.V...............-MV.SANGAFH.PRDcvvs.......................................................eppvhMDYVR-D.SW...VN.Q....RE...............................KFL..N..M.L.P..G.N.PN....................................F.A.V.LPE......PS..G.T..H.P.MHILQ....................................................P........------..-...S..D.-...-.....--...SSKD.M.....R....-...-.....V..G.MEEPG.VR..KEG.....GPLK.K.RTA..G..G.....T..P.K...TPKP.........KKSK.KGPSVP..KDNGN....S--.......----SV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLATEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A6A4PPS3_LUPAL/1-336               ................................................................................................................................................MDDP..G..HHEngrHKpdqy...........................ksagQW-L.M.-QH.........QPS.M---.KQ.IMS.LMA.....ER...D.A...--...............AIQERSL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREssltsgsmsscppg........................cqisrgvnhihhpqQ........QVHQLH..N...M..G.D...T.....SY...SARD.M.....H....T...T.....D..A.LPESP.IP..L--.....EAGK.S.RRA..-..K.....R..P.K...QAKSis.....pnKKIS.KTARKV..KMESG....DMNd.....mMFGKMRewksgqemf......nggedlnkqsVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PFCSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5D2S2X1_GOSMU/1-187               .........................................................................................................................................mmpqhhv----..-..---...--...................................----.-.KEQ.........SNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....D..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN.......RQ----.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vdtefapaqefpdiatsgemvdgs.................
A0A1U8KTS0_GOSHI/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A2G2X786_CAPBA/65-114              ...............................................................................................................................................h----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.--------------------------------VGGRKMSGGAFSKLLNHFAAQD.YDL.SI.PLDLKDsdQLAKHDTNRYNTLK.........................................
A0A6P9E7R0_JUGRE/6-299               ..............................................................................................................................................ip----..-..---...--...................................-WNM.V.PQHqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.S...--...............AIRERNA.-.-...............ALS.EKNEALA.ARD................................................................EALRQRD.EA...FA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LQV-Rdnamnfplgg................................giqrgskrmhH.......lSNHLVT..M...A..E.-...A.....PY...NTKE.A.....Q....I...T.....D..A.FPITV.IA..S--.....EAVK.S.HQV..-..K.....R..T.K...ENKAi.......sSKPL.KSPRKG..KKVGE....DLN......rQAASDG.........................TKYR.SE.WD....SQD.VG..L....N.L....V.T...........FDE.SS.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTRLSMYPLPQMPNKRHARVGGRKMSGSVFTRLLSRLAAEG.HDL.SL.PLDLKD..YWARHGTNRYITIK.........................................
A0A5B6X0K1_9ROSI/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREnaknfpfg....................................sgiqrgrtC........RHPSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVPT.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A445D1C4_ARAHY/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LLGGRNA.A.V...............-LS.GTNGAYH.HRDigmp.......................................................patypMDYMR-D.AW...ISsQ....RE...............................KYM..N..M.I.P..T.N.PS....................................Y.G.S.IPE......TS..S.T..H.H.MQMIP....................................................-........------..-...-..-.P...P.....EL...SAKE.E.....R....-...-.....-..P.VEEAP.VV..EKA....nTTGK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RGPRVP..KDEN-....---.......APT--V.........................QRAR.AP.KK....TTE.IV..I....N.G....I.D...........LDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGMSTYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5D2Y9N7_GOSMU/75-122              .............................................................................................................................................awh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----------------------------------GRKMSNRACIKFVLRLTAES.HDL.SQ.PVDLKD..HCARHGTNNFVTIK.........................................
A0A4U5QLS2_POPAL/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........PVR.GNLG.LQ.LMSpTMP.....E-...-.-...KP...............ILGSRSA.A.I...............-MT.SMNEGFY.HRDigis.......................................................qplmpMEYVR-D.AW...IG.Q....RE...............................KLL..N..V.L.P..G.N.HD...................................yA.A.V.LPE......TS..S.S..H.H.MEMFQ....................................................P........------..-...-..-.-...P.....YS...TKDE.P.....L....-...-.....E..L.VEEAG.VV..EKV....nVPNK.K.RQR..H..K.....G..P.K...SPRA.........KKGM.GGAQVP..KREGS....---.......-P--PT.........................QRAR.AA.KK....SAE.IM..I....N.G....I.N...........MDI.SV.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTCISVYPLPMSTKRRSARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0L9V970_PHAAN/1-337               ................................................................................................................................................MDDA..G..HREngrHKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREtsigsgsmsscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...P.....SY...STRE.M.....H....T...T.....D..A.LPAAP.IT..S--.....EAGK.S.RRA..-..K.....R..P.K...EPKSts.....pnKKTP.KAAKKV..KKESE....DLNk.....vMFGKAHewkngqemv......nggddlnkqlVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....KQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
H1ZN90_SOLLC/6-219                   ..............................................................................................................nhkeetfdshfpwihrdnfppatqlgskskpcaa----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.VPIRS.VA..PTGe..qnVDVK.F.KAK..S..Q.....K..M.K...KNKKtsm...ngiR---.---ETV..SELLK....EK-.......-----Rfenkssas.........kkpkgeakCGEA.TV.TK....NPS.SV..Y....G.R....A.S...........ADF.SG.LPQ.PFCSCTGVS....RRC.YKCG-GGWQSSCCTTSLSEYPLPFNPSKPGNRKAGRKMSNGAYNKLLCTLATEG.HDL.SN.PVDLKD..HWAKHGSNKFITLK.........................................
A0A540M1I3_MALBA/1-339               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HN.........QPS.M---.KQ.VMA.IMS.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DS..A.I..A.T.LHY-Rdnslnsgnvsscppgc....................qisrgvkhmhhtqqqqH........VHHMPH..M...N..E.-...A.....SY...GTRD.M.....H....T...S.....D..S.ITMPP.ET..S--.....VPTK.S.RQP..-..K.....R..P.R...EPKTtq.....pnKKPS.KSPRKM..KRESE....DLNk.....mTFDKLHdwkggqdmg......gegddlnkqvVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PMCSCTGLL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLTAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0D3DXB4_BRAOL/1-279               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPaa.....atSFK.GNLG.LQ.LMP.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.QTGSYHH.HQH...............................................................hPEPHMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.V.LPQ......TS..S.S..P.S.MHMN-....................................................-........LHHHHH..Q...T..E.E...-.....--...----.-.....H....-...P.....V..K.CEPDI.VE..S--.....---K.K.RKP..-..N.....S..K.A...GGAP.........TKAK.K-PRKP..KEENG....DSN.......NAN--V.........................SRVK.PA.KK....SFD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
BPC5_ARATH/1-283                     ...................................................................................................................mesggqyengrykpdyykgtqsvnvmpkk----..-..---...--...................................----.-.-EQ.........HNA.LVMN.KK.IIS.ILA.....ER...D.A...--...............AVKERNE.-.-...............AVA.ATKEALA.SRD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MET......ES..A.L..N.A.LRYRE....................................................Nnl....nyILSCAK..R...G..G.S...Q.....RF...ITEE.S.....H....L...P.....N..P.SPIST.IP..P--.....----.-.---..-..-.....E..A.A...NTRP.........TKRK.KESKQG..KKMGE....DLN.......RPVASP........................gKKSR.KD.WD....SND.VL..-....-.-....V.T...........FDE.MT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRLAGEG.HEL.SS.PVDLKN..YWARHGTNRYITIK.........................................
A0A0K9R6K0_SPIOL/76-241              .......................................................................................................................qncilssgvecdnnyvpqeinalse----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..S.....N..N.K...SPQP.........KKTK.E--RKP..REKRT....---.......---CDE.........................LKVK.KE.WD....GKK.MG..L....N.R....V.D...........YDD.SV.MPS.PGCSCTGVF....RQC.YKWGNGGWQSACCTTTVSVYPLPPVPNKRYARIGGRKMSASAFSKLLSELAMEG.FDL.SV.PVDLKN..RWSKHGTNRYITIK.........................................
A0A1S3X692_TOBAC/8-224               ..................................................................................................................ypmasqvnhkvetfdshfpwthqdnrfpat----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....-K...DGSK.S.....K....P...Y.....A..A.VPIRS.VA..PTG....eQHMN.V.KVK..A..K.....R..Q.K...VKKN.........KMSA.KELREI..ASKLF....KVE.......QPENKPs......................asKRTK.GE.SRcgeaTVT.KN..P....N.S....V.I...........ADF.CG.VPP.PFCSCTGVA....RRC.YKCGVYGWQSSCCTTTLSEYPLPMNPSKPGNRLGGRKMTNGAYTKLLLRLAAQG.RDL.SN.PVDLKN..HWAKHGSNKFITIK.........................................
A0A1S3UIK1_VIGRR/1-279               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............YLPARDP.S.V...............-LM.GASGTFH.PRDcvvs.......................................................eapmqLNYVR-D.NW...TS.Q....RD...............................RYF..S..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..V.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.IEELV.VK..KEG.....GQSK.K.RQT..K..G.....A..L.T...TPKA.........KKPR.K----P..KDNG-....--N.......VPV---.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A0B2QBP8_GLYSO/1-317               ................................................................................................................................................MDDG..R..QHEngrHKmeyy..........................rgahsLWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILEIEL.E.A...............AIS.EKNEALA.ARD................................................................AAIRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRNnsvnfpfggg................................iqcgskrmhhS........SNHLSN..M...T..E.-...A.....AY...NTKD.M.....I....I...R.....D..A.SPVTV.IP..S--.....EAVN.S.HQS..-..K.....R..S.K...ENKVi.......nSKAS.KPPCKV..KKMGE....DLN......rQASSEG.........................TKIR.SE.WD....RQD.VG..V....N.L....V.A...........FDE.TI.MLV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
F2E947_HORVV/1-350                   ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVTg...gHR...D.T...KP...............LLPNGTF.L.Qh............htPPH.HPPHSHH.PRDygngepsgg..............................................mpaeppaihMDFVRNE.AW...MH.P....SQhqhqhqhqhqhqhqhqhqlqhqhqhqhsrelKVL..N..A.V.P..V.G.PAphighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PDEE.K.....I....T...P.....P..L.VEDHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...VPKP.........KKPK.K-DATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
R0GR44_9BRAS/1-339                   ................................................................................................................................................MDDG..G..HRE..nGR...................................HKAA.Q.GQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtaasanmsacppgc...............qisrgvknmhhphmhhhhhQ........QHHIPQ..L...T..E.-...N.....AY...EPRE.M.....E....P...N.....D..G.LPTSP.TA..GSV....lESAK.P.KRG..-..K.....R..V.K...DPKTttq..taanKRGT.KNQRKV..KKESE...dDLTk.....iMFLKTThdytee............dsskhilIGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A166IE21_DAUCS/40-343              ................................................................................................................................................MDKG..G..RAR...HMefyk...........................gahsQWNM.V.PQYqm.....kdQNA.FLMP.GK.IAH.IIA.....ER...D.A...--...............AFEERDR.-.-...............ALS.ERKAALE.ERD................................................................SAIQLRD.AA...IS.E....RD...............................SAL..R..E.R.E..I.A.LEal...............................rfqE.T.T.M-S......TA..W.N..N.T.IQRGS....................................................K.......rVHHVAN..Y...P..L.V...A.....AY...NTKE.G.....A....I...T.....D..A.FPLQA.IS..S--.....EGVK.A.HQE..-..-.....K..P.R...KPKK.........FVSS.KSQLKA..KKINE....DLN.......RHVT-T.........................DWSK.AE.WD....AKN.LG.sM....K.Q....I.I...........YDE.ST.MPI.PVCSCTGVQ....HQC.YKWGNGGWQSSCCTTTKSQYPLPQLPNKRHSRMGGRKMSGNVFSRLLTRLAAEG.HDT.RM.PLDLKE..HWAKHGTNRYITIR.........................................
A0A5D3AEP1_GOSMU/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A068TRR3_COFCA/1-308               ................................................................................................................................................MDGN..G..SMN...LR...................................NWG-.F.FEPtpt...palKGA.GHLG.LQ.LMS.TMT.....E-...-.-...KP...............LFGGGRE.N.Hp.............yQ--.----HHH.PHQayssimapstnggp...................................yhhhrvggisessipMDYMR-D.LQ...LH.P....QQ...............................QNQ..H..H.S.Q..H.H.HPq.................................inY.G.V.LPE......TS..S.A..H.S.VQMIQ....................................................Q........-SSLLN..N...D..D.-...-.....VG...PQEE.E.....-....-...-.....-..I.CETRG.VV..G--.....-AVK.K.RGG..G..K.....V..P.K...SPKA.........KKPK.KAPKPP..REESS....---.......---RSL.........................HRAR.AP.KK....SAE.VI..I....N.G....I.S...........MDI.SG.IPI.PVCTCTGNA....QQC.YRWGAGGWQSACCTTGMSVYPLPMSAKRRGARIAGRKMSLGAFRKVLEKLASEG.FNF.SN.PIDLRN..HWAKHGTNKFVTIR.........................................
M1AJB5_SOLTU/12-219                  .........................................................................................................................fdshfpwihrdnfppatkfgses----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....K....P...C.....A..A.VPIRS.VA..PTGe..qnVDVK.F.KAK..S..Q.....K..M.K...KNKKt......smKGIR.ETVSEL..LKEER....PEN.......-----Kssaskk.............tkgearCGEA.TV.TK....NPN.PV..Y....G.R....A.N...........ADF.SG.LPP.PFCSCTGVS....RRC.YKCG-GGWQSSCCTTSLSVYPLPFNPSKPGNRKAGRKMSNGAYNKLLCTLATEG.HDL.SN.PVDLKD..HWAKHGSNKFITLK.........................................
A0A5D2WG87_GOSMU/1-212               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREnaknfpfg....................................sgiqrgrtC........MHLSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN.......RQV---.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------dtefapaqefpdiatsgemvdgs..................
A0A2J6LVH0_LACSA/1-303               ................................................................................................................................................MEDD..G..-LN...MR...................................NWG-.Y.YEP.........SFR.EHLG.LQ.LMS.PIP.....D-...-.T...KP...............FLSTREN.S.I...............MMN.PN--PTT.NHDhipnyp...................................................psdpsipIHYMR-D.NW...IQ.-....RE...............................RFL..H..I.L.P..G.N.HN....................................F.P.V.IPT......AS..T.S..L.V.MPSLHiap.............................................ppplD........----LS..K...D..T.V...T.....TM...EDSV.V.....D....R...K.....D..S.VNVNG.GD..GDR....gGSVK.K.RGS..T..TttaaaA..G.K...PPRA.........KKQK.KTPSTP..KENGN....S--.......----SS.........................QRPK.TM.KR....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAS....QQC.YRWGSGGWQSACCTTTISMHPLPMSTKRRGARIAGRKMSRGAFKKVLEKLASEG.YNF.AN.AIDLRT..FWAKHGTNKFVTIR.........................................
A0A5J5AET6_9ASTE/1-241               ..........................................................................................................................................mailqr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................------D.SA...IA.E....RC...............................---..-..-.-.-..-.-.--....................................-.Q.I.SRG......LM..H.M..H.H.LQQ--....................................................H........AHHQAH..L...S..E.-...A.....PY...NTRD.M.....H....I...G.....D..A.LPISP.VA..S--.....EPAK.S.QRT..-..K.....R..P.K...EAKAvs.....stKKAS.KSSKKV..KREGD....DLNk.....mMFGKSQewkggqdmg......yggddlnkqlGVPK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.QVCSCTGDL....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5E4GB85_PRUDU/1-311               ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARE................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....DTVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDD.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A2H3X057_PHODC/1-319               ................................................................................................................................................----..-..---...--...................................---M.M.PQH.........QMK.DHQT.MK.LMA.IMA.....ER...D.S...--...............AIHERNL.-.-...............AIS.EKKAALA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARetgmngnggngcs.........................pgctaptkhhdhlpH.......vHPSPKQ..L...S..D.A...P.....YD...HERQ.V.....D....V...T.....E..A.YPIST.AV..ESA.....KGSK.V.KRM..R..K.....E..N.G...VQAIp.......tKKSS.KSPKKN..KRSGN...dDLN......rQVSI-Akfhgewkgqe....qvsdggdvnkvPVTK.HQ.WK....GQD.LG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGKF....HPC.YKWGNGGWQSSCCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2R6R1J8_ACTCC/1-301               ................................................................................................................................................MDDG..G..QRDharHRmdyyy.........................kgghiPWSM.M.PQYqm.....neANA.IFMN.KK.IVH.IIA.....EK...D.A...--...............AIEEMNK.-.-...............AIA.EKNAALE.ERN................................................................EAFKQRD.NA...IA.A....RD...............................---..-..-.-.-..-.-.--....................................T.A.L.RER......DS..A.I..A.A.LRFQE....................................................Nsm...ngiLGYGIQ..R...G..T.K...R.....AH...HPTN.Y.....H....P...A.....P..A.AEV--.PI..ASD.....EIVK.S.RQA..-..K.....C..A.K...GKKNv.......sPKVS.KSPKKG..KKVGE....DLN.......REV-TT.........................NGSK.AE.WD....AQD.LD.lI....N.Q....I.D...........FDE.SS.IAA.PVCSCTGKP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARMGGRKMSGSVFTRLLTRLASDG.HDL.SI.PLDLKN..FWAKHGTNRYITIK.........................................
A0A078JVC6_BRANA/1-325               ................................................................................................................................................MDDG..G..HRDngrHKap...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..S.A.LQYREnsmatpsavsnmaaacpp................gcqmprgvkhihhpqmhqH........QHHMLQ..L...S..D.H...-.....--...AYDE.S.....R....E...M.....D..G.LPTSP.PP..GTA....lDSAK.P.KRG..G..K.....R..V.K...DPKA........tTKTT.ANKRGP..KNPRK...tTLD.......YGEEETsk....................lvlTGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGDL....RQC.YKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0D3C0Y8_BRAOL/1-284               ...............................................................................................................................menggqyangsdylkga----..-..---...HS...................................MWNM.L.PHHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKMEALA.ARD................................................................QALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................N........SLNFAL..S...G..G.K...R.....CQ...GGDD.D.....D....-...-.....V..L.FTIDD.LC..PTT.....S-T-.-.---..-..N.....T..T.K...AIKR.........KKDN.K--PKG..KKVGE....DLN......lLVAAPG.........................KKCK.KD.WD....TNH.FG..L....N.L....V.T...........FDE.KT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTNLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSHLAAEG.CDL.SS.HVDLKD..YWARHGTNRYITIK.........................................
H1ZN86_SOLLC/1-281                   ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SMV.....DR...D.A...KP...............YLTRREN.P.I...............-ML.GANGVFH.SRDsiipe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.S.PY....................................T.S.V.LPD......AS..A.S..T.P.MQMVQ....................................................-........------..Q...P..D.-...-.....--...TTKD.V.....G....-...-.....V..N.VEEPS.VK..KES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKSK.KVSSAP..KENGN....---.......----PS.........................QRAK.PA.KK....SMD.IV..L....N.G....I.D...........MDI.SV.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0D3ANU4_BRAOL/157-315             ............................................................................................................................pkpeagevyeslkrrqcggg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....Q..R.A...DPKA.........KKER.K----L..-----....KDN.......IVPRM-.........................QRER.SPlRK....SIE.MV..I....N.G....V.T...........IDI.GC.LPV.PVCSCTGLS....QQC.YRWGCGGWQSACCTTNVSMFPLPMNTKKRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SN.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A2P5EE11_TREOI/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FLPGRDP.T.T...............VMV.SANGTFH.PRDcvvs.......................................................dapvpMNYVR-D.GW...VN.Q....RD...............................KFL..N..M.L.P..A.T.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........------..-...-..-.-...P.....DT...QRDE.R.....V....-...-.....G..R.VEEPV.VN..KES.....GPSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----P..KENNN....S--.......----AV.........................PRLK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
V4U5W1_9ROSI/132-423                 ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TMPm...vDR...D.T...KP...............FLPGRDP.N.I...............-MI.GANGAFH.PRDcvvs.......................................................easipMNYMR-D.SW...IS.Q....RD...............................KFL..N..M.L.P..S.N.PT....................................F.G.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........PPNMSR..D...D..R.L...A.....PD...RVAP.D.....R....I...V.....P..K.VEEPV.VK..TEG.....APLK.K.RQG..G..G.....A..S.K...TPKA.........KKPK.K----P..KDNNG....---.......---TAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
BPC7_ARATH/5-226                     .................................................................................paqnlmlsatnankdsglrtsnahwlhsciavpkttgidlsqeppaegvmvpqshlfpppird----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---SR.--..NDT.....ETVK.Q.KSV..N..Q.....S..P.S...KALK.........PKPQ.RKKRSV..SNKS-....---.......KKTPSI.........................PETK.RE.KK....NLD.IN..I....D.I....S.S...........FDT.SG.VPP.PVCSCTGVS....RVC.YKWGMGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLADEG.YDL.SH.PLDLKN..HWARHGTNKFVTIK.........................................
A0A0D3HAK7_9ORYZ/1-280               ..............................................................................................................................................mg----..-..---...LR...................................GWGA.F.YEP.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSVACP.-.-...............--A.PPPSAHH.PREcgananananandg...................................ampppaateappsmlMNFVRND.MW...MH.P....QQ...............................---..-..-.-.-..-.-.-Q....................................H.H.H.HPR......--..E.P..K.M.MQHQP....................................................E........PQPQPQ..P...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..ISE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDGA....PP-.......--SAPA.........................PRRR.GP.MK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTVSTYPLPMSTKRHGARIASRKMNHGAFKKVLEKLAGEA.---.--.------..--------------tiliir...................................
A0A067DNK4_CITSI/1-292               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TMPm...vDR...D.T...KP...............FLPGRDP.N.I...............-MI.GANGAFH.PRDcvvs.......................................................easipMNYMR-D.SW...IS.Q....RD...............................KFL..N..M.L.P..S.N.PT....................................F.G.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........PPNMSR..D...D..R.L...A.....PD...RVAP.D.....R....I...V.....P..K.VEEPV.VK..TEG.....APVK.K.RQG..G..G.....A..S.K...MPKA.........KKPK.K----P..KDNNG....---.......---TAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A444FHH9_ENSVE/2-326               ..............................................................................................................................................vl----..-..---...--...................................QW-M.M.PHH.........QLK.E--N.QT.IKL.LMA.....ER...E.K...--...............ALQERDI.-.-...............AIS.EKKAALA.ERD................................................................TAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DD..A.I..A.A.LEYARencmgnncapgcspv.....................pcgtknmynyqqqhlqH.......iQAAPQQ..L...H..D.A...P.....NN...QTRE.T.....P....R...G.....E..A.FPNSG.GP..ETL....gKLIK.T.KRS..R..K.....K..T.E...VEASs.......sKKMT.KFPRKS..KKGGG...nDWD......kQ-V--Tiaraagawrge...vgvgedlnkvsSLKH.HE.WK....SQD.LG..L....N.Q....V.T...........FDD.SS.MPA.PVCSCTGRY....QQC.YKWGNGGWQSACCTMTLSMYPLPVLPNKRHARVAGRKMSGSAFRKLLSRLAAEG.HDL.SL.PVDLKD..HWAKHGTNRYITIK.........................................
A0A151RFM5_CAJCA/1-98                ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEP.........AIK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.GTNGAFH.HRDigmh.......................................................qatypTEYMR-D.AW...ISsQ....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.V.EE-......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------apv......................................
A0A2K1XHD7_POPTR/1-196               ............................................................................................................................................masv----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.--NGGFH.HRDtgvw.......................................................qpmfhIEYMR-D.AW...TG.Q....RE...............................TFL..N..A.L.P..G.N.HS...................................yA.A.V.LPG......TS..S.A..H.H.MHMFQ....................................................P........------..-...-..-.-...P.....DL...VNHE.T.....M....-...-.....D..Q.VKEAG.VV..EKE....nVPNK.K.RQR..P..K.....A..L.K...SPKV.........KKDM.RGPRAP..KPEGS....---.......---PSV.........................QLVR.SA.KK....TAE.IM..I....N.G....I.N...........IDI.SV.IPI.PVSLCMG-P....QQC.YHWVCGGWLSVCCMTCISMYPLPMSTKRHGSRIAGRK-----------------.---.--.------..--------------k........................................
A0A022QNC4_ERYGU/1-287               ..............................................................................................................................................md--ED..-..--N...LR...................................NWG-.Y.YEPp.......aPMK.GQIG.LN.LMQ.SMA.....ER...D.T...KP..............sFLTGRDH.P.V...............-MV.STNGAFH.PRDcvvte......................................................ppltrMEYVR-E.DW...IN.H....RG...............................KLM..Q..I.F.S..N.N.HY....................................N.P.N.LAE......SS..G.S..H.H.VPM-Q....................................................-........---MIQ..Q...P..E.-...-.....--...PTEE.A.....R....-...-.....P..V.MEDPP.VK..KEP.....GTTK.K.RAS..A..As...sT..P.K...APKG.........KKPR.KGPAKE..NSSG-....--N.......---PSV.........................QRAK.PA.KK....NIE.VV..I....D.G....V.D...........MDI.TG.IPI.PVCSCTGQP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YIF.AN.PIDLKS..FWAKHGTNKFVVIR.........................................
A0A3B6JJM0_WHEAT/1-346               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqhqhhhqnqh....qqqhqhqhqhsreqKVL..H..A.V.P..L.G.PPghighpgh....................avhhhptdF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PLVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1R3HQA6_9ROSI/1-282               ................................................................................................................................................MDDD..P..--T...FR...................................NWG-.F.YEPt......ppSFK.GHLG.LQ.LMT.SMA.....ER...D.T...KP...............FIPGRDP.N.L...............-MI.NPNAGFH.PRDcvvs.......................................................eatipMNY--RD.GW...IS.-....RD...............................KFF..S..M.L.P.pT.V.PN....................................Y.G.M.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DP...STRD.E.....R....M...V.....G..R.VEEPP.AN..KEG.....VQLK.K.RQG..G..A.....T..P.K...TPKP.........KKPR.K----P..KDNTN....S--.......----TV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SN.PIDLRT..HWARHGTNKFVTI-s........................................
A0A199VT54_ANACO/2-173               ..............................................................................................................................idihsaqvdegepqnldg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..-KQ.....QSST.K.KAN..R..T.....A..A.K...ALRP.........KEPK.KRSSKS..AKKKE....---.......-----Sc.......................vANGK.VE.RK....SLE.HD..L....G.G....V.M...........LDL.SS.VPV.PVCSCTGVA....RRC.YRWGTGGWQSSCCTKTISEYPLPMSPSRPGSRLAGRKMSVGAYEKLLQRLAAEG.HDL.SY.AVDLKD..HWARHGTNKFVTIK.........................................
A0A6A3ARE0_HIBSY/34-187              .......................................................................................................................................iasdaaipm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........-----H..Y...P..P.P...P.....DP...STRD.E.....R....M...V.....G..R.VEEPP.AC..NEN.....VESK.K.RQG..G..A.....G..P.K...TPKE.........KKPR.K----P..KDNTN....S--.......----TI.........................QRVK.LP.KK....SMD.NK..I....N.G....Y.D...........MDI.SG.IPV.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGQKMSR--------------.---.--.------..--------------vtregrfk.................................
A0A200QZH7_9MAGN/6-217               ..........................................................................................................................................fsavfv----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.I.L...............ALS.EKKAALA.EQD................................................................MAIRQQE.QT...IS.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.K.MEQ......DN..A.L..A.A.LEY-R....................................................-........GNS---..T...V..N.S...T.....HY...NSRE.M.....H....T...N.....E..A.IPISA.LS..S--.....ESPK.P.RRG..-..R.....R..T.K...EHKDis.....snKRAL.KLSRKV..GKRG-....---.......-CND-L.........................NRCS.DP.WR....GYN.LG..L....N.H....V.Y...........FDD.SN.MPA.PVCSCTCVL....QQC.CKWGKGGWQSACCTSTLSMYPLLVVPNKRHSQLGGRKMSGSAFNKLLS------.---.--.------..--------------wclqkvmtc................................
A0A200QRR6_9MAGN/1-145               .................................................................................................................meqdnalaaleyrgnssvnsnsaptyplgcp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.-V..PRG.....TKQM.Y.HQQ..H..L.....C..H.H...SPHMai....ssnKRAL.KPSRKV..GKRG-....---.......-CKD-L.........................NRRF.DP.WR....RHN.LG..L....N.H....V.Y...........FDE.SS.MPA.PICSCTGVL....HQC.YKWRKGGWQSACCTSPLSVYLLPAVPNKRHS-----------------------.---.--.------..--------------l........................................
I1KP40_SOYBN/1-317                   ................................................................................................................................................MDDG..H..QHEnsrHKmefy..........................rgarsLWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILEIEL.E.T...............AIS.EKNEALA.ARD................................................................AAIQQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRNnsvnfpfggg................................iqcgskrmhhS........SNHLSN..M...T..E.-...A.....AY...STKD.M.....I....I...R.....D..A.SPVTV.IP..S--.....EAVN.S.HQA..-..K.....R..T.K...QNKVi.......nSKAS.KPPCKV..KKMGE....DLN......rQASSEG.........................TKIR.SE.WD....KQD.VG..L....N.L....V.A...........FDE.TI.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A200PX88_9MAGN/1-284               ................................................................................................................................................MDEK..G..GMG...IR...................................NWD-.F.SKQ.........TVS.VDAV.LK.PVS.GIP....vSG...S.T...NE...............HHHAA--.F.Lkmgm.......ypnrNSM.IPESETE.QTS................................................................VEFAG-H.CW...VH.Q....RN...............................-FL..P..A.T.K..N.S.QN....................................P.M.H.TTH......IN..T.E..T.G.LPVVP....................................................-........--TSL-..-...-..-.-...-.....GM...PIDG.S.....V....Q...N.....G..E.FGNKT.SK..IKK.....PQSS.K.KSD..K..V.....A..S.K...ALRP.........KEPK.KKPATS..TKKK-....---.......--GNSI.........................STSI.RE.KK....NLD.IV..L....D.G....S.T...........MDF.SQ.VPA.PVCSCTGVP....RQC.YRWGAGGWQSSCCTTNLSEYPLPMSSSRPGARLAGRKMSNGAYGKLLQRLAAEG.YEL.SH.AVDLKD..HWAKHGTNKFVTIK.........................................
A0A6A5MU15_LUPAL/135-394             .....................................................................................................................................lsgrdpsmfvg----..-..---...--...................................----.-.---.........---.----.--.---.-TN.....DR...D.M...RP...............FLSGRDP.-.S...............MLI.GANGNMH.PRDcvvs.......................................................ealmpMNYVR-G.GW...IS.Q....RD...............................RFF..N..L.P.P..V.T.PN....................................Y.S.V.LPE......AS..A.P..L.S.MQTIH....................................................-........------..V...P..D.-...-.....-T...SRDE.K.....V....-...-.....D..N.IEDSI.VK..KGG.....GQSK.K.RQS..R..G.....A..L.T...TPEA.........KKPR.K----P..KDNSN....---.......A---SV.........................QRVK.PV.KK....TVE.LV..I....N.G....I.D...........MDL.SG.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLEAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A2P5XDL7_GOSBA/1-282               ................................................................................................................................................MDE-..N..ALN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................evhipMNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.LLE......TP..A.A..Y.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPEA.........KKPK.K----P..KENAN....YT-.......-----V.........................QCVK.SA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SS.PIDLRS..HWARHGTNKFVTI-s........................................
A0A4P1QY16_LUPAN/1-334               ................................................................................................................................................MDDP..G..HREngrHKpdqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERSL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREssltsgsmsscppg........................cqisrgvkhihhpqQ........QVHQLH..N...M..G.D...T.....SY...GTRD.M.....H....T...T.....D..A.LPESP.IP..L--.....EAGK.P.RRA..-..K.....R..P.K...QAKSis.....pnKKIS.KTARKV..KMESE....DLNd.....iMFGKMRewksgqemf......nggddlnkqsVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PFCSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PIDLKD..HWAKHGR-------vkgl.....................................
A0A5N6NWF4_9ASTR/1-350               ................................................................................................................................................MDDN..G..HRE..nGRqkqpqgqvsfvytlvlc.fksyfhclypstnwvsyQW-L.M.QHQ.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............AIQERNL.-.-...............AMS.EKKTALA.ERD................................................................MALLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmshtnnntss...........................sscppgcqisrnvK........-----H..V...H..H.P...Q.....QY...HQED.T.....N....L...GggaggS..L.LPVSL.PP..---.....EPTK.F.RRA..-..K.....R..A.K...DVKLvt....ttsNKNS.RSSRKV..KLECD....DLNk.....aMYEDTHdwegg..............gdgelnHGSK.PE.WK....DQD.LG..L....N.Q....V.A...........YDD.TT.MPI.PVCSCTGVF....RPC.YKWGNGGWQSSCCTTTMSVYPLPSLPNKRHARVGGRKMSGSVFNKLISRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A6A3BGV6_HIBSY/149-204             ............................................................................................................................................arsh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.---------------------------QARARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARNGTNKFVTIK.........................................
A0A2R6PCM4_ACTCC/1-298               ................................................................................................................................................MDGN..S..GMN...MR...................................NWD-.F.YEPp.......mAVK.SHLG.LQ.LMS.SGA.....E-...-.-...KP...............LLGLRSH.-.Lp............dvMAD.ANSEPFN.HHMptnggpfhhg............................................vggffespmpMDY----.VW...INhN....RE...............................KYL..N..P.L.H..G.N.HRh.................................anF.S.V.LPE......TS..G.V..H.H.MQMLQ....................................................P........------..-...T..-.-...-.....ES...PKDE.S.....I....-...-.....A..R.MEETS.AE..RES....vGPLK.K.RPG..S..K.....T..P.K...SPKP.........KKAK.KAHRSP..RDDGS....---.......---GSM.........................QRAR.PL.KK....SME.VV..V....N.G....V.D...........INI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTGMSMYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLASDG.YNF.CS.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A287PD86_HORVV/21-269              .........................................................................................................................lcamrpgctprsinisisistsi----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...-N.E....L-...............................KVL..N..A.V.P..V.G.PAphighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PDEE.K.....I....T...P.....P..L.VEDHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...VPKP.........KKPK.K-DATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A4U6USA2_SETVI/2-329               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kavhtQW-M.M.PQL.........--K.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqvp....................plngtknihnhdqlshV........QTSPLQ..L...A..D.S...P.....YD...HTRE.M.....H....I...S.....E..A.YPITT.AP..SSI.....GKGK.K.PRK..-..-.....N..S.S...QASP........lKRPS.GVLRKT..KKVAG...dWKNg.....gMSGGGEds....................araSVMK.NE.WK....DQD.LG..L....N.Q....V.P...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
H1ZN52_POPTR/1-284                   ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........PVK.GNLG.LQ.LMSpTMP.....E-...-.-...KP...............FLGSRSA.A.I...............-MT.SMNGGFN.HKDvgvs.......................................................qpmhpMEYMR-G.AW...IG.Q....RE...............................KFI..N..V.L.P..G.N.HN...................................yA.A.V.FPE......TS..S.A..H.H.MQVFQ....................................................P........------..-...-..-.-...P.....YS...TKDE.P.....L....-...-.....E..L.VEEAG.VV..EKV....nGPNK.K.RQR..Q..K.....A..P.K...SPKA.........KKGK.RGPQVP..KPED-....TL-.......----SV.........................QRVR.SA.KK....TAE.IM..I....N.G....I.N...........MDI.SV.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTCISVYPLPMSMKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
D7KXV6_ARALL/1-55                    ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------MPNKRHSRVCGRKVSGIVLSRLLSRLAREG.HEL.SS.PLDLKD..YWVRHGTNRYITIK.........................................
R0HUS9_9BRAS/5-229                   ............................................................................psqnlmlsaskankdaglrtsnanwfhsyiavpnttgvdlsqvsqaspvesmmvpqsrlshpitvdyr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..--Ng...vESVE.Q.KST..N..Q....sL..S.K...ALKP.........KTPR.K-KRAT..SDKS-....---.......KKTPSI.........................PETK.RE.KK....NLD.IN..I....D.I....S.S...........FDT.SE.VPP.PVCSCTGVS....RVC.YKWGMGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLVRLAGEG.YNL.SH.PVDLKN..HWARHGTNKFVTIK.........................................
A0A2H3ZHQ5_PHODC/1-343               ................................................................................................................................................MDDG..R..HREngrHKpdqf..........................ksvhtQW-M.M.PQH.........QMK.DHQT.MK.LMA.IMA.....ER...D.S...--...............AIHERNL.-.-...............AIS.EKKAALA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARetgmngnggngcs.........................pgctaptkhhdhlpH.......vHPSPKQ..L...S..D.A...P.....YD...HERQ.V.....D....V...T.....E..A.YPIST.AV..ESA.....KGSK.V.KRM..R..K.....E..N.G...VQAIp.......tKKSS.KSPKKN..KRSGN...dDLN......rQVSI-Akfhgewkgqe....qvsdggdvnkvPVTK.HQ.WK....GQD.LG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGKF....HPC.YKWGNGGWQSSCCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5D2TZ83_GOSMU/84-131              .............................................................................................................................................awh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----------------------------------GRKMSNRACIKFVLRLTAEG.HDL.SQ.PVDLKD..HCDRHGTNNFVTIK.........................................
A0A6D2IY19_9BRAS/1-275               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.Q-NGSYH.PEP...............................................................pIHM--SY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TAp.................................nyG.N.V.LPE......TS..S.A..P.S.MQMNL....................................................-........-HHHHH..Q...T..E.E...N.....PV...KC--.-.....-....-...-.....-..-.-EEEI.VL..Q--.....--TK.K.RKP..NskA.....G..S.T...TTKA.........KK--.--PRKP..KEENG....NSN.......T---NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A2U1LDF2_ARTAN/13-183              .............................................................................................................qfttpvtssnpsqvtytvavpirsvapstepdngp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........SKTT.KNKHSK..S----....-KK.......SKKKTV.........................LKPN.TE.RK....NPN.LV..F....D.E....S.K...........FDF.SK.VPP.PVCSCTGVA....RQC.HKNGMMGWRSSCCSSGMSVFPLPMSPSRPGARVGGRKMRHSAYQKLLCKLASEG.HDL.SH.PVDLKA..HWAKLGTNNFVTIK.........................................
A0A5D2VHR1_GOSMU/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpvvs.......................................................eahipMNYVR-D.SW...IA.D....RE...............................KLF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEELP.AN..KDS.....VEPK.K.RQG..G..A.....V..P.K...MPKA.........KKPK.K----P..KENAN....---.......---SAV.........................QRVK.PA.KK....SII.FK..I....N.G....Y.E...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A1S3UNQ2_VIGRR/1-311               ....................................................................................................................................medgrqnendrh----..-..---...-Kmeyy..........................rgphsMWNT.G.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.EKNEALA.ARD................................................................EAIRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.L..A.A.LQSRNssvtfpf.....................................gsgiqcgsK........--RIHH..S...S..N.H..lC.....IM...SEAA.Y.....K....T...K.....D..A.SPITV.VP..---.....SEVK.S.HQV..-..K.....R..T.K...ENKVi.......gSKAS.KPAYKV..KKMGE....DLN......rKASFEG.........................TKIR.SE.WH....RQD.VG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVLEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
B9H4J8_POPTR/1-335                   ................................................................................................................................................MDDG..V..HREngrHKadqy..........................ktaqgQWL-.M.-QP.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............ALS.EKKAAVA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnsfasantsssppg........................yhnsrgvkhmhhqqQ........HIHLPH..M...N..E.-...G.....AY...GTRE.M.....Q....T...S.....D..A.VPISP.VA..S--.....EAAK.P.RRG..-..K.....R..P.K...DTQStp.....snKKTS.KSPMKV..KRESE....DLN......nMFGKSNewkngedmn......gggdglnkqlAASK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPA.PVCSCTGFF....RQC.YKWGNGGWQSSCCTTALSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.QDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
M4CGS2_BRARP/3-138                   .................................................................................................................................vkttldygeeetskl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......----VL.........................TGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGDL....RQC.YKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
BPC2_ARATH/1-279                     ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............-MM.GPNGSYH.HQE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TAtp................................nyG.N.V.LPE......TS..S.A..P.S.MQM--....................................................N........LHHHLQ..T...E..E.N...P.....V-...----.-.....-....-...-.....-..K.LEEEI.VV..Q--.....-TKK.R.KTN..A..K.....A..G.S...TPKA.........KKPR.K----P..KDENS....NNN......nNNNTNV.........................TRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A059CE00_EUCGR/1-323               ................................................................................................................................................MDDG..G..HREngrHKadhy..........................knaqsQW-L.M.-QH.........QPS.M---.KQ.IMG.IMA.....ER...D.A...--...............ALQERNL.-.-...............ALS.EKKAAIA.ERD................................................................IAFHQRD.MA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.Y.LER......DN..A.I..A.T.LQYREnsltsgnisscppg.......................cqisrgvkhmhhpqqQ........VHHVSS..M...S..E.-...A.....AY...GTRD.M.....H....P...S.....D..A.LPISP.VA..S--.....EATR.S.RQT..-..K.....R..T.K...EAKAms.....tsKKAP.KTPKKV..KRETD....DLN.......KLLNGDdgy..................nkpfGVPK.SD.WK....GQD.LG..L....N.Q....V.A...........FDD.ST.MPS.PVCSCTGIA....RQC.YKWGNGGWQSSCCTTTISMYPLPAVPNKRHARVGGRKMSGSAFGKLLSRLAAEG.YDL.SS.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2K1Y8J8_POPTR/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........TVK.GNLG.LQ.LMApTMP.....E-...-.-...KP...............FSGSRSA.A.I...............-MT.SMNGGFN.HRDigvs.......................................................rhmfpMEHMR-D.AS...ID.K....RE...............................KFH..H..V.F.T..G.N.HD....................................Y.DvV.FPE......TS..S.A..N.H.MQMFQ....................................................P........------..-...-..-.-...P.....NS...ANDE.T.....L....-...-.....D..Q.VEGAG.VV..EKE....nGPDK.K.KQR..P..K.....A..L.K...CLKA.........KKGK.RGPQVP..KPDGS....P--.......----SA.........................QQGK.SS.KK....TVE.IM..I....N.G....I.S...........MDI.SL.FPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTCISVHPLPMSMKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.AIDLRT..HWAKHGTNKFVTIK.........................................
A0A199UF85_ANACO/1-318               ................................................................................................................................................MDED..G..GLG...LR...................................NWG-.F.YDP.........PVK.GNLG.LQ.LSS.VAA.....ER...D.A...KKppplplpllsnggggG------.-.-...............---.--SAGFL.HRDcvvpe......................................................psvpmMDYMRDG.AG...WG.A....HHphhh......................hqhqhQ--..-..-.-.-..-.-.HHhhhhqqhpn.................yggaaaaaaaA.A.M.LPN......--..I.M..H.T.LHMMP....................................................-........APPQPQ..L...P..E.P...P....lEA...PKDE.D.....R....V...A.....P..A.LAPPM.-P..DEP.....PPSK.K.RLA..G..A.....RpsH.K...PPKP.........RKPK.KAAAFP..ESPN-....---.......---GST.........................SSSR.GK.RK....STD.MV..I....N.G....I.D...........LDI.SR.IPT.PVCSCTGAA....QQC.YRWGAGGWQSACCTTSISMYPLPMSAKRKGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A0E0QVN8_ORYRU/1-341               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aER...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppppateappsmpMNFARSD.MW...MH.P....QQqqqhh.....................hprehKAL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQLQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A444CP00_ENSVE/182-473             ....................................................................................................................................pqtagfivaslp----..-..---...--...................................----.-.---.........SSK.GNLG.LR.LMS.SIV.....EQ...D.A...KP...............LLSNAGF.I.H...............RHC.SIPEPTA.P--................................................................VDFVS-D.GW...FH.H....SNdsskndyvrd...........glmrhtnnnsKNL..H..I.L.P..T.S.NQhh................................ptY.G.V.LPE......PP..T.I..E.N.VQMLQ....................................................-........-HLELQ..S...K..D.-...-.....--...---D.K.....V....-...-.....P..-.MTDET.VV..RNE.....SPLK.K.APR..G..R.....S..Q.K...PPKP.........KNPK.K-VTAP..KDEV-....-AN.......---GSA.........................SHGK.SG.RK....STG.MV..I....N.G....I.N...........FDI.SR.IPT.PVCSCTGKQ....QQC.YRWGIGGWQSACCTTSVSMYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A6A6M7K2_HEVBR/31-228              .......................................................................................................sfysapktssihsqgtqidsqpglpvapicsvapttepakn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.NN..SGT.....KPAK.A.RKQ..K..P.....S..L.K...GSNQi.......sSKTL.K-PKQP..KKTSS....KKN.......GH--SM.........................PEAI.RE.KR....NLN.VD..I....D.R....M.N...........YDL.SG.VPS.PFCSCTGMP....RVC.YKWGAGGWQSSCCTISISEYPLPMSSTRPGARMAGRKMSNGAYVKLLLKLAAEG.HDL.SH.PVDLKE..HWARH---------vfik.....................................
BBRA_ORYSJ/1-341                     ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aER...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppppateappsmpMNFARSD.MW...MH.P....QQqqqhh.....................hprehKAL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQLQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1U8KKC4_GOSHI/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A103Y7V8_CYNCS/1-309               ................................................................................................................................................MDDG..V..HREngrHRidyy..........................kgvhpQWNM.M.PQYqm.....kdQAA.MMMN.RK.IAH.ILT.....ER...D.T...--...............AIEERDR.-.-...............ALS.EKKTALE.ERD................................................................IAIQQRD.TA...IA.D....RN...............................---..-..-.-.-..-.-.--....................................D.A.I.RER......DN..A.I..A.A.LRFQEttmntqf.....................................qrggskraH........HSNNHQ..H...H..P.A...Q.....PS...YGRD.P.....H....V...T.....E..A.FPITA.VP..G--.....EPVN.K.SKM..I..K.....E..N.K...PRGG.........GGSS.RSAKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.LG.lM....D.Q....I.N...........FDE.ST.MPI.PICSCTGVA....RQC.YKWGSGGWQSSCCTTTLSVYPLPQMPNKRHSRMGGRKMSGTVFTRLLSRLAAQG.HDL.SD.PVDLKN..YWAKHGTNRYITIK.........................................
M4D5X9_BRARP/1-287                   ...........................................................................................................................mesggqyengrynpdyykegt----..-..---...HS...................................VWNA.M.PNHhqt..kedqHNA.LVMN.QK.IMS.ILA.....ER...D.A...--...............ALKERDD.-.-...............ALA.AKQEALA.ARD................................................................EALDLRD.KA...LS.L....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DS..A.L..S.A.LQF-R....................................................E........HNLNYI..L...S..R.A...K.....LG...ASQS.S.....H....L...P.....N..P.SPLST.IP..HEA.....APSK.R.KKK..R..K.....Q..-.-...----.........----.ETRSKG..KRVGE....DH-.......VASPG-.........................KKCR.KD.WD....SNV.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RHC.YKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQG.HDL.SS.PVDLKD..YWARHGTNRYITI-m........................................
C6TF36_SOYBN/1-279                   ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GIT.....ER...D.T...KP...............FLPGRDP.-.A...............MLM.GANGTFH.PRDcavs.......................................................eapmpLNYVR-D.NW...IN.P....RD...............................RFF..N..M.QqP..T.N.PS....................................Y.A.V.LPE......TS..G.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DS...SSDE.K.....V....-...-.....D..R.VEEVA.VK..KEG.....GQSK.K.RQT..K..G.....A..L.S...TPKA.........KKPR.K----P..KDNG-....--N.......APV---.........................QRAK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPT.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A6A2Z5W0_HIBSY/1-282               ................................................................................................................................................MDED..-..VLN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMD.....ER...D.T...KP...............FIPGRDP.N.L...............-MV.TTNAAFH.PRDcvvs.......................................................eahipMNYVR-D.SW...IN.E....GD...............................KLS..S..M.L.P..A.TaPN....................................Y.G.I.LPE......TS..T.A..H.S.LPNLQ....................................................-........------..L...P..P.-...-.....DS...STRD.E.....T....V...V.....S..R.VEEPT.AS..KDG.....VQPR.K.RQD..G..S.....V..P.K...MPKA.........KKPR.K----P..KENAN....S--.......----TV.........................QRVK.PA.KK....SID.FK..I....N.G....F.N...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
U5FRS0_POPTR/5-288                   ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........PVK.GNLG.LQ.LMSpTMP.....E-...-.-...KP...............ILGSRSP.A.I...............-MT.SMNAGFY.HRDigis.......................................................qplmpMEYVK-D.AW...IG.Q....RE...............................KLL..N..V.L.P..G.N.HD...................................yA.A.V.WPE......TS..S.S..H.H.MEMFQ....................................................P........------..-...-..-.-...P.....YS...TKDE.P.....L....-...-.....E..L.VEEAG.VV..EKV....nVPNK.K.RQR..H..K.....G..P.K...SPRA.........KKGM.GGAQVP..KPEGS....---.......-P--PT.........................QRAR.AA.KK....TAE.IM..I....N.G....I.N...........MDI.SV.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTCISVYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2G3CA60_CAPCH/1-310               ................................................................................................................................................MDGN..G..GMN...IR...................................NWG-.F.LEPp......ttVLK.GNLG.LQ.LMS.SMD.....EK...P.H...FGnlrdyh...yhhqqqTHQPDHP.T.V...............MAS.TNGGAFH.HHRvcgls......................................................espmpMEYMR-D.AW...VN.H....KDy............................reKYL..N..V.L.S..A.N.HPyl................................tgY.G.F.LPE......TS..S.A..Q.S.MLMYQ....................................................-........------..-...-..-.Q...P.....NL...VKVE.T.....S....-...-.....P..L.VEEVC.QE..RDT....gGLAK.K.RGA..D..K.....SpvL.K...SPKP.........KKAK.KATTAP..KEDST....---.......-P--SL.........................PRAR.AP.RK....SAE.VN..I....N.G....I.N...........MDI.SR.IPI.PICSCTGSS....QQC.YRWGCGGWQSACCTTNLSSYPLPMNIKRRGSRIAGRKMSLGAFMKVLEKLASEG.YNF.SN.PIDLRP..HWAKHGTNKFVTIR.........................................
A0A3N7FSX5_POPTR/1-279               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNLG.LQ.LLSpTMA.....E-...-.-...KP...............FLGARSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYTR-D.VW...IG.H....RE...............................KLL..S..M.L.P..E.N.HN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...ENDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.TA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTGNP....QQS.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKH---------elih.....................................
A0A397YLH8_BRACM/1-273               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.S-A.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.-QNGSYH.HPE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.V.LPE......AS..S.A..P.S.MHHHH....................................................-........-HHQTE..D...N..P.-...-.....VK...CEE-.-.....-....-...-.....-..-.--EEE.IV..Q--.....-PNK.K.RKT..-..-.....N..S.K...ASAT.........AKGK.K-PRKP..KEEND....SKT.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
A0A2R6Q3A7_ACTCC/10-237              ........................................................................................npmisepnmeasvpyfswmnpgnffsatkvglnpfqasqmdpnpglsalpicsvtp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...-MTE.P.....I....N...N.....T..E.FETNP.TK..AKK....kKSSA.K.SPN..Q..K.....A..P.K...VLSP.........KQPQ.KKPSAS..KKSK-....---.......--RQLE.........................PGTK.VE.RK....NLN.IV..F....N.E....A.N...........LDF.SG.VPP.PYCSCTGVD....RSC.YKWGAGGWQSSCCTINISEYPLPMSSSRPGARLAGRKMSIGAYGKLLCRLGAEG.HDL.SH.PVDLKN..HWARHGTNKFVTIK.........................................
H1ZN85_TOBAC/1-333                   ................................................................................................................................................MDDS..G..NHEnarHKpp...............................qgQW--.F.MQH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKRAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnmspcppg.......................cqiahevkhmhhpqlH........VHHQPQ..L...G..E.-...P.....TF...NHSD.M.....H....M...S.....E.sS.IPLSP.AA..P--.....ELTK.S.RRN..-..K.....R..S.K...EAKEvt.....ssKRTS.KPSKKV..KKEGE....DLNk.....tMLDESQewngaqemg......ggnddvnrqlGVTK.TD.WK....DQG.RG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGDL....RPS.YKWGNGGWQSSCCTNNLSMYPLPMLPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A067KPK2_JATCU/1-337               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqgQWL-.M.-QA.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............AIS.EKKAAIA.ERD................................................................MAFIQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LDR......DS..A.I..A.T.LQYREnsltggnmsscppg.......................cqisrgvkhmhhpqqH........AQHLPH..S...S..E.-...V.....SY...GTRE.M.....Q....T...S.....D..T.VPVSP.VG..P--.....EAAK.S.RRG..-..K.....R..S.K...DAKAmp.....pnKKTS.KSPRKV..KRESE....DLTk.....vMFGKSHdwkngqdla......gggddlnkqlVVSK.SD.WK....GND.LG..L....N.Q....I.A...........FDD.ST.MPA.PVCSCTGVH....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.YDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A200PSG5_9MAGN/13-304              ....................................................................................................................................dngflrsgdnqf----..-..---...LR...................................GWGGgY.FEQs.......mKGG.GHLG.LH.LRS.PVT.....DR...D.T...KP...............FLSARNP.A.A...............VVA.TSNGGYHqHRDygvs.......................................................eshipMEFVRDG.GW...LN.Qs..qRD...............................KYL..S..G.L.P..G.N.PN....................................F.T.V.ISE......TS..G.S..H.P.LQMLQ....................................................-........------..Q...-..-.-...P.....DL...SKEE.R.....M....-...-.....V..K.VEEGA.NK..G-N.....GPLK.K.RPG..G..R.....A..Q.K...SPKP.........KKSK.R---VV..KDESN....S--.......----SV.........................QRSK.PM.KR....SMG.VV..I....N.G....I.D...........LDL.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTSISMYPLPMSNKRRGARIAGRKMSQGAFKKVLEKLATEG.YNL.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0L9UUL1_PHAAN/1-180               ....................................................................................................................................medcrqnendih----..-..---...-Kmeyy..........................rgphfMWNT.G.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............VILKLEL.E.A...............-AI.SEKNALA.AQD................................................................EAIQERD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.L..A.A.LQSRNssvtfpfg....................................sgiqcgskR........IHHSSN..H...L..-.-...C.....IM...FEAA.Y.....K....T...K.....D..A.FPITV.IP..S--.....EVVK.S.HQV..-..N.....R..A.K...ENKAi.......gP---.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------kasnlpykvk...............................
A0A2J6JNF7_LACSA/1-199               ...............................................................................................................................................m----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.-PD......TS..T.S..Q.S.IHMMP....................................................P........-APPLD..S...T..K.E...L.....RM...NLKD.L.....Q....A...P.....P..G.GSDTG.CG..G--.....GSVK.K.RGV..G..Dtv.saT..P.K...QPRA.........KKPK.KATSIP..KKTR-....---.......-----H.........................QRSK.SI.KR....NMD.VV..I....N.G....QnQ...........LRG.IW.IPI.LVCSCTGVP....QQC.YRWGTGGWQSACCTTTISMYPLLVSTKRKSARIVGRKMSQGAFKIVLEKLGSGS.YNF.AN.AIDLRA..HWAKHGTNKFVTIR.........................................
M0SVB2_MUSAM/1-284                   ................................................................................................................................................MDEG..G..QRGngrYKtdqy..........................kpshaQW-M.A.PQH.........HLK.E--N.QT.IKL.IMA.....ER...D.K...--...............ALQERDL.-.-...............AIS.EKKAALV.ERD................................................................MAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.VER......DN..A.I..A.S.LEYAR....................................................E........NGMSA-..-...S..Y.-...A.....SG...QKKD.-.....A....Q...G.....E..M.FPISA.AS..ETG....vKALK.A.KRG..G..K.....V..T.K...VQSSs.......lKKPR.KSKRVG..IGED-....-L-.......-TKQVS.........................MAKH.HE.WK....SQD.LG..L....N.Q....V.A...........YDD.TT.MPV.PVCSCTGKY....RQC.YKWGNGGWQSACCTMTLSMYPLPVMPNKRHARVGGRKMSGSAFRKLLSRLASEG.HDL.SL.PVDLRE..HWAKHGTNRYITIK.........................................
A0A2R6PIK7_ACTCC/3-187               .................................................................................................................................pkppiaavpirsvap----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...T.....T..Q.PEKST.DF..ETKp...pKVKK.K.KST..T..K.....R..S.N...QFAPrv.....weKQPK.KKPSAS..RKTK-....---.......--TQFE.........................AGIK.VE.RK....NLN.AG..S....N.E....S.K...........WDF.ST.VPP.PYCSCTGDA....RVC.YKCG-GGWQSSCCTINISEYPLPKSPTKPGARVSGRKMTSGAYGNLLHRLASEG.RDL.SH.PVDLKD..HWARLGTNNFVTIK.........................................
A0A498HKG4_MALDO/12-290              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.I...KP...............FAPGRDP.A.V...............-MV.SANGAYH.PRDcvvs.......................................................daqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN...................................yA.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....EA...SRDE.R.....V....-...-.....G..R.MEEPV.VP..KEG.....GTSK.K.RQG..G..G.....A..P.K...APKA.........KKPR.K----P..KDNAN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRS..HWAKHGTNKFVTLR.........................................
A0A1U8E0B4_CAPAN/1-313               ................................................................................................................................................MDDG..G..QRE...NKrhrmny.......................skggyaPWNV.V.PPYqm.....rdQEA.FIMN.TK.IRM.VFA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKKEALA.ERE................................................................LAIQQRD.TA...FA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFLEstmngtlsc.................................rkrgtkrpnqP........KNHCNN..N...S..D.-...S.....VC...INRD.V.....P....V...A.....D..A.FPIST.MS..S--.....DAGK.A.LQG..-..K.....R..S.K...VNKTm.......sMKSA.KFPRKT..KKVKE....DLN.......RQF-ST.........................DGSK.AE.WD....AQD.LG.sV....N.Q....I.Q...........FDE.ST.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHGRLGGRKMSGSVFSRLLTRLALAD.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
A0A1U8BID1_NELNU/1-284               ................................................................................................................................................MDEK..G..GLG...IR...................................NWN-.F.SEQ.........SVG.VDAV.LK.PVS.GVQ.....VP...G.G...--...............TSGHQTA.F.Lk............mgAYG.NRNSMIP.HADag...........................................................asaMEYAG-H.CW...VH.P....RN...............................---..-..F.L.P..V.N.KAsp...............................splQ.A.I.PLN......T-..-.D..G.G.IPVV-....................................................-........------..-...P..T.G...M.....GV...PTDG.Q....tQ....S...S.....E..FgTKSSK.IR..K-Q.....QPSA.K.KSN..R..V.....A..S.K...VLRP.........KQPK.KKPSVS..TKKKN....---.......---NSI.........................STVK.HE.KK....ILD.IV..I....D.G....T.T...........IDF.SQ.MPA.PICSCTGVA....RQC.YRWGAGGWQSSCCTTSISEYPLPMSTTRPGARMAGRKMSNGAYAKLLQRLASEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A5D2WG48_GOSMU/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREnaknfpfg....................................sgiqrgrtC........MHLSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A251SBK0_HELAN/55-352              ................................................................................................................................................MDDD..G..-LN...MR...................................NWGY.Y.EPP.........SFK.EHLG.LQ.LMS.PII....dPR...D.V...KP...............LSSSREN.P.F...............IMN.PNGLSYHyPRNsmvp.......................................................eppvpMHYSR-D.GW...IQ.-....RE...............................RIL..S..M.L.P..G.N.HN....................................F.S.V.IPD......NS..A.S..Q.S.MHMMQ....................................................P........VDCSKE..M...I..L.-...D.....DY...ATGV.G.....G....G...G.....G..G.GGDSG.GS..DGG.....QLKR.T.AAA..L..T.....T..P.K...QPRA.........KKPK.KAPAPP..LPKQ-....---.......IGNTSG.........................QRSK.SM.KR....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGVP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.AN.AIDLRA..HWAKHGTNKFVTIR.........................................
A0A2I0WW46_9ASPA/1-290               ................................................................................................................................................MDED..A..ALG...IQ...................................NWGG.Y.YRT........pPMK.GNLG.LQ.LMS.SVG.....ER...N.T...KS...............FFSGVEA.G.G...............GYL.HRECGIT.EPSt.............................................................mpMDFTR-D.MW...YH.N....NRd............................ssKML..H..V.F.Q..G.N.HHqhs..............................hnyE.A.L.LPE......-A..S.A..H.S.FQMLQ....................................................Q........VEVPRE..-...-..-.-...E.....KA...PLLE.E.....P....V...A.....P..Q.LDAEP.LK..K--.....---K.S.KGQ..G..R.....S..S.K...TLKP.........KKTK.K-AKAP..REES-....-VN.......--P--S.........................GRGR.SV.KK....SMD.MV..I....N.G....I.D...........LDL.SG.MPT.PVCTCTGQP....QQC.YRWGAGGWQSACCTTSISLYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.EDF.SS.PIDLKL..FWAKHGTNKFVTIR.........................................
A0A4U5QLD9_POPAL/1-317               ................................................................................................................................................MEDG..G..QHQngrYKidyyk........................tahphpPWNM.M.PRNqv....keqTNA.LVMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............AFA.EKKEALV.ARD................................................................EAIQQRE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYQEnamnyplsgg................................sqrgskriphP........VYHSSD..M...S..E.-...-.....AL...DSGE.M.....H....V...T.....N..A.LPISS.VP..A--.....ENAK.S.RQT..-..K.....R..S.K...ENKAv.......gLKAA.KSTWKG..NRVSE....DLN.......KQGASD........................gKKIK.VE.WD....SQD.VG..L....N.L....I.N...........FDE.TT.MTA.PVCSCTGVP....RQC.YKWGSGGWQSACCTTTVSSYPLPQMPNKRRARVGGRKMSGNVFTRLLSRLAAEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A0K9R5U0_SPIOL/1-309               .........................................................................................................................................mqqpqsm----..-..---...--...................................----.-.---.........---.----.KH.MMS.IMA.....ER...D.A...--...............AIQERNM.-.-...............AIN.EKNKALE.ERD................................................................MAFMQRD.TA...MQ.E....RN...............................---..-..-.-.-..-.-.--....................................E.A.L.MER......DN..A.L..A.T.LQYRQnsinggsnscppgc........................qisrgvkhmhhpqqH........IQHPPH..V...G..E.-...V.....SY...DGRE.V.....Q....V...P.....D..A.LPLTS.VA..P--.....ESAK.S.RKV..-..K.....R..P.K...DPNAas.....pnKKTS.KTGRKA..KREGD....DLNk.....iMFSKSQewkgmqdm........gdhdgykqmGAPK.SD.WK....GPD.LG..L....N.Q....V.A...........FDE.ST.MPP.PVCSCTGVY....RQC.YKWGNGGWQSSCCTTTISVYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAADG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A368QQ32_SETIT/2-329               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kavhtQW-M.M.PQL.........--K.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqvp....................plngtknihnhdqlshV........QTSPLQ..L...A..D.S...P.....YD...HTRE.M.....H....I...S.....E..A.YPIAT.AP..SSI.....GKGK.K.PRK..-..-.....N..S.S...QASP........lKRPS.GVLRKT..KKVAG...dWKNg.....gMSGGGEds....................araSVMK.NE.WK....DQD.LG..L....N.Q....V.P...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A0S3RAS6_PHAAN/1-337               ................................................................................................................................................MDDA..G..HREngrHKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREtsigsgsmsscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...P.....SY...STRE.M.....H....T...T.....D..A.LPAAP.IT..S--.....EAGK.S.RRA..-..K.....R..P.K...EPKSts.....pnKKTP.KAAKKV..KKESE....DLNk.....vMFGKAHewkngqemv......nggddlnkqlVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....KQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A251L2F5_MANES/1-310               ................................................................................................................................................MDDG..G..QHQsgrYKid...............................yyKWSL.M.PPPhl....keqNNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIQERNM.-.-...............ALA.EKKEALD.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREndvnfamnne................................sqrglkriphP........VYKSNA..V...V..-.-...E.....AL...NSGE.T.....H....I...T.....D..T.FPIAN.VS..A--.....ESLK.L.RQT..-..K.....R..S.K...ENKPa.......sSKAS.KAPRKG..NKVAE....DLN.......REGASD........................gKKFK.VE.WD....SQD.AG..L....N.L....V.N...........FDE.TT.IPV.PVCSCTGAP....HQC.YKWGNGGWQSSCCTTTMSSYPLPQMPNKRHARIGGRKMSGSVFRKLLGRLAAEG.HDL.ST.PLDLKE..YWARHGTNRYITIK.........................................
A0A397YJF4_BRACM/1-285               ...............................................................................................................................mesggqydngrykpdyy----..-..---...-Kgt..............................ppsVWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............ALKERNE.-.-...............ALA.AKKEALA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......ET..A.L..N.A.LHYPE....................................................-........-KNNLN..Y...I..L.-...-.....SC...AKRG.G.....T....-...-.....-..-.-EGRS.HP..PRP.....PPVS.P.IPA..-..-.....-..-.-...DKNP.........TKRK.KETKQG..KKVGD....DLN......rLAASPG.........................KKCR.KD.WD....VNE.VG..L....N.L....V.A...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGSGGWQSSCCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGEG.QDL.SS.PVDLKD..YWARHGTNRYITIK.........................................
M0RQS4_MUSAM/1-270                   ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.Y.YEP.........SSK.GNLG.LR.LMS.STV.....EQ...D.A...KP...............LLSNAGF.-.I...............H-R.HCSIPEP.TAP................................................................VDFMS-D.GW...FH.H....SN...............................--D..N..S.K.N..D.Y.VR....................................D.G.L.MRH.....sNN..N.S..K.N.LHIL-....................................................P........TSHQH-..-...-..-.-...-.....--...----.H.....P....T...Y.....S..V.LPEPP.TI..EN-.....SPLK.K.TPR..S..S.....A..Q.K...PPKT.........KKPK.K-VTAP..KDEV-....-AN.......---GSA.........................SHGK.SG.RK....STG.MV..I....N.G....I.N...........FDM.SR.IPT.PVCSCTGKQ....QQC.YRWGIGGWQSACCTTSVSIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A5A7VPX9_CUCME/13-292              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP........sFKG.NHLG.LQ.LMS.TIS.....ER...D.M...KH...............FLPGRDP.S.V...............-MV.NANGSFH.PRDcvvs.......................................................eapvhMNYVR-D.NW...GG.N....RD...............................RFL..N..M.L.P..A.N.HS....................................Y.P.V.MPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....-S...SSRD.E.....I....A...A.....S..R.VEEPP.VK..KEG.....GKAK.K.RQS..S..E.....A.gP.K...TPKA.........KKPR.K----P..KDTST....AV-.......------.........................QRVK.PP.KK....NID.LV..I....N.G....I.D...........MDI.SC.IPI.PVCSCTGAP....HQC.YRWGCGGWQSACCTTNISTYPLPMSDKRRGARIAGRKMSQGAFKKVLEKLAADG.YNF.AN.PIDLRT..HWARHGTNKFVTI-s........................................
A0A0S3R114_PHAAN/60-338              ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............YLPARDP.A.V...............-LM.GANGTFH.PRDcvvs.......................................................eapmpLNYVR-D.NW...TS.Q....RE...............................RYF..S..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..V.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.IEELV.VK..KEG.....GQSK.K.RQT..K..G.....A..L.T...TPKA.........KKPR.K----P..KDNG-....--N.......VPV---.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A2R6VWT1_MARPO/2-290               ......................................................................................................................................qlsmhhtdaa----..-..---...--...................................----.-.---.........---.---V.RK.LIT.MIA.....ER...D.A...--...............AILERNS.A.Iae..........kvaARE.ERDTALL.QRD................................................................MAYADRD.SA...IE.E....RD...............................AAV..A..A.L.E..I.A.MT...................................dR.N.I.LEK......RV..A.T..K.D.SKLFQ....................................................Sfs....mtKNCTLL..G...A..I.Q...P.....SS...LSTS.R.....F....S...S.....I..V.AEQSD.LC..R-N.....GSSK.E.DQV..G..L.....S..R.K...RKIVvkst.ldrtLRTK.RSYLSA..NEER-....-GH.......EIGDGE.........................ETDH.YA.RS....KEE.IY..-....-.-....-.-...........VEN.VR.YPI.PHCSCTGVK....QQC.YRWGNGGWQSSCCTTMISMYPLPMNPTKRGSRLAGRKMSAGAFEKLLEKLALEG.VNV.NY.PVDLKD..HWAKHGTNRYVTLR.........................................
A0A0D9XHC1_9ORYZ/1-338               ................................................................................................................................................MDDD..G..NIT...LR...................................GWGG.F.YEPp.......pPPP.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSASPF.M.H...............HHA.HQHVPHH.QHHarecggaggngga.....................................pnggmppteapsmnMNFVRND.MW...MH.P....QHhs..........................retKVL..H..T.L.N..V.G.HGghivhs.......................ahhdpvgY.G.M.IPG......TH..S.G..H.T.LQMMQ....................................................Q........PEPQPQ..P...Q..P.-...P.....PP...PKEE.C.....I....S...S.....P..L.IEENV.PV..ISE....pPPPK.K.RRQ..G..R.....Q..P.K...VPRP.........KKPK.K-PATP..REDG-....---.......APNPPA.........................PRRW.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A0Q3FA07_BRADI/1-333               ................................................................................................................................................MDDD..G..SLG...MR...................................NWG-.F.FDP.........PTR.NNLG.LQ.LMS.SMPa...dRR...D.T...KQ...............LLSTGPY.-.V...............HQH.HHVHPHA.PQHthhhphphphprdgc..................................ggvssgapgdstyipVNFVRNE.AW...LH.Q....AHhp..........................repKIL..H..A.I.T..A.G.HSghvvha.......................ahheqagY.G.I.IPG......TH..G.M..H.T.LQMMQ....................................................K........--AEPQ..P...P..P.-...-.....-P...PKDE.C.....I....S...P.....P..L.VEENA.GV..VNE....lPPPK.K.KQQ..R..R.....Q..P.K...SPKP.........KKPK.K-ANAP..CEDG-....---.......VPKPA-.........................PRKR.GP.KK....HVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCTCTGAQ....QQC.YRWGAGGWQSACCTTTISTYPLPMNTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1J7I8B8_LUPAN/1-335               ................................................................................................................................................MDDP..G..HREngrHKpdqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREnslttgsmsacppg.......................cqisrgvkhmhhpqqQ........VHHLHN..M...G..D.-...A.....SY...GTQE.M.....T....T...T.....D..A.LPEAP.IP..S--.....EAGK.S.RRA..-..K.....R..P.K...EAKSp.......nKKAS.KTARKV..KMESE....DLNg.....mMFGKTHewkssqevf......nggddlnkqsVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKKHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A1U7YND6_NICSY/1-333               ................................................................................................................................................MDDS..G..HHEnarHKpp...............................qgQW--.F.MQH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKRAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnmspcppg.......................cqiahevkhmhhpqlH........VHHQPQ..L...G..E.-...P.....TF...NHSD.M.....H....M...S.....E.sS.IPLSP.AA..P--.....ELTK.S.RRN..-..K.....R..S.K...EAKAvt.....ssKRTS.KPSKKV..KKEGE....DLNk.....tMLDESQewngaqemg......ggnddvnrqlGVTK.TD.WK....DQG.RG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGDL....RPS.YKWGNGGWQSSCCTNNLSMYPLPMLPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A022PZW2_ERYGU/1-42                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-------------------------------------MSGSAFNKLISRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2I4E7H8_JUGRE/1-315               ................................................................................................................................................MDDG..R..QHEngrHKldyy..........................rgshsPWNM.V.PQHqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.S...--...............AIRERNA.-.-...............ALS.EKNEALA.ARD................................................................EALRQRD.EA...FA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LQV-Rdnamnfplgg................................giqrgskrmhH.......lSNHLVT..M...A..E.-...A.....PY...NTKE.A.....Q....I...T.....D..A.FPITV.IA..S--.....EAVK.S.HQV..-..K.....R..T.K...ENKAi.......sSKPL.KSPRKG..KKVGE....DLN......rQAASDG.........................TKYR.SE.WD....SQD.VG..L....N.L....V.T...........FDE.SS.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTRLSMYPLPQMPNKRHARVGGRKMSGSVFTRLLSRLAAEG.HDL.SL.PLDLKD..YWARHGTNRYITIK.........................................
A0A6A2ZN91_HIBSY/30-250              ....................................................................................................................hpnicsalsadvavfafayishlgvgss----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......-N..S.L..I.A.MKM-R....................................................S........FSDENM..M...P..E.T...-.....EI...GSTG.N.....K....S...D.....W..E.TKTTQ.VG..KQK.....SAVK.G.SNQ..-..I.....A..S.K...VLGP.........KQLL.KKPSVP..KKAK-....---.......--GPNI.........................PEAK.RE.KK....NLD.FD..L....D.G....T.K...........FDF.SG.VPS.PICFCTDVA....RVC.YKWGASGWQSSCCTINISECPVPMSPTRPGARVAGRKMTKGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWGRHGANKLVTIK.........................................
A0A2R6RBR4_ACTCC/1-301               ................................................................................................................................................MDDG..G..QRDharHRmdyy..........................kgvhiPWNT.M.PQYqm.....neANA.IFMN.KR.IMH.IIA.....EK...D.A...--...............AVEEMNK.-.-...............AIA.EKNVALE.ERN................................................................EAFKQRD.DA...IT.A....RD...............................---..-..-.-.-..-.-.--....................................T.A.V.RER......DS..A.I..A.A.LRFQE....................................................Nsm...ngiLGYGIQ..R...G..T.K...R.....AH...QPTN.Y.....H....P...A.....P..A.AEF--.PI..ASD.....EIVK.S.RQA..K..R.....A..K.G...KNNNv.......sPTVS.KSLKKG..KKVGE....DLN.......REV-TT.........................NGSK.AE.WD....AQD.LD.lI....N.Q....I.N...........FDE.SS.IAA.PVCSCTGKP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARMGGRKMSGSVFTRLLTRLASDG.HDL.SI.PLDLKK..FWAKHGTNRYITIK.........................................
A0A5D2ZZZ0_GOSMU/27-306              ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPARDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appipMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPD......TS..T.T..H.S.MPIWQ....................................................P........------..-...P..L.P...P.....DA...STRD.E.....R....V...V.....G..R.VEEPP.AS..KEG.....VQSK.K.RQG..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IA..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
D7LHX4_ARALL/4-226                   .........................................................................................fpsqnlmlsatnankgaglrtsnahwlhsciavpkttgidlsqanpaegvmvpqs----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....H..L.FPPPT.RD..SRNd...mETVK.Q.KSV..N..Q.....S.pL.K...SLKP.........NPPR.KKRSAS..NKSKK....T--.......-----Ls.......................iPETK.RE.KK....NLD.IN..I....D.I....S.S...........FDT.SG.VPP.PVCSCTGVS....RVC.YKWGMGGWQSSCCTISISTYPLPMSTTRPRVRLAGRKMSNGAYVKLLARLAGEG.YNL.SH.PVDLKN..HWARHGTNKFVTIK.........................................
H1ZN83_TOBAC/1-282                   ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGMYH.SRDsivpe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.N.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMVQ....................................................-........------..Q...P..D.-...-.....--...VTED.V.....R....-...-.....V..N.AEEPS.VK..NES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKLK.KGSSVP..KENGN....PR-.......-----V.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YSF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2I0AKJ2_9ASPA/62-352              ................................................................................................................................................MDDD..G..ALG...NQ...................................NWGG.Y.FRP........pPIK.GNLG.LQ.LMS.SVA.....ER...D.A...KS...............FISGSAG.-.-...............GGG.RGGRGFF.HREcgvle......................................................psamsVDFVR-D.VW...YH.N....NRdg...........................ggKML..H..V.F.Q..G.N.HQqls..............................hhyG.A.L.LPE......TS..S.V.pA.A.FQMME....................................................-........------..-...-..-.Q...V.....EA...PMEE.K.....V....-...-.....P..V.VEESV.PV..K--.....--KR.S.KGQ..G..R.....P..S.K...ASRP.........NKTK.K-ANAT..RDGS-....-A-.......---NPS.........................AKVR.SV.KK....KMD.MV..I....N.G....I.D...........LDL.SG.MPA.PVCTCTGQG....QQC.YRWGAGGWQSACCTTIISMYPLPMSTKRRGTRIAGRKMSQGAFKKVLEKLAGEG.QDF.SS.PIDLKP..FWAKHGTNKFVTIR.........................................
A0A453IJI2_AEGTS/1-227               ..............................................................................................................................................sr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....EQ...............................KVL..H..A.V.P..L.G.PPghighpgh....................avhhhptdF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PLVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A397Z737_BRACM/1-262               .........................................................................................................................................mmpqhqi----..-..---...--...................................----.-.KEQ.........HNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKERNE.-.-...............ALA.AKQEALA.ARD................................................................EALQQRD.LA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......EN..A.L..T.A.LQH-R....................................................-........ENHLNY..I...L..D.-...-.....-C...AKRG.G.....Y....Q...T.....C..F.TEETH.LP..NPS.....PLST.-.--I..P..H.....E..P.P...NTKR.........KKDR.K---RK..KAGGE....DLN......rQLASPG.........................KKCR.KD.WD....CND.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEG.HDL.SS.PVDLKD..YWARHGTNRYIIIK.........................................
A0A4S8ICK5_MUSBA/1-280               ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.Y.YEP.........PSK.GNLG.LR.LMS.SMV.....ER...N.A...KP...............LLSNGGF.-.I...............-HR.HCSFPEP.SVS................................................................MDFMR-D.GW...SQ.Q....GNd............................ssKSF..H..T.F.P..V.R.HQhp................................psY.G.V.LPD......PP..N.V..H.N.IQMLQ....................................................-........------..H...P..E.-...-.....PQ...PKDD.K.....V....-...-.....-..L.MAEDT.TG..KNE.....PPLK.K.RPR..G..C.....L..Q.K...SSKP.........KRPK.K-VTAP..SDEV-....---.......-PNGSV.........................SRGK.AA.RK....STG.MI..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGKP....QPC.YRWGVGGWQSACCTTNMSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A565B0P1_9BRAS/118-264             ...................................................................................................................................drrhcsvgqsdap----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.----KV..KRERKl..kDSN.......VPR--M.........................QRER.SPlRK....SIN.MV..I....N.G....V.C...........MDI.GC.LPV.PVCSCTGIP....QPC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARISGRKMSQGAFRKVLEKLSTNG.FNF.SN.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A5A7QJP1_STRAF/1-287               ................................................................................................................................................MDGN..G..NMN...LR...................................NWGF.L.DTPa......stLKN.HHLG.LQ.LMP.SIS.....EKplfD.T...AG...............AHSHTDS.N.P...............TAS.TNGGPFH.PHRi.............................................................teSHIPMDY.YW...VN.Q....NH..............................eKYL..N..I.I.S..G.Y.YLp..................................sC.G.I.SPE......TP..-.-..Q.P.ITNPP....................................................K........HDKIAS..E...T..D.-...P.....TS...EKRE.K.....S....-...-.....-..-.-----.--..HFG.....PAAK.K.RAR..-..-.....G..P.T...SNQA.........QAQA.QKEKKK..KPRT-....--K.......AP-RAP.........................RDGP.GP.KK....QAE.IE..I....N.G....I.H...........MNV.SD.IPT.PVCSCTGTP....EKC.YRWGSGGWQSACCTTKLSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLTREG.YNF.SS.PIDLRS..YWAKHGTNKFVTIR.........................................
A0A2G3D804_CAPCH/2-301               ........................................................................................................................................kdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RNaliq......................erddaI--..-..-.-.-..-.-.-Aalrlq.........................dsstndN.N.M.VPDspgngtES..G.A..K.H.IYI--....................................................-........---QQQ..M...H..R.T...I.....AE...AAHG.S.....M....K...D.....P..T.AGYLK.DT..N-T.....SEAK.V.PKK..V..R.....R..P.K...ESRH.........NKQA.KIPRVS..KNGAE....SLN.......MQVIATtsddwanl........qemdsdkdgDTQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQG.YDL.SI.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A2G2YE13_CAPAN/4-120               .........................................................................................................................tiveaahgstkdpttgylkdtdt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....SEAK.V.PKK..V..R.....R..P.K...ESRH.........NKQA.KIPRVG..KNGAE....SLS.......MQVIATtsddwanl........lemdsdkeaDTQL.TS.WK....-DN.LR..L....N.Q....I.N...........FDE.SI.MLV.LVCSYTGTP....Q--.------------------------------------------------------.---.--.------..--------------p........................................
A0A5C7HIZ4_9ROSI/176-455             ................................................................................................................................................MDDD..A..-LN...MR...................................NWGY.Y.EPT.........YKG.GHLG.LQ.LMS.TMA.....DR...D.T...KP...............FLPGRDP.S.V...............-MV.STNGAYH.PRDcmvs.......................................................easipMNYARGDsNW...IN.T....RD...............................KYL..M..L.P.P..N.-.-N....................................Y.G.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........------..-...-..P.-...-.....PN...TTRD.D.....R....V...V.....P..R.VEEPV.VK..TEG.....AQVK.K.RQG..G..G.....A..P.K...TPKA.........KKAR.K----P..KDSGV....A--.......-----V.........................QRSK.PP.KK....SMD.MV..I....N.G....I.D...........MDL.SS.IAI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.DN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A2C9VYP5_MANES/1-345               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqsQWL-.M.-QA.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnsltsgnmsscppgcqia...............rgvkhmhhpqqhahnvphsS........AHNVPH..S...S..E.-...P.....SY...GTRE.M.....Q....A...N.....D..T.LPMSP.VG..S--.....EAAK.S.RRG..-..K.....R..S.K...DTKVtt.....pnKKTS.KSPRKV..KRENE....DLNk.....rTFDKPHewkneqdmt......gggddlnkqlVASK.SD.WK....GQD.LG..L....N.Q....I.A...........FDE.ST.MPA.PVCSCTGVF....RQC.YKWGNGGWQSSCCTTSISMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.YDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A6A3CD06_HIBSY/1-309               ................................................................................................................................................MDGA..G..KQE...IGrykldq.......................yrgappPWNV.M.PQHhm....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.Y.IER......DN..A.L..A.V.LQCQEnamsfpig....................................sviqrgrtR........MHPLYH..S...T..D.M...G.....ET...LHCE.K.....H....V...T.....D..A.IPLST.IT..SEG.....KSCP.V.---..-..K.....R..T.K...VNKA.........SSPK.P-PRKI..KKLAE....GLN......rSAGTEV.........................RKCK.SE.WN....GQD.IG..L....N.M....V.N...........FDE.TT.MPV.PVCTCTGVP....RHC.YKWGSGGWQSSCCTTTMSSYPLPQLPNKRHARVGGRKMSGSVFTKLLSRLAAEG.QDL.SI.PLDLKT..YWARHGTNRYITIK.........................................
A0A1U8NC14_GOSHI/40-234              ...........................................................................................................slqrtgihhepglvvspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---PSI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
M0RWT5_MUSAM/1-126                   ................................................................................................................................................MDDV..G..QREngrHKtdqy..........................rtahaQW-M.L.PQH.........QLK.E--N.QT.IKL.LMA.....ER...E.K...--...............ALQERDM.-.-...............AIT.EKKAALV.ERD................................................................MAYLQRD.AA...VA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.IER......DN..A.I..G.A.LEYAR....................................................E........-NGMSG..N...C..A.-...T.....GK...QTRE.T.....P....T...N.....E..A.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------spdsggs..................................
A0A453QIV9_AEGTS/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.IER......DN..A.L..A.A.LELARtngfnmnngtgfnpg.....................slngaknfhhqdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A2I0B9A4_9ASPA/12-77               .....................................................................................................................................rlcvhalehnn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------NAKRKGARIAGRKMSQGAFAKVLEKLAGEG.HQF.KD.PIDLKL..FWAKHGTNKFVTIR.........................................
A0A3B6HR63_WHEAT/1-348               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.-.Lqh...........hnALH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqqqhqhhhqnq..hqqqhqhqhqhsreqKVL..H..A.V.P..L.G.PAghighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A5A7QYU7_STRAF/1-266               ................................................................................................................................................MDEI..G..QRE...NKrhrtdc.......................fkstprNPVS.Q.YQP.........-KE.QNAF.MK.IIT.LCD.....ER...D.A...--...............AFKERDR.-.-...............ALA.EKKAALD.ERD................................................................TAIHQRD.SA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.RER......DN..A.I..A.A.LQFHE....................................................-........------..-...-..-.-...-.....--...----.T.....T....F...S.....T..I.FNTIG.SR..G--.....--PK.P.RPK..-..-.....P..N.K...KNLG.........KSTS.-QLKKS..RKVGE....DLN.......RQVT-S.........................DWSK.AK.WD....AKE.LG.sF....D.P....I.P...........FDE.ST.MAP.PVCSCTGVP....RQC.YKWGNGGWQSACCTTSLSVYPLPQMPNKKHSRMGGRKMSAGVFSRLLTRLASAG.HDL.SV.AVDLRS..YWAKHGTNRYITIK.........................................
A0A0E0EVC4_9ORYZ/1-238               ............................................................................................................................................mwmh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................---MQQQ.HH...HH.P....RE..............................pKVL..H..T.L.S..V.G.HGghiah.........................hdhpvgY.G.M.MPA......TH..T.L..R.M.LQHQP....................................................E........PQPQLQ..H...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..K-P.....PPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDGA....PP-.......--SAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.RICSCTGAP....QQC.YRWGAGGWQSACCTTTVSTYPLLMSMKRRGARIAGRKMSHGAFKKVLEKLASEV.YNL.NN.PIDLKT..FWAKHGTNK-----e........................................
W9R7S8_9ROSA/1-312                   ................................................................................................................................................MDDS..R..QHEtgrHKveyy..........................rgahsPWNM.M.TQHqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNV.-.-...............ALS.EKNEALA.ERD................................................................EALRQRD.QA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.I..A.A.LQIRNnsmnmpvsg.................................vqrgvkrihhP........SNHLAN..M...T..E.-...A.....TY...SSKE.M.....Q....I...T.....D..A.FPITV.IS..S--.....EAIK.S.GQA..-..K.....R..T.K...ENKA.........MSSK.EPKPPR..KKVAE....DLNr.....rASSD-G.........................IKYR.TE.WD....SQD.VG..L....N.L....I.T...........FDE.SS.MPV.PVCSCTGVH....RQC.YKWGSGGWQSSCCTTNMSMYPLPQIPNKRHARMGGRKMSGGVFTRLLSRLAAQG.HDL.SI.PLDLRE..YWAKHGTNRYITIK.........................................
A0A6A3AFT5_HIBSY/29-268              .....................................................................ltklnqviamkmrsyldknsmsetnigsadspfswlyhynptskpglsslhrrhepglvvspirticsttesgnk----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....N..D.WETKI.TQvgKQK.....SSVK.G.SNQ..-..I.....A..S.K...VLGP.........KQPI.KKPSVP..KKAKG....---.......---PNI.........................PEAK.RE.KN....NLN.VD..L....D.R....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLGAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A0D3CUW8_BRAOL/1-339               ................................................................................................................................................MDDG..G..HRDngrHKtp...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..S.A.LQYREnsmatpsavsnmaavcp.................pgcqmprgvkhihhpqmhH........QHHMLQ..L...S..D.-...-.....-H...AYDE.S.....R....E...M.....D..G.LPTSP.PP..ETA....lDSAK.P.KRG..G..K.....R..V.K...DPKAttk..ttanKRGP.KNPRKV..KKENE...dDLTk.....iMFVKTLdygeee.............tsklvlTGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGDL....RQC.YKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0K9PCF2_ZOSMR/109-276             ........................................................................................................................phlpdpsstidkpkpspsllpgrr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..R.....G..F.K...SSNS.........KKPK.KKPHLE..GEESG....---.......---NNN.........................GRCG.RR.KK....NTE.VV..I....N.G....I.D...........LDI.GG.IPT.PVCTCTGTP....QPC.YRWGAGGWQSACCTNNLSTYPLPMNSKRRGARIAGRKMSQGAFKKVLEKLTTEG.CDL.STvQIDLKS..YWAKHGTNKFVTIR.........................................
A0A1R3K7R1_9ROSI/2-278               ...........................................................................................................................................mpqhh----..-..---...--...................................----.M.KEQ.........NNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.EKKEALA.ARD................................................................EALLERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................G.A.L.MER......DN..A.L..A.V.LQYRKnamnfp........................................mqrgvkR........MHPTYH..-...-..-.S...T.....DV...GEDG.E.....H....V...T.....D..A.LPVST.IA..S--.....-EEG.N.RCS..V..K.....H..T.K...ENKV.........VSS-.KPPRKV..KKVAE....DLN......rQAVTEV.........................KKCK.SE.WN....GQD.VG..L....N.L....I.N...........FDE.TR.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLISRLAAEG.QDL.SI.PLDLKN..YWARHGTNRYITIK.........................................
A0A5J5AIA9_9ASTE/1-253               ....................................................................................................................................mvsdhnvmlsan----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............---GRDH.T.V...............-MM.SANGAFH.PRDcmvs.......................................................eapvhLDYVR-D.SW...IN.H....RE...............................KYL..N..M.L.P..G.N.PN....................................F.V.V.HPE......PS..G.T..H.P.MQILQ....................................................P........------..-...H..D.-...-.....--...LSKD.V.....R....-...-.....A..G.MEDPG.GR..KEG.....GPLK.K.RAG..G..S.....T..P.K...APKM.........KKAK.KGPSVP..KDNGN....S--.......----SV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLATEG.YDF.AN.PIDLRA..HWAKHGTNKFVTIR.........................................
A0A4U6VRZ8_SETVI/1-341               ................................................................................................................................................MDDD..G..NLS...IR...................................NWG-.F.YDT.........-MK.GNLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPTGAF.L.Qhh..........ghhNAP.HQLHSHH.SRDsgggggasg.............................................gmptephsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghgghp...........ghgghavhhhptgY.G.M.MPD......--..A.P..H.T.LQMMQ....................................................P.......qLPSQPQ..E...-..-.-...P.....PP...CKED.H.....V....P...T.....P..P.VEDHS.VV..RTE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-PAVP..REDG-....---.......AVNGHA.........................PRGR.GP.RK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGTP....QQC.YRWGAGGWQSACCTTSISTYPLPMNAKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A5A7RIJ6_STRAF/195-325             ................................................................................................................................................MDDS..S..HREngrHKpp...............................qgQWL-.M.-RH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AVS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................I.A.I.IER......GN..A.I..A.T.LQY-R....................................................E........N-----..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------alivascecyvhlhvrhsrrlpeghvrfqrgqqainnvnt.
A0A5B6V2N9_9ROSI/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpvvs.......................................................eahipMNYVR-D.SW...IA.D....RE...............................KFF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...G.....S..S.VEELP.AN..KDS.....VEPK.K.RQG..G..A.....V..P.K...MPKA.........KKSK.K----P..KENAN....S--.......----AV.........................QHVK.PA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTI-s........................................
A0A5N5KN19_9ROSI/88-135              .............................................................................................................................................vqq----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----------------------------------GRKMSSGAFKKVLEKVAGEG.CDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
I1H191_BRADI/1-327                   ................................................................................................................................................MDNI..G..HREngrQRpdqy..........................kglhtQW-M.I.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.N...--...............AIMERDH.-.-...............ALA.EKKAALA.ERD................................................................MAFAQRE.SA...MV.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnvnngngfpag.....................slsgtknfhhhdqlshA........QSSPRQ..L...A..D.S...P.....YD...HSKE.M.....H....I...S.....E..A.YPISI.AS..G--.....NAGK.I.KRS..-..K.....K..N.S...SPPM.........KRPS.GVLRKT..KKATG....DWRd....vgMSGGGEdp....................areSVMK.NE.WK....DQD.LG..L....N.Q....V.A...........YDE.SS.MPA.PSCSCTGKL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAGEG.HDL.ST.SVDLKD..HWAKHGTNRYITIR.........................................
M0SRV2_MUSAM/53-346                  ................................................................................................................................................MDEI..G..HREngrHKndqy..........................ktahaQW-M.M.PHH.........QLK.E--N.QT.IKL.LMA.....ER...E.K...--...............ALQERDM.-.-...............AIS.EKKAALA.ERD................................................................TAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DD..A.I..A.A.LEYAR....................................................Enc...msnNSAPQQ..L...H..D.A...P.....NN...QTRE.T.....P....R...S.....E..A.FHNSG.GP..ETL....gKLIK.T.KRS..R..K.....K..T.E...VEASs.......sKKMT.KFPRKS..KKVGE....DLN.......KVS---.........................SLKH.HE.WK....SQD.LG..L....N.Q....V.T...........FDD.SS.MPA.PVCSCTGRY....QQC.YKWGNGGWQSACCTMTLSMYPLPVLPNKRHARVAGRKMSGSAFRKLLSRLAAEG.HDL.SL.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1S2YEV7_CICAR/1-308               ....................................................................................................................................mnddreyengrh----..-..---...-Kmeyy..........................rgahsLWNT.D.PQHqv.....keQNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.EKNEALA.ARD................................................................AALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.LER......DN..A.L..A.A.LQS-Rsnsvnfpf...................................nggskrmhhS........SNHLSD..M...T..E.-...A.....AY...GSKD.I.....I....I...R.....D..A.SPVTV.IT..S--.....EAVK.S.HLA..-..K.....R..S.K...GNKV.........SKP-.--PTKV..KKMGE....DLNr.....kAYS-EG.........................TKIK.SE.WD....RQD.VG..L....N.L....V.A...........FDE.TI.MPV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEG.HDV.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A068UB08_COFCA/1-282               ................................................................................................................................................MDDD..G..-LN...MR...................................NWGY.Y.EPS.........SLK.GNLA.LQ.LMS.SVA.....DR...D.T...KP...............FLSGRDS.G.V...............-MG.AANGVYH.PRDylis.......................................................gapdhMDYVR-D.SW...IN.H....RD...............................KFV..H..M.F.P..G.N.PY....................................N.T.V.LPE......TS..G.T..H.Q.MQMLQ....................................................-........------..Q...P..E.P...-.....--...SKDA.R.....-....-...-.....V..S.VEDVG.VR..KEP.....GPAK.K.RAA..V..S.....V..P.K...TPKS.........KKPK.KNPAVP..KENGS....S--.......----SG.........................QRSK.AV.KK....SMD.VV..I....N.G....I.D...........LDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRS..HWAKHGTNKFVTIR.........................................
M5VNL8_PRUPE/20-330                  ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A5J5B1H7_9ASTE/1-275               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.--MN.KR.IMH.IIA.....ER...D.A...--...............AVEERNR.-.-...............AIS.EKNAALD.ERD................................................................AAIQQRD.TA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.I.RER......DN..A.I..A.A.LQFQEstmnstlgcg................................iqrgtkrmhqP........TNHPAN..V...A..E.-...A.....SY...KTRE.P.....H....I...T.....D..A.FPISA.IS..S--.....EAVK.S.RQA..-..K.....R..T.K...ENKAv.......pSKTS.KSPRKG..KKVGE....DLN.......RHVT-T.........................AGSK.AE.WD....AQD.LG.sM....N.Q....V.N...........FDE.AT.MQT.PICSCTGVP....RQC.YKWGNGGWQSSCCTTTLSVYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAVDG.HDL.SM.PLDLKN..YWAKHGTNRYITI-n........................................
A0A0K9PBT5_ZOSMR/24-232              ..........................................................................................mnscnqgksssglpegstdrtstinvawvpqrnflpsippstetknnrnallgn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..--D.....KQTT.N.QLK..K..R.....S..S.V...TNNN.........KKKK.K--KKK..KEEED....DA-.......-SS-AT.........................FTGK.RE.KR....NLD.LV..V...gE.G....V.S...........FDF.SG.VPT.PICSCTGVS....RQC.YKWGAGGWQSSCCTTTISEYPLPMSTSRPGSRLAGRKMSNGAYGKLLHRLAMEG.CDL.KD.AIDLKN..HWARHGTNKFVTIR.........................................
A0A0D2S501_GOSRA/1-253               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.-MV.....ER...D.A...KS...............FIPSRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................eahtpMNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.HPE......TS..A.A..Y.S.LPILR....................................................-........------..-...S..-.P...P.....YS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KDG.....VEPK.K.RQG..G..A.....A..P.K...MPKA.........KKPK.K----P..KENAN....S--.......----TV.........................QRVK.SA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A2U1KTK9_ARTAN/1-298               ................................................................................................................................................MDDD..G..-LN...IR...................................NWGY.Y.EPP.........SFK.EHLG.LQ.LMS.PMI....dHR...D.T...KP...............FLSPREH.P.I...............MVN.PNGVMPY.HHNhlrnsv...................................................vnesplpMQYMR-D.GW...IQ.-....RD...............................RHH..H..M.H.P..G.N.NN....................................Y.P.L.IHD......SS..G.S..Q.S.MHMMH....................................................Q........LDPSKN..H...G..M.-...M.....ME...DSAE.C.....G....G...G.....D..S.GSGGS.--..GSG.....VQLK.R.RSG..P..Av...aN..P.K...QPRA.........KKPR.KTSSIP..KENGN....P--.......-----S.........................GRSK.TV.KR....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGVQ....QQC.YRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASES.YNF.AN.AIDLRL..HWAKHGTNKFVTIR.........................................
V7ARX6_PHAVU/1-337                   ................................................................................................................................................MDDA..G..HREngrHKadqf..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.F..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...P.....SY...NTRE.M.....H....T...T.....D..V.LPAAP.IT..S--.....EAGK.S.RRA..-..K.....R..P.K...EPKSts.....pnKKTT.KAAKKV..KKESE....DLNk.....vMFGKAHewkngqemv......nggddlnkqlAVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....KQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
M4EBN7_BRARP/321-589                 ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.HPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.I.LPE......TS..S.A..P.S.MRHHQ....................................................-........------..T...T..D.-...E.....YP...GTHE.Q.....-....-...-.....-..-.VEEIV.--..Q--.....-TNK.K.RKP..-..-.....N..T.K...PGAT.........TKAK.K-PRKP..KEESD....K--.......-----S.........................IKAK.PA.KK....SVD.FV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A328D5U3_9ASTE/1-286               ........................................................................................................................................mddcergh----..-..---...-Rrermnc......................frggghpQWSM.V.SQQq......hmKEQ.NAFF.MN.MKM.FFA.....ER...D.A...--...............AIAERDR.-.-...............ALA.EKEAATE.ERD................................................................MVIRQRD.IA...FA.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.RER......DN..A.I..A.A.LHFQQ....................................................E........NNASVG..F...S..Y.Ri.cG.....TK...RANT.I.....R....V...T.....D..A.VPISA.IS..S--.....EAVK.S.QQR..-..-.....K..Q.K...QAKR.........KRTK.R----A..RDDRN....RR-.......VT---T.........................DGSK.AE.WD....ARN.QV..G....P.E....I.C...........FDE.ST.MPA.PVCTCTGVA....RQC.YKWGSGGWQSSCCTTSLSVYPLPRRPQKDRGRIAGRKMSGGVFSRLLTRLSFAGhHDL.ST.PLDLKN..YWAKHGTNRYITIK.........................................
A0A3N7FX19_POPTR/7-290               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNLG.LQ.LLSpTMA.....E-...-.-...KP...............FLGARSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYMR-D.VW...IG.H....RE...............................KLL..S..M.L.P..E.N.HN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...ENDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.TA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTGNP....QQS.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
D7LPX4_ARALL/1-280                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaSFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRES.N.L...............M-I.GSNGSYH.PRE................................................................HDMNY--.SW...IS.Qp..kDN...............................KFF..N..M.L.P..I.S.TPn..................................yG.S.V.MSE......TS..G.S..N.S.MQMIH....................................................Q........----PV..V...-..-.-...N.....SS...RFEE.I.....P....-...I.....P..P.REDEI.VQ..P--.....--SK.K.RKM..R..G.....S..I.S...TPTI.........PKAK.K-MRKP..KEERD....-VA.......SSNVQQ.........................QRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PVCTCTGTP....QQC.YRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEG.YSF.GN.AIDLKS..HWARHGTNKFVTIR.........................................
A0A4S8KEA9_MUSBA/22-367              ................................................................................................................................................MDDV..G..QREngrHKtdqy..........................rtahaQW-M.L.PQH.........QLK.E--N.QT.IKL.LMA.....ER...E.K...--...............ALQERDI.-.-...............AIT.EKKAALV.ERD................................................................MAYLQRD.AA...VA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.IER......DN..A.I..G.A.LEYARengmsgncatgchlg.....................srgtkhiynhqqqhlqH.......iHSPQQQ..L...H..D.A...P.....SK...QTRE.T.....P....T...S.....E..A.SPNSG.GS..ETG....mKFNK.A.KRS..R..K.....E..S.K...VLASs.......sKKMM.KAPRRS..KKGGS...dDLN......kQ-VTIArptgewrgei....gvgedlnkqvsLTKH.HE.WK....SQD.LG..L....N.Q....V.S...........FDD.MT.MPV.PVCSCTGKY....QQC.YKWGNGGWQSACCTTTLSMYPLPVIPNKRHARVAGRKMSGSAFRKLLSRLAAEG.YDL.SL.PVDLKD..HWAKHGTNRYITIK.........................................
A0A4S8IDC8_MUSBA/1-285               ................................................................................................................................................MDDD..GdgGLD...IR...................................NWG-.Y.YEQ.........TWK.GNLG.LH.LMS.SVV.....ER...D.T...KP...............LLSNGGF.-.L...............H-R.QCGVSEP.LVA................................................................MDVTR-D.GW...IH.Q....SGdd...........................hnKIL..H..M.L.P..V.N.HHhhh.............................ndgyY.G.A.RHD......PL..T.P..E.T.LQMWQ....................................................-........------..L...P..E.P...-.....--...PKDD.N.....F....-...-.....P..V.ID-IP.VG..ENE.....TPLK.K.RSK..G..R.....P..Q.K...FPKP.........KKSK.KVAALS..NDTT-....--N.......---GSI.........................SLGK.SC.RK....SAE.MV..I....N.G....I.S...........LNI.SG.IPT.PVCSCTGKP....QPC.YRWGAGGWQSVCCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLTEEG.HSL.SN.PIDLRS..FWAKHGTNKFVTIR.........................................
A0A2H3XVC6_PHODC/1-271               ................................................................................................................................................MDDN..G..GLG...MR...................................NWA-.Y.YEQ.........PLK.RNLG.LQ.LMS.SVA.....ER...N.A..aKP...............LLPNGGF.-.F...............-HR.DCSMPEP.PVA................................................................MEFAR-D.GW...IG.H....RE..............................nKMV..H..M.M.P..L.N.PN....................................Y.S.V.LPD......AH..G.A..Q.A.FPMLQ....................................................P........------..-...-..-.-...P.....EP...PKED.K.....I....-...-.....P..L.MDDPG.SR..K-E.....APLK.K.KAQ..-..-.....-..A.K...APKP.........KKPK.KVTAAR..NETS-....--N.......---GSV.........................SRGR.NV.RK....SLD.VV..I....N.G....I.D...........LDI.SG.IPT.PVCSCTGAR....QQC.YRWGVGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKN..YWAKHGTNKFVTIR.........................................
A0A2U1NCT7_ARTAN/2-271               ............................................................................................................................................lpqy----..-..---...--...................................--QM.K.DQN.........QNA.IQMN.RK.FMH.IIA.....ER...K.T...--...............AIEERDR.-.-...............ALS.QKKAALE.ERD................................................................MAIQQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................D.A.I.RER......NN..A.I..A.A.LHFHE....................................................-........-ATMNP..Q...P..Q.R...G.....AK...RTHH.H.....H....T...Q.....P..S.YMREP.RV..TEA.....FPLT.A.VQA..E..P.....V..N.R...SKIT.........TKET.KSRKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.FG.lV....E.Q....I.S...........FDQ.LT.MPI.PICSCTGVA....RQC.YKWGSGGWQSSCCTTTISVYPLPQMPNKRHSRMGGRKMSGSVFTRLLSRLASQG.HDL.SS.PIDLRT..YWAKHGTNRYITIK.........................................
A0A1S3CSG1_CUCME/1-280               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP........sFKG.NHLG.LQ.LMS.TIS.....ER...D.M...KH...............FLPGRDP.S.V...............-MV.NANGSFH.PRDcvvs.......................................................eapvhMNYVR-D.NW...GG.N....RD...............................RFL..N..M.L.P..A.N.HS....................................Y.P.V.MPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....-S...SSRD.E.....I....A...A.....S..R.VEEPP.VK..KEG.....GKAK.K.RQS..S..E.....A.gP.K...TPKA.........KKPR.K----P..KDTST....AV-.......------.........................QRVK.PP.KK....NID.LV..I....N.G....I.D...........MDI.SC.IPI.PVCSCTGAP....HQC.YRWGCGGWQSACCTTNISTYPLPMSDKRRGARIAGRKMSQGAFKKVLEKLAADG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A151RRJ6_CAJCA/92-262              ........................................................................................................................................llerdnal----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..AAL.....QTVK.S.HQT..-..K.....K..T.K...DNKVi.......nSKAS.KTPCKV..KKMGE....DLN......rQASSEG.........................TKIR.SE.WD....RQD.VG..L....N.L....V.A...........FDE.TI.MPV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A6A5MCX1_LUPAL/62-334              ........................................................................................................................smfisvndrdskpflsgrdpsmfv----..-..---...--...................................----.-.---.........---.----.--.---.GVN.....DR...D.V...KP...............LLPGRDP.S.-...............MFI.GANGTMH.PRDcvvs.......................................................eapmsMNYVR-D.GW...IS.L....RD...............................RFF..N..M.P.P..V.T.PD....................................N.A.V.LPE......SS..A.P..S.T.MQTTQ....................................................-........------..L...P..D.-...-.....-T...SRNE.K.....V....-...-.....D..S.IEDSV.VK..K-V.....GQSK.K.RQS..T..G.....V..L.T...SPKA.........KKLR.K----P..KDNSD....AS-.......-----V.........................QHVK.PI.KK....TKE.LL..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMNVKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.VN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A2R6R3J7_ACTCC/1-314               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW-L.L.HQ-.........-PS.M---.KQ.IMA.VMA.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................LAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MAR......DT..A.I..V.T.IQYREnamtrgnmspqcppg......................cqishgvkhmhhpqqN........LNHQPH..M...G..E.V...-.....PH...DSGD.M.....H....T...S.....D..G.LSMSP.VA..S--.....EPAK.P.RQT..-..K.....Q..T.K...EAKPst.....psKKPS.KTSKKV..KREED....LSK.......MILGKSc......................ggDVSK.PD.WK....GQD.LG..L....N.Q....V.S...........FDE.TM.MPG.PVCSCTGIR....RPC.YKWGNGGWQSSCCTTTMSMYPLPALPNKRHARVGGRKMSGSAFSKLLSRVAGEG.YDL.SI.PVDLKD..HWARHGTNRYITIK.........................................
A0A446RJA1_TRITD/5-326               ......................................................................................................................................leecgsydsc----..-..--S...MF...................................QW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngigfnpg.....................slngaknfhhhdqqphA........QSSPLQ..L...A..D.S...P.....YD...HTRE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agISG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A3B6I1C6_WHEAT/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngigfnpg.....................slngaknfhhhdqqphA........QSSPLQ..L...A..D.S...P.....YD...HTRE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A5N5L5G5_9ROSI/5-283               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SYK.EPLG.LQ.LMP.AMV.....DR...D.S...KH...............LLPRRDP.N.N...............IMI.GANGAYL.PRDsvvs.......................................................dapmhLSYMR-D.SW...MN.-....RE...............................KFL..N..M.L.P..Q.N.PN....................................Y.V.A.LPE......TS..G.A..Q.S.MSMLQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....S..R.IEEPS.VS..NEG.....SQLK.K.RQV..G..G....tA..P.K...LPKP.........KKPR.K----P..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNISIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A445KV51_GLYSO/192-550             ................................................................................................................................................MDDA..G..HREngrHKaadqyksaqgqhvlp....akkgtdfdnicldvalQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...A.....SY...STRE.M.....H....T...T.....D..A.LPAAP.IP..S--.....EAGK.P.RRA..-..K.....R..P.K...EPKSas.....pnKKTS.KPAKKV..KKESE....DLNk.....vMFGKSHewksgqemv......nggddlnkqlTVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDD.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1S3CSF6_CUCME/1-277               ...............................................................................................................................................m-DGD..-..ALN...MR...................................NWG-.Y.YEP.........SLK.AHLG.LQ.LVS.TIG.....ER...D.V...KH...............FMPGRDP.-.S...............AIV.NMNAAFH.PRDsvvs.......................................................eapvsTNWAR-D.GW...MN.Q....RD...............................KLF..N..V.L.S..P.N.TS....................................Y.S.L.LAE......TS..A.A..Q.P.LQMLQ....................................................P........------..-...-..-.-...L.....DT...SRDE.M.....V....-...-.....L..K.IEEPP.VK..KGT.....KQPK.K.RQN..G..G.....A..P.K...SPKP.........KKPR.K----P..KSNDP....---.......----SF.........................QQVK.AP.KK....KME.LV..I....N.G....F.D...........MDI.SS.IPI.PVCSCTGTP....HQC.YRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A2G2ZGY4_CAPAN/10-292              ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEQ.........SLR.GNLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGVFH.SRDsiipe......................................................aplshIDYVR-D.GW...IN.H....RE...............................KFL..N..M.F.P..G.S.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMIQ....................................................Q........------..-...P..D.A...-.....--...-TKD.V.....G....-...V.....N..A.EEPPS.VR..KES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKSK.KASSVP..KENGN....---.......---PSV.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.TG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A4U6T8X6_SETVI/1-359               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KP...............LLPNGGN.F.Lqhhghh..naphqhqHQH.HTQHPHH.PRGggggsgaps.............................................gmpteppavhMDFVRNE.AW...LH.P....SQhhhqhhh................qhqhprqpKVL..H..H.L.P..V.G.PAghaghpghg.................ghavhhhptgY.G.M.MAD......AH..G.V..H.T.LQMMQ....................................................Pqa...qqqPQPQPQ..P...Q..D.-...P.....PP...PKEE.S.....M....P...Q.....P..L.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGTP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A199V3D0_ANACO/1-246               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MS.SVA.....EH...E.K...KQ...............LFSNGGF.-.L...............-QR.DYSAPET.FAP................................................................IEFLK-N.SW...PN.Y....RE..............................aKMP..Q..M.M.P..T.N.PS....................................Y.D.L.LPS......AN..G.A..H.S.FQIMQ....................................................A........------..-...-..-.-...P.....SP...PKDD.N.....V....A...-.....-..P.MNEPQ.A-..TND.....KPPK.K.RSR..A..R.....P..E.S...ASKP.........RKPK.K-APVP..KEER-....KV-.......--N-SN.........................PRVR.NG.RK....SAD.IV..I....N.G....I.D...........LDL.SG.LPT.PVCSCTGAP....QQC.YRWGVGGWQSACCTTSISVYPLPMSTKRRGSRIAGRKMSQGAFRKVLEKLAGEG.YNL.NN.PIDLRA..YWAKHGTNKFVTIR.........................................
A0A0A0KJH7_CUCSA/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TIS.....ER...D.M...KH...............FLPGRDP.S.V...............-MV.NANGSFH.PRDcvvs.......................................................eapvhMNYVR-D.NW...GG.N....RD...............................RFL..N..M.L.P..T.N.HS....................................Y.P.V.MPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....-S...SSRD.E.....I....A...A.....S..R.VEEPP.VK..KEG.....GKAK.K.RQS..S..-.....-..E.A...GPKA.........PKAK.K-PRKP..KDTST....AV-.......------.........................QRVK.PP.KK....NID.LV..I....N.G....I.D...........MDI.SC.IPI.PVCSCTGAP....HQC.YRWGCGGWQSACCTTNISTYPLPMSDKRRGARIAGRKMSQGAFKKVLEKLAADG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
V4M1G3_EUTSA/1-291                   ....................................................................................................................................menggqyengry----..-..---...-Kpdhlk.........................gaqstMWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVQERNQ.-.-...............AVS.AKREAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DT..A.F..A.A.LQHHE....................................................Nsln.falsGGKQRY..D...V..D.-...D.....GF...SFGE.T.....H....K...P.....D..V.FPITT.IP..AEK.....----.-.---..-..-.....-..-.K...VSKR.........KK--.QGQAKG..KKVGE....DLN......rGVAAPG.........................KKSR.TD.WD....SND.VG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAAEG.YEL.SC.PVDLKD..YWARHGTNRYITIK.........................................
A0A2G2YPY1_CAPAN/2-301               ........................................................................................................................................kdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RNali........................qerdD--..-..-.-.-..-.A.IAalrlq.........................dsstndN.N.M.VPD......SP..G.N..G.T.ESGAK....................................................H........IYNQQQ..M...H..R.T...I.....AE...AAHG.S.....M....K...D.....P..T.AGYLK.DT..D-T.....SEAK.V.PKK..V..R.....R..P.K...ESRH.........NKQA.KIPRVS..KNGAE....SLN.......MQVIATtsddwanl........qemdsdkdgDTQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQG.YDL.SI.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A0E0IP29_ORYNI/1-342               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A200R2H5_9MAGN/1-85                ...............................................................................................................................................m----..-..---...--...................................----.-.---.........---.----.-K.FMT.ILA.....DR...D.T...--...............VIQERNL.-.-...............ALS.EKNAALA.EGD................................................................TAILQQD.QA...IF.K....WN...............................---..-..-.-.-..-.-.--....................................S.A.M.MEK......DN..A.L..A.A.LEY-R....................................................G........-NSSVN..S...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------nsaptyplgcpvprgt.........................
A0A1S4AUE2_TOBAC/1-274               ................................................................................................................................................MDDG..G..RRE...SRrhrmdc.......................skgghaPWNV.V.PPYqm.....kdQEA.FIMN.TK.IRM.LCA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKNTVLA.ERD................................................................LAIQQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LLF-Q....................................................E........----ST..M...N..G.-...-.....--...-TLG.C.....R....-...-.....-..-.--TRG.TK..RPN.....QIAK.A.LQV..-..-.....-..-.-...-KRT.........KGNK.GMSRKT..KKVNE....DLN.......RHLT-T.........................DGSK.AE.WD....AQD.LG.sI....N.Q....I.K...........FDE.SS.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVG.HDL.SL.PIDLKT..YWAKHGTNRYITIK.........................................
M0T639_MUSAM/1-118                   ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.F.YEP.........PMK.GNLG.LR.LMP.SVM.....ER...D.A...KP...............LLSSGGF.M.Rrqcgip...epsvppNFV.R------.--Dgwrhh.....................................................gndsskNDLLR-D.GW...IH.H....NSd............................ndKNF..H..I.F.P..V.N.HQhh................................pgY.G.V.L--......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------tmeangak.................................
D7KVR8_ARALL/95-265                  ..................................................................................................................nvptnasrmthpmqpevvgevdeslkrrhc----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........SGGQ.RGPLKV..KKEKKl..kDNN.......MPRVQR.........................ERSP.LL.RK....SVE.MV..I....N.G....V.S...........MDI.GG.LPV.PVCSCTGMP....QQC.YRWGCGGWQSACCTTNVSVYPLPISTKRRGARIAGRKMSQGAFRKVLEKLSSDG.FDF.SN.PIDLKS..HWAKHGTNKFVT--.........................................
A0A4D9ARJ6_SALSN/3-323               ............................................................................................................................ekklrgwtsrlvlllmmdhn----..-..---...--...................................----.-.---.........---.-HLTiKT.FMA.ITA.....DR...D.A...--...............AIREKNM.-.-...............ALE.ERKRAFQ.ERD................................................................MAMLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.M.QER......DE..A.I..A.S.LLYREssmndntdipdsye.......................nelasggkriiqyqqQqq....mrVSEVAG..Y...S..P.K...G.....NL...RGNE.I.....V....I...A.....E..T.AETPK.PR..R-G.....RQTK.E.KEG..-..E.....A..T.K...SARPsr.....agKRAA.EAVIKE..EVNSD....AYN.......-----Gwsneqg.............ldsdeeNLDK.QV.SW....KDN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGSP....QPC.YRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFNKLLNRLAAEG.YDF.SS.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A251T2N6_HELAN/1-120               ................................................................................................................................................----..-..---...MR...................................NWGY.Y.EPP.........SFK.EHLG.LQ.LMS.PMV....dHR...D.P...KP...............FLSAREN.P.I...............MVN.PNVSTYH.HPHtrvvs......................................................eppgpMNYMR-D.GW...IQ.-....RE...............................RLL..H..M.S.H..P.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------ihmvppldmckdpvlnnnnnmsvednvvvskdiggs.....
A0A2G3AFR7_CAPAN/2-215               ................................................................................................................................asqvnhkeetfdshfp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........RMHQVN..F...T..P.-...A.....TK...FGSE.S.....K....P...C.....A..A.VPIRS.VA..PTG....eQNVN.A.KFK..A..K.....S..Q.K...IKKN.........MPPM.KGIRET..VSKLL....KVE.......RPENKSs......................asKKTK.GE.SR....CGE.AT..VtkkpK.S....VaS...........ADF.SG.LPP.PFCSCTGVS....RKC.YKCG-GGWQSSCCTTSLSEYPLPWNPSKPGYRLTGRKMSNGAYNKLLFTLATEG.CDL.SN.PVDLKN..HWAKHGSNKFTTIK.........................................
V4TA25_9ROSI/61-395                  ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A4D8Z0T1_SALSN/1-302               ................................................................................................................................................MDNS..G..HHEngrHKap..............................qqgQWL-.M.-HH.........QPS.M---.KQ.IMA.IMT.....ER...D.A...--...............AIQEKNL.-.-...............AIS.EKKAALA.ERD................................................................MAIMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.I..A.T.LQYREnainnngnispcppg.....................cqiprgvkhmhhpqhqH........VHHQPH..M...V..E.-...A.....PY...TSRE.I.....Q....I...P.....D..A.VPVSP.EP..A--.....KPSR.T.KRV..K..E.....A..K.Q...AAPA.........RKAP.KPTKKI..KQEED....---.......------.........................DFTK.SE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSPCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLGRLAAEG.IDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
V4TFC0_9ROSI/1-335                   ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0L9UU47_PHAAN/135-228             ....................................................................................................................................kasnlpykhqvk----..-..---...--...................................----.-.-E-.........PNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............VILKLEL.E.A...............A-I.SEKNALA.AQD................................................................EAIQERD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LEQ......DN..S.L..T.T.LQS--....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------qnsyvtfpfgsg.............................
A0A0E0B769_9ORYZ/1-331               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppspateappsmpMNFARSD.MW...MH.P....QQqqqhh.....................hprehKAL..H..N.L.T..V.G.HV...................................gY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A498J8T5_MALDO/1-339               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HN.........QPS.M---.KQ.VMA.IMS.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DS..A.I..A.T.LHY-Rdnslnsgnvsscppgc....................qisrgvkhmhhtqqqqH........VHHMPH..M...N..E.-...A.....SY...GTRD.M.....H....T...S.....D..S.ITMPP.ET..S--.....APTK.S.RQP..-..K.....R..P.R...EPKTtq.....pnKKPS.KSPRKM..KRESE....DLNk.....mTFDKLHdwkggqdmg......gegddlnkqvVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PMCSCTGLL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLTAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2K1Y8J9_POPTR/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNLG.LQ.LLSpTMA.....E-...-.-...KP...............FLGARSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYTR-D.VW...IG.H....RE...............................KLL..S..M.L.P..E.N.HN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...ENDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.TA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTGNP....QQS.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A5E4GAZ6_PRUDU/20-330              ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARE................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....DTVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDD.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A1U8MSE2_GOSHI/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.LQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREnaknfpfg....................................sgiqrgrtC........MHLSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A1E5UQI0_9POAL/1-294               ...............................................................................................................................................m----..-..---...--...................................----.-.---.........---.----.-N.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqgp....................plngtknihhhdqlshV........QTSPLQ..L...A..D.S...P.....YD...HTRE.V.....H....I...S.....E..A.YPIAT.AP..GSI.....GKGK.K.PRK..N..S.....-..-.S...QASPlkrp.sgvlRKTK.KPASEW..KSGGM....SVG.......R----Eds....................vraSVMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A444F7W4_ENSVE/1-315               ...........................................................................................................................................mkdhp----..-..---...--...................................----.-.---.........---.---A.LK.IIA.LIA.....ER...D.S...--...............AIQERDL.-.-...............AIS.EKTAALA.ELD................................................................MALKERD.AA...FA.K....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LRYAReksyngyneqgccswc....................tpplwtshshqdahldV........HESSPQ..L...A..D.A...P.....YD...HIRQ.M.....H....I...T.....E..A.YPISM.VP..DYS....eKEMK.A.KKI..-..T.....S..T.Q...TTPH.........KRPL.KSPRKS..KKGHG...dDSNk....lvS--RAKkhgklkgqei.....vggkkdlnefPTMT.DT.WG....NCN.MG..F....N.E....F.S...........VNE.LS.VPA.PVCSCTGKL....RQC.YRWGDFGWQSSCCTSSLSMYPLPVMPNRRHARMGGRKMSGSAFRKLLRCLAADG.YDL.SM.TVDLKN..HWAKHGTNRYITIR.........................................
A0A4P1RW76_LUPAN/70-337              .............................................................................................................................andrdskpflsgrdpsmfv----..-..---...--...................................----.-.---.........---.----.--.---.GVN.....DR...D.M...KP...............FLPGRDP.S.-...............MFI.GANGTMH.PRDcvvs.......................................................dapmsMNYVS-D.GW...IS.L....RD...............................RFF..N..M.P.P..V.T.PD....................................N.A.V.LPE......SS..V.P..S.T.LQTTQ....................................................-........------..L...P..D.-...-.....-I...SRNE.K.....V....-...-.....D..S.VEDSV.VK..K-V.....GQPK.K.RQS..R..G.....V..I.A...SPKA.........KKPR.K----P..KVNS-....--N.......A---SV.........................QRVK.PV.KK....TKE.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMNVKRRGARIAGRKMSLGAFKKVLEKLAAEG.YNF.VN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A0D3DUK0_BRAOL/1-300               ................................................................................................................................................MDDG..G..HRDngwHKas...............................hgKW-M.M.QQHq.......pQQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..A.A.LQF-R....................................................D........SSMSTS..R...Q..H.Q...P.....HI...HHQQ.H.....H....M...L.....Q..V.TENAY.ET..RETetsppPPTK.P.KRG..-..R.....K..A.K...EPKApa.....anKRGP.KTQRKV..KKENE...dDLTk.....lMFDEEA.........................TGSK.SD.WR....SQEtVG..L....N.R....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2I0JB64_PUNGR/1-298               ................................................................................................................................................MDGD..N..GLN...MR...................................NWG-.Y.YDAgp....agpSLR.SHLP.LQ.LMS.TMP.....E-...-.-...KP...............LLDTRAG.L.M...............GPS.SGGPFQH.HRDigvs.......................................................hgmfpMDFMR-D.PW...IS.N....RE...............................KFP..N..L.L.P..V.N.HN....................................Y.S.M.IPE......TSstA.Q..H.H.MQMVQ....................................................P........SDLVKE..E...R..-.-...G.....AM...TQVD.E.....V....-...-.....-..G.IEMEN.NV..N-G.....PSKK.R.QQG..P..K.....A..Q.K...SPKP.........KKAK.KGPRVP..KPETA....VAT.......--TPSG.........................PRAR.TV.KK....TTE.VM..I....N.G....I.N...........MDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGLSMYPLPMSTKRRGARIAGRKMSLGAFKKVLEKHAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
M0ZVN7_SOLTU/1-285                   ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.-MA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................ALI..Q..E.R.N..D.A.IAalrlq.........................dsstndN.N.M.VPD......SP..G.N..G.T.ESGAK....................................................H........IYNQQQ..MyrtT..A.E...A.....AH...GSME.D.....P....S...A.....G..Y.LKDTD.T-..---.....SEAK.I.PKK..V..K.....R..P.K...ESRH.........NKQA.KIPRVG..KIGTD....NLS.......MQVIATtsddwanl........qemdsdkegDTQL.TS.WK....D-N.LG..-....F.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQG.YDL.SI.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A0E0IP33_ORYNI/5-234               ......................................................................................................................................paateappsm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.--P................................................................MNFVRND.IW...MH.P....QQ...............................---..-..-.-.-..-.-.-Q....................................H.H.H.HPR......--..E.P..K.M.MQHQP....................................................E........PQPQPQ..P...P..P.S...P.....PH...PKEE.C.....I....S...L.....P..L.MEENV.PV..ISE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDGA....PP-.......--SAPA.........................PRRR.GP.MK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.SICSCTGAP....QQC.YRWGAGGWQSACCTTTVSTYPLPMSTKRHGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A103XB59_CYNCS/1-176               ................................................................................................................................................MDDG..G..HREngrQKqp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............AIQERNL.-.-...............AMS.EKKTALA.ERD................................................................MALLQRD.SA...VA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnntss.............................scppgcqisrnvK........-----H..V...H..H.P...Q.....QY...QQEE.MgggggS....G...G.....R..G.VDPLP.VS..PAA....pEPAK.S.RRT..-..K.....R..T.K...DMKS.........VTDK.KTSRAS..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------rk.......................................
A0A1S3XFH8_TOBAC/1-186               ............................................................................................................................................mqih----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..E.Q...P.....NL...VKVE.P.....D....-...-.....P..Q.LEEVC.LE..RDI....gGLAK.K.RGA..G..K.....SqlL.K...SPKS.........KKAK.KATRIP..KVEST....---.......-P--SV.........................PRAR.AP.RK....SAE.VV..I....N.G....I.T...........MDI.SV.IPI.PVCSCTGVAqxaaQQC.YRWGCGGWQSACCTTNLSSYPLPMNTKRRGSRIAGRKMSLGAFTKVLEKLASEG.YNF.SN.AIDLKP..YWAKHGTNKFVTIR.........................................
A0A078FIC2_BRANA/60-195              ................................................................................................................................................MDED..G..-LS...NR...................................NWGY.Y.DQS.........QFR.PSLG.FQ.LIP.SIV.....DR...N.E...KQ...............FLFPQNP.N.FittnngycgggssssNVM.SFPRDYT.ASD................................................................APFMS-Y.SW...LN.Q....HRd.............................sKFF..N..N.L.P..N.N.PS....................................N.H.H.TLL......DP..R.A..Q.P.MQLLQ....................................................F........PKPEA-..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------gevdeslkrrqc.............................
A0A2U1NCW0_ARTAN/1-296               ................................................................................................................................................MDDN..G..HHEvvrHRidyy..........................kevhpQWNM.L.PQYqmk...dqnQNA.IQMN.RK.FMH.IIA.....ER...K.T...--...............AIEERDR.-.-...............ALS.QKKAALE.ERD................................................................MAIQQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................D.A.I.RER......NN..A.I..A.A.LHFHE....................................................-........-ATMNP..Q...P..Q.R...G.....AK...RTHH.H.....H....T...Q.....P..S.YMREP.RV..TEA.....FPLT.A.VQA..E..P.....V..N.R...SKIT.........TKET.KSRKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.FG.lV....E.Q....I.S...........FDQ.LT.MPI.PICSCTGVA....RQC.YKWGSGGWQSSCCTTTISVYPLPQMPNKRHSRMGGRKMSGSVFTRLLSRLASQG.HDL.SS.PIDLRT..YWAKHGTNRYITIK.........................................
A0A2G3B897_CAPCH/2-91                ...........................................................................................................................rrtiveaahgstkdpttgylk----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....D..T.D...TSEA.........KVPK.KVIATT..SDDWA...nLLE.......MDSDKE.........................ADTQ.LT.SW....KDN.LR..L....N.Q....I.N...........FDE.SI.MLV.LVCSYTGTP....Q--.------------------------------------------------------.---.--.------..--------------p........................................
A0A2I4G898_JUGRE/14-293              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TMA.....DR...D.T...KH...............FLPGRDPnS.I...............MVN.TANGTFH.PRDcvvs.......................................................eapvpMNYVR-D.SW...AN.Q....RD...............................KFL..N..M.L.P..A.N.PN....................................Y.G.V.LPE......TS..G.A..H.S.LQILQ....................................................P........-----Q..D...P..-.-...-.....SM...--DE.R.....M....-...-.....V..K.VEEPL.VK..SEG.....GQMK.K.RQS..G..G.....A..P.K...TPRA.........KKPR.K----P..RDNNN....---.......---PSV.........................QRVK.PV.KK....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAADG.YNF.SN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A6A2W8T4_HIBSY/1-336               ................................................................................................................................................MDDG..G..HREngrIKtdqy..........................raaqgQW-L.M.HQP.........--S.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslssgnmssclag.......................fhmsrgvkhmqhphqN........IHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....S...T.....D..T.LPVMP.GT..S--.....EAAK.S.RRG..-..K.....R..A.K...EAKVia.....pnKKAS.KPPKKV..KQETE....NLNk.....iMSGKSHewkgaqdvg......gasddfnkqlVTTK.PD.WT....GKD.LG..L....N.Q....V.V...........FNE.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTALSMYPLPAVPNKKHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
M5XDN6_PRUPE/1-278                   ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FVPGRDP.A.V...............-MV.SSNGAFH.PRDcvvs.......................................................dapvpLNYMR-D.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....A..R.IEEPV.AN..KEG.....GPSK.K.RGG..G..G.....A..P.K...TPKV.........KKPR.K----P..KDNNN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAS....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRG..HWARHGTNKFVTIR.........................................
A0A2U1P1U4_ARTAN/1-296               ................................................................................................................................................MDDN..G..HHEvvrHRidyy..........................kdvhpQWNM.M.PQYqmk...dqnQNA.IQMN.RK.FMH.IIA.....ER...K.T...--...............AIEERDR.-.-...............ALS.QKKAALE.ERD................................................................MAIQQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................D.A.I.RER......NN..A.I..A.A.LHFHE....................................................-........-ATMNP..Q...P..Q.R...G.....AK...RTHH.H.....H....T...Q.....P..S.YMREP.RV..TEA.....FPLT.A.VQA..E..P.....V..N.R...SKIT.........TKET.KSRKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.FG.lV....E.Q....I.S...........FDQ.LT.MPI.PICSCTGVA....RQC.YKWGSGGWQSSCCTTTISVYPLPQMPNKRHSRMGGRKMSGSVFTRLLSRLASQG.HDL.SS.PIDLRT..YWAKHGTNRYITIK.........................................
A0A5D2W6H1_GOSMU/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqH........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A0E0EVC1_9ORYZ/1-42                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-------------------------------------MSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A4P1R340_LUPAN/1-306               ..................................................................................................................................mdggrqhencrqki----..-..---...-Eyyr............................gahsPWNM.D.AQHqhe..vkepNNA.LVMN.KK.IRS.IIA.....ER...Q.A...--...............VILELEL.E.A...............AIS.EKNEALA.ARD................................................................LALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DI..A.L..A.A.LQNRNntvn............................................lslgG........VQCGSK..R...T..H.Q...A.....AY...STKD.M.....P....I...R.....D..A.APVTV.IT..A--.....EAVK.S.RQA..-..K.....R..S.K...ENKV.........SNSK.A-SKSP..TKLGE....DLN......rHASSQG.........................TKIK.SE.WD....KLD.VG..L....N.L....V.A...........FDE.TT.MPA.PVCTCTGVP....RQC.YKWGSGGWQSSCCTNTLSMYPLPQLPNKRHTRIGGRKMSGSVFTRLLSRLASEG.HDL.SI.RLDLKS..YWARHGTNRYITIK.........................................
A0A443P953_9MAGN/1-283               ................................................................................................................................................MDGK..G..GLG...IR...................................NWN-.F.SDQ.........ASS.VNSV.FK.TIS.DCR.....VH...D.G...--...............AILDGSS.-.-...............GVS.EHQHAYM.KMSaftnrs....................................................smvpeaAEF---T.DW...VH.Q....RN...............................-FL..S..A.T.K..A.S.SIpi................................haD.E.V.NPD......MD..D.L..A.D.MNMVL....................................................-........------..G...-..-.-...-.....--...TPVD.T.....P....Q...N.....G..E.LETKP.SK..IKK.....HPSA.K.KSN..H..V.....S..S.K...VLKP.........KEPK.KKTSPS..TKKQ-....---.......--SSSL.........................ATAK.RE.KK....NPD.IV..L....D.G....T.A...........LDF.SH.VPT.PMCSCTGVI....RQC.YRWGAGGWQSSCCTTCISEYPLPMSSSRPGARMAGRKMSNGAYLKLLQRLTAEG.HDL.SH.PVDLKN..HWARHGTNKFVTIR.........................................
A0A0S3QXT1_PHAAN/1-312               ....................................................................................................................................medgrqnendrh----..-..---...-Kmeyy..........................rgphsMWNT.G.SQHqv.....kePNA.LVMN.KK.IRS.ILA.....ER...Q.A...--...............TILELEL.E.A...............AIS.EKNEALA.ARD................................................................EAIRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.L..A.A.LQSRNssvtfpfg....................................sgiqcgskR........IHHSSN..-...-..H.L...C.....IM...SEAA.Y.....K....T...K.....D..A.SPITV.IP..S--.....EVVK.S.HQA..-..K.....R..T.K...ENKVi.......gSKAS.NPPYKV..KKMGE....DLN......rKASFEG.........................TKIR.SE.WH....RQD.VG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVLEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A078HW26_BRANA/1-287               ...........................................................................................................................mesggqyengrynpdyykegt----..-..---...HS...................................VWNA.M.PNHhqt..kedqHNA.LVMN.QK.IMS.ILA.....ER...D.A...--...............ALKERDD.-.-...............ALA.AKQEALA.VRD................................................................EALDLRD.KA...LS.L....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DS..A.L..S.A.LQF-R....................................................E........HNLNYI..L...S..R.A...K.....LG...ASQS.S.....H....L...P.....N..P.SPLST.VP..HEA.....APSK.R.K--..-..-.....-..-.K...KRKP.........ET--.--RSKG..KRVGE....DHV.......-ASPG-.........................KKCR.KD.WD....SNV.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RHC.YKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQG.HDL.SS.PVDLKD..YWARHGTNRYITI-m........................................
A0A6A3BJ17_HIBSY/104-224             .......................................................................................................................................vgriedpll----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.-P.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPV.PVCSCTGTT....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSRGAFKKVLEKLAAEK.YNF.SE.PINLRS..HWARHGTNKFVTIR.........................................
A0A251K9F6_MANES/1-314               ................................................................................................................................................MDDG..G..QPN...GRykidy........................ykaansPWTL.M.PPPql....keqNNA.LVMN.KK.IMA.ILA.....ER...D.T...--...............AIQERNI.-.-...............ALA.EKKEALA.ARD................................................................EALQERE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREnglnfpvgn..................................gnqqgskriP........HPVYNS..N...A..V.A...G.....AI...NSGE.M.....H....I...T.....D..A.FPITT.VS..A--.....ETLK.P.RQT..-..K.....R..P.K...ENKSv.......sSKPA.KSPRKG..NKVGE....DLN.......RQGTSD........................gKKFK.VE.WD....GHD.AG..L....N.L....V.S...........FDE.TT.MPV.PVCTCTGAP....HQC.YKWGNGGWQSSCCTTTMSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLASEG.HDL.SV.PLDLKD..YWARHGTNRYITIK.........................................
A0A2I0JBN1_PUNGR/1-94                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPG.PVCSCTGEA....HPC.YKWGNGGWQSSCCTTMISMYPLPQMPNKRHARMSGRKMSGSVFTRLLTRMAKAG.HDL.SI.PVDLKD..YWARHGTNRYITIK.........................................
A0A067DHJ2_CITSI/1-311               ................................................................................................................................................MDDG..H..HEN...GRykmey........................ykgthaQWNM.M.PQHqm....kepNNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIRERNI.-.-...............ALT.EKREALE.TRD................................................................QALEERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................D.A.L.MAR......DS..A.L..A.A.LQYREaaanfssv...................................ggfqrggkrM........HHPTYQ..S...G..D.V...P....eAL...NSGD.M.....H....A...T.....D..A.KPITI.IP..S--.....-ETK.P.HQA..-..K.....R..A.K...ENKI........vTKPS.VSPRKV..KKVGE....DLN......kKVASDG.........................KKIK.SE.WD....SQD.-G..L....N.L....V.N...........FDE.TT.MPV.PVCTCTGTP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.HDL.SV.PLDLKN..FWAKHGTNRYITIK.........................................
A0A2H5NS32_CITUN/86-418              ............................................................................................................................ckrfayeilclltilslmlp----..-..---...--...................................QWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2P6PQ67_ROSCH/1-310               ................................................................................................................................................MDDG..R..QHEngrHKqdyy..........................rgapsPWNM.T.AQQqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.S...--...............AIRERNA.-.-...............AIS.EKNEAFA.ARD................................................................EALRQRD.EA...FA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.L.MER......DN..A.F..A.A.FHI-Rdnsmnfplgg................................vqrgskrmhyP........SNHPVN..M...A..D.-...D.....PY...STKD.V.....P....I...T.....E..A.FPISV.LS..A--.....EAIK.S.RQT..-..K.....R..S.K...ENKA.........SKAS.K--ASR..KKVGE....DLN......rQASTDG.........................IKYR.SE.WD....TQD.LG..L....N.L....V.S...........FDE.TT.MPV.PVCSCTGMP....RQC.YKWGNGGWQSSCCTTNMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAAEG.HDL.SV.PLDLKE..YWARHGTNRYITIK.........................................
A0A1U8INQ5_GOSHI/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpvvs.......................................................eahipMNYVR-D.SW...IA.D....RE...............................KLF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LSILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEELP.AN..KDS.....VEPK.K.RQG..G..A.....V..P.K...MPKA.........KKPK.K----P..KENAN....S--.......----AV.........................QRLK.PA.KK....SII.FK..I....N.G....Y.E...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A5P1FIW7_ASPOF/91-311              ....................................................................................................................................adkisgrfedgr----..-..---...--...................................----.-.---.........---.----.--.LTL.VMP.....KR...E.V...KE...............FVGEKKE.-.-...............AAK.YEGHIEE.KTP................................................................MHEEKKD.EH...IE.E....RT...............................KDT..G..E.S.Q..N.E.PTqe................................ekA.K.S.IGE......DK..K.D..A.A.AKHEH....................................................P........EEKPTS..R...E..E.-...K.....EE...NRKE.E.....K....P...K.....D..T.KEKQN.EP..TRK.....ETRK.S.KDE..P..V.....K..E.E...ESKNi.......eEKTT.K-MKKL..REMRK....MIPi.....sWLDPGT.........................LDKL.NR.NK....KVI.AA..L....D.K....L.N...........RNK.KV.IAV.AVVSFSAGV....YAC.LKLSSSGMSSACCTV---------------------------------------.---.--.------..--------------a........................................
A0A1R3IXY8_COCAP/6-328               .......................................................................................................................................qfsenlcll----..-..---...--...................................QW-L.M.HQ-.........-PS.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.V.AER......DN..A.I..A.N.LQYREnslangnmsscppg.......................fqmsrgmkhvphqqqN........IHHMPH..I...S..E.-...A.....PY...NSRE.M.....H....P...S.....D..A.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..G.K...EGKAva.....sdKKAS.KPPKKV..KRENE....DLNk.....iMLGKSDewkggqdvg......vggddhkkqtVATK.SD.WK....GQD.LG..L....N.Q....V.V...........FDD.ST.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEG.HDL.SV.PVDLKD..NWAKHGTNRYITIK.........................................
A0A5N5KN19_9ROSI/2-90                ..............................................................................................................................................vk----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................--F..D..M.L.P..G.N.HN...................................sA.G.V.LPE......TA..S.T..H.H.MQMFQ....................................................P........------..-...-..-.-...P.....DS...ASDE.M.....L....-...-.....D..Q.VEEAS.VE..EKE....nGPKK.K.RQL..A..K.....A..P.K...SPKA.........KKGT.RAPRAP..KPEDS....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------psvqq....................................
A0A068UT92_COFCA/39-233              .................................................................................................................................afhpsqatqmdskag----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...I.....A..A.VPIRS.VP..PLH.....GPTK.N.RFV..T..K.....P..V.K...IKKNwppsndacpS---.-NKSRP..KQPNK....KLS.......TTKKTKrp.....................pkIGVN.IE.RK....NPD.LV..Y....D.E....A.K...........FDF.SR.VPP.PFCSCTGVA....RAC.YKWGSGSWQSSCCNTNLSQYPLPMSPSRPGARVPGRKMSHGAYTKLLCRFATEG.RDL.SQ.PIDLKN..HWAKHGTNKFVTIK.........................................
A0A446S9U4_TRITD/1-349               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg..agHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqhqhqhhhqnq..hqqqhqhqhqhsreqKVL..H..A.V.P..L.G.PAghighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A4D9AAH7_SALSN/1-305               .......................................................................................................................................mmdhnhlti----..-..---...--...................................----.-.---.........---.----.KT.FMA.ITA.....DR...D.A...--...............AIREKNM.-.-...............ALE.ERKRAFQ.ERD................................................................MAMLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.M.QER......DE..A.I..A.S.LRYREssmndnadipdsy.........................rnelasggkriiqyQ........QQQQMR..V...S..E.T...D.....GY...SPKG.N.....L....-...-.....-..R.GNEIV.IA..ETA.....ETPK.L.RRG..R..Q....tK..D.K...EGKA.........TKSA.KPPRAG..KRTAE....TVI......kEVNS-Dayngwsne.........qgldsdeeNLDK.QV.SW....KDN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGSP....QPC.YRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFNKLLNRLAAEG.YDF.SS.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A1S3BIS4_CUCME/1-313               ................................................................................................................................................MDDG..R..QHEngrHKldyf..........................rgspsPWNM.V.PPNhv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNL.-.-...............ALS.EKKDALA.ARD................................................................EALRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LEI-Rdnasnfplgg................................gvqrktkrlhH.......lSNHMPN..I...S..E.-...T.....SY...GTKD.V.....H....I...T.....D..A.FPITV.IA..S--.....EAVK.S.QQG..-..K.....R..A.K...DNKLv.......sSKTS.KP--PR..KKVGE....DLN......rHAATDG.........................TKYR.TD.WD....GQD.VG..L....N.L....V.S...........FDD.SS.MPA.PICSCTGFA....RQC.YKWGNGGWQSSCCTTHMSMYPLPHLENKRHARMGGRKMSGSVFTKLLSRLAAAG.HDL.SV.PVDLKD..HWARHGTNRYITIR.........................................
A0A540N5P0_MALBA/1-311               ................................................................................................................................................MDDG..R..QHEngrHKmdyyr.........................ggtasPWNM.M.AQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALRQRD.DA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DN..A.Y..A.A.LHS-Rdnavnfplgg...............................gapraakrmhrP........SNHSVT..L...D..D.-...V.....HY...STKD.M.....H....I...T.....E..A.YPVSV.IS..T--.....EDVK.S.RQT..-..K.....R..A.K...ENKA.........SRAK.QSRKKV..GEDL-....--Nr.....qASSD-G.........................IKYK.SE.WD....THD.LG..L....N.L....V.T...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SM.PLDLKE..YWSRHGTNRYITIK.........................................
A0A287VJM0_HORVV/1-307               ................................................................................................................................................----..-..---...--...................................---M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.N...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfnpg.....................slngaknfhhhdqqphA........QSLPLQ..L...A..D.A...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QGSP........lKRPS.GVLRKT..KKAAG...dWRDv.....gISG--Ggedp.................ahvaSVMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSLYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A0E0EVB9_9ORYZ/53-371              ................................................................................................................................................MDDD..A..NMS...IK...................................-WRG.F.FES.........-PA.-KLG.LQ.LMS.--G.....DR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprqhNVL..H..N.L.T..V.G.HGsahia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YQ-.--.------..--------------rpfvl....................................
A0A2G9H9T0_9LAMI/1-302               ................................................................................................................................................MDES..G..REN...RRhrvd..........................cykvpPWNV.I.SQYqn.....keQNA.FHMN.AK.ISM.LCD.....EK...D.A...--...............AIKERDR.-.-...............ALA.EKKAALD.ERD................................................................AAIQQRD.AA...IV.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.V.RER......DN..A.I..A.A.LQFQEstmnall.....................................tsgarglkR........------..T...N..H.P...T.....NH...HTSN.V.....Q....S...T.....D..I.LWEQC.IT..DAFp...vSAVP.G.EAT..N..I.....R..T.K...TNKN.........VKMK.S--RKV..KKMGE....DLN.......RQVT-T.........................DGSK.AE.WD....AQH.FG.sM....N.Q....I.S...........FDE.SI.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTSLSLYPLPQMPNKRHARMGGRKMSGSVFSRLLTRLAAGG.HDL.SI.PVDLKN..YWAKHGTNRYITIK.........................................
I1KJA4_SOYBN/1-282                   ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SLP.....E-...-.-...KP...............LIGGRNA.-.V...............VLA.GTDGAFH.HRDiggmp......................................................qatypIEYMR-D.TW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VV..KKA....nGTRK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RVPRAP..KDEN-....---.......APA--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SR.IPI.PVCSCTGAT....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A0E0M518_ORYPU/79-427              ................................................................................................................................................MDDD..A..SMS...MR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSATPF.L.H...............HQN.HQQHVPH.HHHqphhprdcggngngngggv..........................pnggamppppateappsvaMNFVRND.MW...MH.P....QQqqhhh.....................hprehKVL..H..N.L.T..V.G.HSsshia.........................hhdplgY.G.M.IPG......TH..S.A..H.T.LQMMQ....................................................Q........TEPQQQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAPP..REDG-....---.......APNAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1S3UBA0_VIGRR/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.ATNGAFH.HRDisms.......................................................hatypMEYXR-D.AW...IS.S...xXD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....A....-...-.....-..-.VEEEP.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAA....QXC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A6A6M8S5_HEVBR/2-113               ............................................................................................................................................peai----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.RE.KR....NLN.VD..I....D.R....M.N...........YDL.SG.VPS.PFCSCTGMP....RVC.YKWGAGGWQSSCCTISISEYPLPMSSTRPGARMAGRKMSNGAYVKLLLKLAAEG.HDL.SH.PVDLKE..HWARH---------vfik.....................................
B8BFL6_ORYSI/1-342                   ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..HEDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A287PE82_HORVV/22-154              .................................................................................................................................camrpgctprsinis----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......-----I.........................TRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1U8GAV9_CAPAN/1-324               ................................................................................................................................................MDDS..G..NRDnsrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssmsggqivr................................gvkhmhhpqqH........VHHQQH..M...V..E.-...P.....TY...NPRD.V.....H....I...N.....E..A.IPVSP.PA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAap.....cpKKAP.KASKKV..KRETE....DLNq.....tTFSKSQewkgaqemag.....gasddlnrqlAVPK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
M4EXP6_BRARP/1-262                   .........................................................................................................................................mmpqhqi----..-..---...--...................................----.-.KEQ.........HNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKERNE.-.-...............ALA.AKQEALA.ARD................................................................EALQQRD.LA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......EN..A.L..T.A.LQH-R....................................................-........ENHLNY..I...L..D.-...-.....-C...AKRG.G.....Y....Q...T.....C..F.TEETH.LP..NPS.....PLST.-.--I..P..H.....E..P.P...NTKR.........KKDR.K---RK..KAGGE....DLN......rQLASPG.........................KKCR.KD.WD....CND.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGGQSSCCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEG.HDL.SS.PVDLKD..YWARHGTNRYIIIK.........................................
A0A392QS79_9FABA/13-145              ................................................................................................................................................MDDD..H..QYEngrHKveyy..........................rgahsPWNT.D.PQHqi.....keQNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............ALLELEL.E.A...............AIS.EKNEALA.ARD................................................................AALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRS....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------gasnfpfnggiqrgskrmhhssnhisn..............
A0A2P5YSC2_GOSBA/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DY..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A5D2SJC5_GOSMU/39-234              ..........................................................................................................sslqrtgihhepglvvspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---PSI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A1U8KTQ0_GOSHI/47-356              ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A4P1RFJ1_LUPAN/69-337              ..........................................................................................................................gvndrdskpflsgrdpsmfvga----..-..---...--...................................----.-.---.........---.----.--.---.--N.....DR...D.M...KP...............FLPGREP.S.-...............MFI.GANGIMH.QRDcivs.......................................................eapmlMNYAR-D.GW...IS.Q....RD...............................MFF..N..M.P.S..V.A.PN....................................Y.A.I.LPE......TS..A.P..T.S.LRTVQ....................................................-........------..L...P..D.-...-.....-T...SRDE.K.....V....-...-.....D..S.IEDSV.VK..K-G.....GQSK.K.RQS..R..G.....D..L.T...TPKT.........KKPR.K----P..KDNSN....---.......A---SV.........................QRAN.PV.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PINLRT..HWARHGTNKFVTIR.........................................
A0A5D2VGT2_GOSMU/1-282               ................................................................................................................................................MDDN..-..ALN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPSRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................eahipMNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.HPE......TS..A.A..Y.S.LPILR....................................................-........------..-...S..P.-...P.....NS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KDG.....VEPK.K.RQG..G..A.....A..P.K...MPKA.........KKPK.K----P..KENAN....S--.......----TL.........................QRVK.SA.KK....SIV.FK..I....N.R....Y.F...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
H1ZN44_POPTR/1-320                   ................................................................................................................................................MDDG..G..QHQngrFKmdyykaa.....................hphphppAWNM.M.SQHqv....keqTNA.LAMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............ALA.EKKEALA.ARD................................................................EAIQQRE.KA...LV.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREnamsyplsgg................................sqrgskriphP........VYHSNG..M...S..E.-...-.....AL...DTGE.M.....H....I...T.....D..A.LPISS.VT..A--.....ETGK.A.RQT..-..K.....R..S.K...ENKAv.......gLKAA.KSPRKG..SRVGE....DLN.......KQGASD........................gKKIK.VE.WD....SQD.VG..L....N.L....I.N...........FDE.TT.MPA.PVCSCTGVP....RQC.YKWGSGGWQSACCTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEG.HDL.AI.PLDLKD..YWARHGTNRYITIK.........................................
A0A5D2VYG2_GOSMU/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPGRDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appirMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPE......TS..A.T..H.S.MPIWQ....................................................P........------..-...P..P.P...P.....DA...STRD.E.....S....V...I.....G..R.VEEPP.AS..KEG.....VQSK.K.RQV..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IT..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
A0A2T7END6_9POAL/1-336               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YDT.........-VK.GSLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPAGAF.-.Lhhh.........ghhNAP.HQLHSHH.SRDsggagtsgg..............................................mptepqsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghg.................ghavhhpptgY.G.M.IPD......--..A.P..H.T.LQMMQ....................................................V.......qPQLQSQ..L...Q..E.-...P.....PP...CKED.D.....V....P...P.....P..L.VEDQS.LV..KTE.....TPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAVP..REDR-....---.......AVNGHA.........................PRGR.GP.KK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A0B0PPB9_GOSAR/48-244              .........................................................................................................fsslqrtgihhepglivspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---ASI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A199W2C5_ANACO/15-346              ................................................................................................................................................MDDS..G..HREngrQRpdqy..........................ksvhtQW-M.M.PQH.........QMK.EHHT.MK.LIA.LMT.....ER...D.T...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAIMQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.I.IER......DD..A.I..A.A.LELAResgmngnaknlhn..........................hhhnhqhhnnlsvV........QPSPPQ..L...S..D.A...P.....YD...HVRE.M.....H....I...M.....E..A.YPISA.AL..END....mKARK.P.KQN..R..K.....E..S.K...AQAAps....psmK-SS.-SKRKS..KRVGV...dDLNss...qvT----Iakthh...............nggggVKKK.NE.WK....DQD.LG..L....N.Q....V.T...........FDE.ST.MPV.PVCSCTGKF....RPC.YKWGNGGWQSSCCTTTLSMYPLPVMANKRHARMGGRKMSGSAFSKLLSRVAAEG.HDL.SM.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2R6R032_ACTCC/10-322              ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQWF-.M.CQP.........--S.M---.KQ.IMV.VMA.....ER...D.A...--...............ATQERNL.-.-...............AFS.EKKAALA.ERD................................................................LAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MAR......DN..A.I..A.T.IQYREnamsrgnmspqcppg......................cqispgvkhmhhpqqN........LNHKPH..M...D..E.-...V.....LH...DSGD.M.....H....T...S.....D..G.LSMSP.VA..S--.....EPTK.L.RQA..-..K.....Q..T.K...EVKPrt.....pnKKPS.ESSKKV..KREDD....PSK......mILGKSRg.......................gNMSK.PD.WK....GQD.LG..L....N.Q....I.A...........FDE.TM.MPG.PVCSCTGFL....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARIGGRKMSGSAFSKLLSRLAGEG.H-L.SN.PVDLKD..HWARHGTNRYITIK.........................................
A0A200R2I6_9MAGN/2-141               ...........................................................................................................................................aissn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........KRAL.KPSRKV..HKRG-....---.......-CKD-L.........................NRRF.DP.WR....RHN.LG..L....N.H....V.Y...........FDE.SS.MPS.PICSCTGVL....HQC.YKWGKGGWQSACCTSTLSMYHLPTVPNKQHSRLGGRKMSGSAFNKLLSWLLAEG.HDL.ST.PLDLKD..HWSRHRTNCYITIK.........................................
A0A2H3ZJS8_PHODC/1-351               ................................................................................................................................................MDDG..G..QREnvrHKtdqy..........................kqvhaQW-M.M.PQH.........QLK.ENHT.IK.IMA.IMA.....ER...D.N...--...............AIQERNI.-.-...............ALA.EKKAALA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARenglngngasacppgct..................aprgtkhihhhqqqhlqH.......iHPSPPQ..L...S..D.A...P.....YN...HTRE.M.....H....I...T.....E..A.FPIST.AS..E--.....SIAK.G.RKA..K..R.....P..R.K...ETKAqn....spsKKSS.KSPRKS..RKGGG...eDLNr....qvT--I-Akpasewrnei....rggddlnkqvaLTKH.QE.WK....GQD.LG..L....N.Q....V.T...........FDE.AT.MPT.PVCSCTGKY....QPC.YKWGNGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFRKLLSRLAAEG.HDL.SQ.PVDLKD..NWAKHGTNRYITIK.........................................
A0A6A6MVR1_HEVBR/1-232               ............................................................................................................................................mvgp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.--NGAFH.PRDcvvs.......................................................dasvpMNYVR-D.SW...IS.Q....RE...............................KFL..N..M.L.P..P.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.MQVLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.K.....V....-...-.....P..R.IEEPS.VN..KEG.....NQLK.K.RQG..G..G.....T..P.K...TPKA.........KKPR.K----P..KDSSN....---.......---NAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.VN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0P0XRW0_ORYSJ/54-343              ................................................................................................................................................MNDD..A..SMSsmgLR...................................GWGA.F.YEP.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KH...............LLSATPF.L.H...............HHQ.HQQYVPH.HHH................................................................QPHHPRD.CG...TN.A....NA...............................---..N..G.N.G..N.G.VG....................................Y.G.M.MPA......TH..T.L..R.M.LQHQP....................................................E........PQPQLQ..H...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..K-P.....PPPK.K.RQQ..G..R.....Q..P.K...VLRP.........KKPK.K-PAAP..CEDGA....PP-.......--SAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.RICSCTGAP....QQR.YRWGAGGWQSACCTTTVSTYPLPMSMKPRGARIAGRKMSHGAFKKVLEKLASEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A453IJI6_AEGTS/1-93                ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------.........................................
A0A022QDD9_ERYGU/1-309               ............................................................................................................................................mddn--EN..G..NVN...SR...................................NWT-.F.HQYsrtpyeephHHH.NHMP.LN.LMP.SMI.....ET...S.L...SGgggg.......ggggGVRELPV.-.-...............TAS.TNHHHHH.H-Itg...........................................................isgGPLNPLS.CW...MG.P....NS..............................sKYL..N..NpL.S..V.N.PNrp...............................yylQ.S.Y.VDV......SS..E.A..S.S.PQITL....................................................P........KNDTSL..M...I..N.-...-.....--...-KVE.E.....S....C...E.....E..R.-DNSG.GG..GSGg...gVAVK.K.RGG..G..G.....G..G.K...APKE.........KKPR.T-NKTP..RGA--....---.......-PN--E.........................DRAK.AP.KK....MAE.VV..I....N.G....Q.N...........MDI.SK.IPI.PICSCTGTA....HQC.YRWGSGGWQSACCTTGLSVHPLPVSTKRRGARIAGRKMSVGAFKKVLEKLSSEG.YDF.SN.PIDLRS..YWAKHGTNKFVTIR.........................................
A0A540MGV9_MALBA/1-340               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HN.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQY-Rdnsinsgnvsscppgc...................qisrgvkhvhhtqqqqqH........VHHMPH..M...N..E.-...P.....SY...GSRD.M.....H....T...S.....D..S.ITMPP.DA..S--.....VPTK.S.RQP..-..K.....R..P.R...EPKTvq.....pnKKPS.KSPRKV..KRESE....DLNk.....mTFDKLHdwkggqdmg......sggddlnkqvVVSK.SD.WK....RQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PMCSCTGLL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1S3U723_VIGRR/1-337               ................................................................................................................................................MDDA..G..HREngrHKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREtsigsgsmpscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...P.....SY...STRE.M.....H....T...T.....D..A.LPTAP.IT..S--.....EAGK.S.RRA..-..K.....R..P.K...EPKSts.....pnKKTP.KAAKKV..KKESE....DLNk.....vMFGKAHewkngqemv......nggddlnkqlVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....KQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A394DE27_LUPAN/1-281               ................................................................................................................................................MDGD..N..GLN...MR...................................NWG-.Y.YEPa.......mSFK.SHLG.LQ.LMS.LMP.....E-...-.-...KP...............LLGARNA.A.V...............-LS.GNHGGFH.HRDigmp.......................................................hatypMDYMR-D.AW...ISsQ....RE...............................KFM..N..I.I.P..T.N.PT....................................F.G.G.ISE......TS..S.A..Y.H.IQMIQ....................................................P........------..-...-..-.-...P.....EV...PQEE.K.....A....-...-.....-..-.IEEEP.IV..DKV.....NITS.K.KRQ..G..K.....F..P.K...SPKV.........KKSK.RDPHLP..KDES-....---.......APS--V.........................QRER.VP.KK....TAE.IV..I....N.G....I.D...........MDI.TS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRN..YWAKHGTNKFVTIR.........................................
A0A251RTZ6_HELAN/54-359              ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHNG.LQ.LMS.HFG....dHR...D.T...KP...............FLSARET.P.Iminph.....ggaaaG--.-------.-TTtaaagyh..................................................hhhplipMPYMR-D.SW...VH.-....RE...............................RLL..H..M.L.P..G.P.GN....................................P.N.F.VPDh....sGS..G.S..N.S.IHIMH....................................................Png....tlKDPGLS..L...E..D.I...G.....GG...DGDG.D.....G....D...G.....E..C.VGDVG.GP..N--.....GPVK.K.RSG..P..L.....G..P.K...GPRG.........KKPK.KAKETA..NQTG-....---.......QTGQTG.........................QRSK.VM.KR....SLD.IV..I....N.G....L.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YSF.DN.AIDLRG..HWAKHGTNKFVTIR.........................................
A0A068TKY0_COFCA/1-312               ................................................................................................................................................MDDG..G..QRE...SRrqrtdy.......................ykgahsPWNG.I.PHYqi.....keQNA.FFMN.TK.INM.LLA.....ER...D.A...--...............AIEERDR.-.-...............ALS.EKRAALD.ERD................................................................SAIQQRD.TA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................H.A.L.RER......DN..A.I..A.A.LQFQEstmngalgc.................................gtqhgmkrfnQ........HRSPHA..N...S..A.Q...S.....AN...KTRE.G.....H....I...T.....E..A.FPITA.IS..S--.....EAAR.S.HQA..-..K.....R..T.K...VNNV.........IPTK.SKSAKK..AKVGE....DLN.......RHVT-T.........................DGSK.AE.WD....AQD.LS.sL....N.Q....I.S...........FDE.TR.MPI.PVCTCTGVA....RQC.YKWGNGGWQSSCCTTSLSVYPLPQIPNKRHARMGGRKMSGSVFSRLLTRLAAGG.HDL.SI.ALDLKN..YWAKHGTNRYITIK.........................................
A0A0A0K147_CUCSA/1-313               ................................................................................................................................................MDDG..R..QHEngrHKldyf..........................rgsssPWNM.V.PPNhv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNL.-.-...............ALS.EKKEALA.ARD................................................................EALRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LEI-Rdnasnfplgg................................gvqrktkrlhH.......lSNHMPN..I...S..E.-...T.....SY...GTKD.V.....H....I...T.....D..A.FPITV.IA..S--.....EAVK.S.QQG..-..K.....R..A.K...DNKL.........VSSK.TSRPPR..KKVGE....DLN......rHAATDG.........................TKYR.TD.WD....GQD.VG..L....N.L....V.S...........FDD.SS.MPA.PICSCTGFA....RQC.YKWGNGGWQSSCCTTHMSMYPLPHLENKRHARMGGRKMSGSVFTKLLSRLAAAG.HDL.SV.PVDLKD..HWARHGTNRYITIR.........................................
A0A0L9VI05_PHAAN/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.ATNGAFH.HREigms.......................................................hatypMEYVR-D.AW...ISsQ....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....E....-...-.....-..-.VEEEA.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A2G2ZCT7_CAPAN/1-310               ................................................................................................................................................MDGN..G..GMN...LR...................................NWG-.F.LEPp......ttVLK.GNLG.LQ.LMS.SMD.....EK...P.H...FGnlrdyq...yhhqqqTHQPDHP.T.V...............MAS.TNGGAFH.HHRvcgls......................................................espmpMEYMR-D.AW...VN.H....KDy............................reKYL..N..A.L.S..A.N.HPyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQMYQ....................................................-........------..-...-..-.Q...P.....NL...VKVE.T.....A....-...-.....P..L.VEEVC.QE..RDT....gGLAK.K.RGA..D..K.....SpvL.K...SPKP.........KKAK.KATTAP..KEDST....---.......-P--SL.........................PRAR.AP.RK....SAE.VN..I....N.G....I.N...........MDI.SR.IPI.PICSCTGSS....QQC.YRWGCGGWQSACCTTNLSSYPLPMNIKRRGSRIAGRKMSLGAFMKVLEKLTSEG.YNF.SN.PIDLRP..HWAKHGTNKFVTIR.........................................
A0A443N9H0_9MAGN/1-284               ................................................................................................................................................MDDD..G..GLGglgIR...................................NWG-.Y.YEQ.........PTK.GNLG.LQ.LMS.SVT....aER...D.Q...KP...............LLGGRDA.G.V...............---.MLNGGFM.HREcgvp.......................................................estvpMDFIR-E.SW...IS.P....RE...............................RLL..H..G.F.S..G.H.QN....................................Y.P.F.LSG......GS..G.A..H.N.SPY--....................................................-........------..-...P..P.P...P.....DI...PKEE.H.....P....Q...V.....E..E.VEVGG.--..KND.....APLK.K.RAN..G..R.....A..C.K...APKA.........KKSK.KSSSAS..KEDSN....CS-.......------.........................VPRP.KP.IK....NTG.VI..I....N.G....V.D...........IDI.SG.IPI.PICSCTGTP....QQC.YRWGCGGWQSACCTTSISMYPLPLSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNI.SN.PIDLKT..HWAKHGTNKFVTIR.........................................
A0A5E4F301_PRUDU/1-337               ................................................................................................................................................MDDS..G..HREngrIKaeqy..........................kaaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALQ.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnslnngnvsscppg.......................cqisrgvkhmhhpqqH........VHHPPH..M...N..E.-...A.....SY...GTRD.M.....H....T...S.....D..S.IPMPP.DA..S--.....LPTK.S.RQP..-..K.....R..P.R...EPKTma.....pnKKTS.KSPRKV..KRESE....DLNk.....mTFDKLHewkgsqdmg......gggddvnkhlVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A2G5EK89_AQUCA/1-341               .......................................................................................................................................mvdtnrist----..-..---...--...................................EW-L.I.PSHl.......mKDQ.HALS.IK.FMN.IIS.....ER...D.G...--...............ALQERNL.-.-...............ALS.ERKAALA.ERD................................................................MAILQRD.TA...LV.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.IER......DN..A.I..A.A.FEYREnatmsvtssptcpe.......................rygtisetrymhhseH........GQHPPH..L...A..E.-...V.....PC...HARE.L.....H....F...A.....D..A.LPIQA.AA..S--.....EAVK.P.QRN..-..K.....R..T.K...SNKPp......lfKRAS.KPSKKG..KTVGE....DLNkh...lpV----Aepnkwkmdhgr...ggcgedlnkelALPE.VE.WK....DQD.LG..L....N.H....Y.MhhsehgqsrqiFDD.SA.MPV.PVCSCTGAL....QQC.YKWGTGGWQSACCTTTMSIYPLPMMPNKRHARVSGRKMSGSAFTKLLSRLAIEG.YDL.SV.PVDLKD..HWARHGTNRYITIK.........................................
M0RLG3_MUSAM/1-86                    ................................................................................................................................................MDED..G..GLG...IR...................................NWG-.Y.YEP.........PSK.GNLG.LQ.LMS.SAA.....ER...N.T...KP...............LQSGGGF.-.F...............-HR.DCSIPEP.SVQ................................................................MDFGR-D.GW...IH.Hg.rdSN...............................KIL..E..M.L.P..A.R.P-....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------qk.......................................
A0A151RFM5_CAJCA/92-255              ..............................................................................................................................................gv----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-EEAP.VV..EKP....nGTRK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RGPRTP..KDENT....---.......-PS--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5N5G3M3_9ROSA/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.I...KP...............FAPGRDP.A.V...............-MV.SANGAYH.PRDcvvs.......................................................dtqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN...................................yA.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...P..-.-...-.....EP...SRDE.R.....V....-...-.....G..R.IEEPV.VP..KEV.....GTSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----A..KDNT-....---.......--NPSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PICSCTGVP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.TN.PIDLRS..HWAKHGTNKFVTLR.........................................
M0T1D8_MUSAM/1-66                    ................................................................................................................................................MDGD..G..GMG...MR...................................NWA-.Y.YEQ.........TLK.GNLG.LQ.LMS.PVA....aER...EsT...KP...............LLSNGG-.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------flrrdcdvaepsvpmgfmrn.....................
A0A2H9ZRP2_9ASPA/1-335               ................................................................................................................................................MDDN..G..QREngrHKadhy..........................kqvhaQW-M.M.PQH.........QIK.DSHT.MK.LMQ.IMA.....ER...D.N...--...............AIQERNA.-.-...............ALQ.EKKTALA.DRD................................................................IAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.MER......DN..A.L..A.A.LEYARensmnggtnsap...........................rgakhfhqqhlqqH.......lQHPPLQ..L...S..E.S...P.....YI...HERD.M.....H....V...T.....E..A.YPFSE.AL..D-G.....NTVK.V.RKP..K..R.....S..R.K...EGKAqaa...npsKKAS.KAPRKG..KKNGGg..dDLN......kQ---VTiakplt............ewrgdviGTKH.HE.WK....GQD.LG..L....N.Q....V.T...........FDE.ST.MPP.PGCSCTGKL....QQC.YKWGNGGWQSACCTTTMSIYPLPVMPNKRHARVAGRKMSGSAFTKLLSRLAAEG.HDL.SA.AVDLKD..HWAKHGTNRYITIK.........................................
A0A2H3XRU5_PHODC/1-277               ................................................................................................................................................MDDD..E..GLG...IR...................................NWGY.Y.-DQ.........PLK.GNLG.LQ.LMS.SVP.....ER...D.T...KP...............LLSNGG-.F.L...............H-R.DCGVAEP.SIP................................................................MDFVR-D.GW...IH.H....NRd.............................nKIL..H..V.L.P..M.N.HHq.................................hnY.G.M.LPD......PP..G.A..H.T.LQILQ....................................................P........------..-...P..E.-...-.....-P...PRDD.K.....V....-...-.....-..L.MMEDP.GG..RNE.....TPLK.K.RSQ..G..R.....P..H.K...SPKP.........KKPK.K-VAAP..RDEA-....-TN.......---GSV.........................SRGK.AG.KK....STG.LV..I....N.G....I.D...........LDI.SG.IPT.PICSCTGTP....QQC.YRWGVGGWQSACCTTSISCYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.HNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A067HAT9_CITSI/1-335               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............ATS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
M4D2L7_BRARP/1-285                   ...............................................................................................................................mesggqydngrykpdyy----..-..---...-Kgt..............................ppsVWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............ALKERNE.-.-...............ALA.AKKEALA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......ET..A.L..N.A.LHYPE....................................................-........-KNNLN..Y...I..L.-...-.....SC...AKRG.G.....T....-...-.....-..-.-EGRS.HP..PRP.....PPVS.P.IPA..-..-.....-..-.-...DKNP.........TKRK.KETKQG..KKVGD....DLN......rLAASPG.........................KKCR.KD.WD....VNE.VG..L....N.L....V.A...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGSGGWQSSCCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGEG.QDL.SS.PVDLKD..YWARHGTNRYITIK.........................................
A0A0J8B6K9_BETVU/1-280               ................................................................................................................................................MDGD..G..GLN...MR...................................NWG-.Y.YDP.........-PM.KHLN.LQ.LMS.SIA.....DR...K.-...-P...............LLGGRES.A.L...............-IA.NTNAGFH.QRDygvp.......................................................sshyhVDYMR-D.TW...IN.R....EN...............................KFF..N..M.L.P..S.G.HS....................................Y.G.V.PTE......TA..P.T..H.H.PPM-Q....................................................-........---MLR..Q...P..E.-...-.....-S...SNEE.R.....M....-...-.....-..-.IRTEP.VE..INN.....GPLK.K.RSA..G..K.....S..E.K...APKT.........KKPK.KTPSGP..KDGGS....---.......--G-SA.........................QRAK.SA.KK....TTE.VV..I....N.G....I.D...........MDI.ST.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTSMSMYPLPMSAKRRGARIAGRKMSLGAFKKVLEKLAAEG.YNF.SN.SIDLRT..HWAKHGTNKFVTIR.........................................
A0A078IRI7_BRANA/1-273               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.S-A.....DR...N.T...KP...............FLPGRDP.N.L...............M-I.GQNGSYH.HAE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TSp.................................nyG.N.V.LPE......TS..S.A..P.S.MHHHH....................................................-........-HHQTE..D...N..P.-...-.....VK...CEE-.-.....-....-...-.....-..-.--EEE.IV..Q--.....-PNK.K.RKT..-..-.....N..S.K...ASAT.........AKGK.K-PRKP..KEEND....SKT.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
M0SA08_MUSAM/52-220                  .........................................................................................................................................fpepsvl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.MAEDT.TG..KNE.....PPLK.K.RPR..G..C.....L..Q.K...SSKP.........KRPK.K-VTAP..SDEV-....---.......-PNGSV.........................SRGK.AA.RK....STG.MI..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGKP....QPC.YRWGVGGWQSACCTTNMSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A022Q3T7_ERYGU/1-135               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW-L.M.-QQ.........QPS.M---.KQ.IMG.FMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKTALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnainssnnnms.............................pcppglsiprgvQ........HMHQPQ..Q...H..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------qqqqqqhitssss............................
A0A0E0PT04_ORYRU/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
V4M9X7_EUTSA/1-295                   ....................................................................................................................................mesggqyengry----..-..---...-Kpdyy..........................kgtesVWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKERNE.-.-...............AVA.AKKEALA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......ES..A.L..N.A.LQYRE....................................................Nnl....nyILSCAR..R...G..G.S...Q.....SC...VTEE.S.....H....L...P.....D..P.SPIST.IP..P--.....EAAN.T.RPA..-..K.....R..K.K...QSKQ.........ETR-.---SKG..KKVGE....DLN......rQVASPG.........................KKCR.KD.WD....SND.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGSVFSRLLSRLAGQG.HEL.SS.PVDLKD..YWARHGTNRYITIK.........................................
K4ABT0_SETIT/1-359                   ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KP...............LLPNGGN.F.Lqhhghh..naphqhqHQH.HTQHPHH.PRGggggsgaps.............................................gmpteppavhMDFVRNE.AW...LH.P....SQhhhqhhh................qhqhprqpKVL..H..H.L.P..V.G.PAghaghpghg.................ghavhhhptgY.G.M.MAD......AH..G.V..H.T.LQMMQ....................................................Pqa...qqqPQPQPQ..P...Q..D.-...P.....PP...PKEE.S.....M....P...Q.....P..L.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGTP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A4U5Q572_POPAL/54-388              ................................................................................................................................................MDDG..V..HREngrHKadqy..........................ktaqgQWL-.M.-PP.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnsfasantsssppv........................yhnsrgmkhmhhqqQ........HIHLPH..M...N..E.-...V.....AY...GARE.M.....Q....T...S.....D..A.VPISP.VA..S--.....EVAK.P.RRG..-..K.....R..P.K...DTKStp.....snKKTS.KSPMKV..KRESE....DLN......nMFGKSNewkngedmn......gggddlnkqlAASK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPA.PVCSCTGFF....RQC.YKWGNGGWQSSCCTTALSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.QDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2C9UFY2_MANES/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........TFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLPGRDP.N.N...............IMV.GANGAFH.PRDcvvs.......................................................dasvpMHYVR-D.GW...IS.Q....RE...............................KFL..N..M.L.P..P.N.PN....................................Y.A.V.LPE......AS..G.A..H.S.MQVLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.K.....V....-...-.....G..R.IEEPT.VN..KEG.....NQLK.K.RQG..G..G.....A..P.K...TPKA.........KKPR.K----P..KDSSN....---.......---NAV.........................QRAK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.VN.PIDLRT..HWAKHGTNKFVTIR.........................................
R0HH84_9BRAS/1-284                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.SI-.....DR...N.T...KP...............FLPGRES.N.L...............M-I.GSNGSYH.PREh..............................................................eASMPMNY.SW...IN.Qp..kDN...............................KFF..N..M.L.P..I.S.TPn..................................yS.N.V.MSD......TS..G.S..N.S.MQMMH....................................................Q........----PV..V...-..-.-...N.....TS...RFEE.N.....P....A...P.....P..P.REDEI.-V..QPS.....KKRK.M.RGS..I..S.....S..P.T...VPKA.........KKP-.---RKP..KEESG....ATN.......NVH--Q.........................QRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PVCTCTGTP....QQC.YRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEG.YSF.GN.SIDLKS..HWARHGTNKFVTIR.........................................
A0A2K1Y8J6_POPTR/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNLG.LQ.LLSpTMA.....E-...-.-...KP...............FLGARSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYTR-D.VW...IG.H....RE...............................KLL..S..M.L.P..E.N.HN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...ENDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.TA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTGNP....QQS.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2H3YFY8_PHODC/1-279               ................................................................................................................................................MDDE..G..GLG...IR...................................NWG-.Y.YEQ.........PSK.GNLG.LQ.LMS.SMV.....ER...D.T..tKP...............LLSNGG-.F.L...............HRE.CSMVVEP.SVP................................................................MDFVR-D.GW...IH.H....NRd.............................nKIL..H..V.L.P..A.N.HHh.................................pnY.G.M.LPD......PP..G.A..H.T.FHMLQ....................................................P........------..-...P..-.-...-.....EP...PKDD.K.....V....-...-.....P..M.MEDPG.-S..RNE.....TPLK.K.RSQ..G..R.....S..L.K...SPKP.........KKPK.K-VAAP..RDGA-....-TN.......---GSV.........................SRGK.AG.KK....STG.LV..I....N.G....I.D...........LDI.SG.IPT.PVCSCTGRL....QQC.YRWGVGGWQSACCTTSISCHPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A6A5M8U9_LUPAL/14-350              ................................................................................................................................................MDDP..G..HREngrHKpdqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AVQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREssltsgsmsscppg........................cqisrgvkhvhhpqQ........QVHHLH..N...M..D.D...A.....SY...GTRD.M.....H....T...T.....D..S.LPEAH.IP..L--.....EAGK.S.RRA..-..K.....R..P.K...EAKSis.....tnKKTS.KTARKD..KMESE....DLNd.....lMFGKTHewksgqemv......ngggdldkqpVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A6A3BJ17_HIBSY/11-104              ................................................................................................................................................MDDD..A..-LK...MR...................................NWG-.Y.YVP.........SFK.GDLG.LQ.LMT.SMA.....EW...D.T...KP...............YIPGRDP.D.L...............-MV.TTGAAFH.PRDcivs.......................................................egpipMHYVR-D.TW...IS.Q....RK...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------pplpdpstgdgrvv...........................
A0A0D3BWP6_BRAOL/1-219               ................................................................................................................................................MDDG..G..HRDngrHKap...............................qgQWMM.Q.QQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKSAVA.ERD................................................................ISFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQY-Rdnlmatsrq.................................hqphmhhqhqH........QHHMLQ..L...T..E.-...N.....AY...ETRE.T.....E....T...S.....P..P.TTG--.--..--Sa...lESAK.P.KRG..-..R.....K..V.K...DPKAaa.....anKRGP.KTQRKV..KKENE...dDLSk.....iMFVKTTtldys..............eeeeeaTGSK.SD.WK....SRE.MVvgL....N.H....V.V...........YD-.--.---.---------....---.------------------------------------------------------.---.--.------..--------------.........................................
A0A6A3CMI7_HIBSY/1-83                ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMT.SMA.....ER...D.T...KP...............FIPGRDP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................eapipMHYVR-D.TW...IS.Q....RE...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------pqp......................................
A0A0E0IP31_ORYNI/1-329               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFQHH-.--...HP.R....EH...............................KVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
V7CRJ4_PHAVU/1-312                   ....................................................................................................................................medgrqnendrh----..-..---...-Kmeyy..........................rgahsMWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.VKNEALA.ARD................................................................AAIRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.L..A.A.LQSRNnsvsfpfg....................................sriqcgskR........MHHSSN..H...-..-.L...P.....NM...SEAS.Y.....K....T...K.....D..A.SPLAV.IP..F--.....EAVK.S.PQA..-..K.....R..T.K...ENKVi.......sSKAS.NPPYKV..KKMGE....DLN......rKASFEG.........................TKIR.SE.WH....RQD.VG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVLEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A5N5LQ19_9ROSI/24-303              ................................................................................................................................................MDDD..A..-LN...MH...................................NWG-.Y.YEP.........SYK.EPLG.LQ.WMP.SMV.....DR...D.T...KH...............FLPRRDP.I.N...............IMI.GANGAYL.PHDsvvs.......................................................dapvhMNYMR-D.SW...IN.-....RE...............................KFL..N..P.L.P..P.N.PN....................................Y.V.V.LPQ......TS..D.A..H.S.MQMLQ....................................................-........------..-...-..-.S...P.....NS...SRDE.R.....V....-...-.....S..R.IEEPG.VS..KEG.....NQLK.R.RQV..G..Gg...aS..P.K...TPTA.........KKPR.----KP..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PICSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..YWARHGTNKFVTIR.........................................
M0U0N5_MUSAM/91-225                  .................................................................................................................................gdagkvavskdesss----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......---RMG.........................HQGR.NL.RQ....STA.LN..I....N.G....I.D...........LDV.SN.IPT.PLCSCTGMP....HQC.YRWGAGGWQSACCTTGVSMHPLPMSTKRRGARIAGRKMSQGAFKKVLANLAAKG.YNL.SD.PIDLKP..YWAKHGTNKFVTIR.........................................
A0A1D6EKS7_MAIZE/9-80                ..............................................................................................................................................qa--DD..G..SLA...IR...................................NWG-.F.YDT.........-VK.GSLG.LQ.LMS.SMP....pDR...D.T...KP...............LLPRGAL.L.Qqhgh.......hnaaHQL.HAQQSQH.HRD................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------yagg.....................................
A0A4U5Q6S9_POPAL/1-320               ................................................................................................................................................MDDG..G..QHQngrYKmdyykaa.....................hphphppVWNM.M.SQHqv....keqTNA.LAMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............ALA.EKKEALA.ARD................................................................EAIQQRE.KA...LV.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREnamnyplsgg................................sqrgskriphP........VYHSNG..M...S..E.-...-.....AL...DTGE.M.....H....I...T.....D..A.LPISS.VT..A--.....DTGK.A.RQT..-..K.....R..S.K...ENKAv.......gLKAA.KSPRKG..NRVGE....DLN.......KQGASD........................gKKIK.VE.WD....SQD.VG..L....N.L....I.N...........FDE.TT.MPA.PVCSCTGVP....RQC.YKWGSGGWQSACCTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEG.QDL.AI.PLDLKD..YWARHGTNRYITIK.........................................
B4F7V9_MAIZE/1-348                   ..............................................................................................................................................md-DDD..G..SLG...IR...................................NWG-.F.YDT.........-VK.GSLG.LQ.LMS.PMP....pDR...D.T...KP...............LLPRAGF.-.Lqqhg......hhnapHQL.HAQQPQH.YRDsagggvsgg..............................................tpaeqhpihMDFSRNE.AW...LH.P....SHhqh........................pheqKVL..H..S.R.P..I.G.PAghvghpghvahp...........vhavhvvhhhptgY.G.M.ISD......--..A.Q..H.T.LQMMQ....................................................P.......qLESQLQ..E...P..P.-...-.....-P...CKED.E.....A....P...P.....P..L.VEDHS.VV..STG.....PPVK.K.RQR..G..Qkq.scQ..P.K...SPKP.........KKPK.K-SAVP..PEGG-....TI-.......--NGHA.........................TRRR.GP.KK....NVG.MM..I....N.G....I.E...........LDL.AN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.VN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A5J5BWJ6_9ASTE/1-246               ................................................................................................................................................MDDG..G..QREngrHRmdyf..........................kgahtPWNM.M.PQYqv.....keQNV.FYMN.KR.IMH.IIT.....DR...D.A...--...............AVEERNR.-.-...............ALS.EKNAALD.ERD................................................................AAIQQRD.AA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.RER......DN..A.I..A.A.LQFQEstmngtlgc.................................giqrgtkrmhH........QTNQPA..N...V..A.E...A.....AY...KTRE.V.....H....I...T.....D..A.FPISA.IA..S--.....EAVK.S.RQA..-..K.....R..T.K...ENKAv.......sSKTS.KSPQKG..KKVGE....DLN.......RHVT-T.........................DGSK.AE.WD....AQD.LG.lM....N.Q....V.N...........FDE.SS.MPI.PVCSCTGLP....RQC.YKWGN-------------------------------------------------.---.--.------..--------------wrlavi...................................
U5CWE0_AMBTC/1-94                    ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPI.PVCSCTGVL....QQC.YKWGNGGWQSACCTTQISMYPLPVMPNKRHARVGGRKMSGSAFTKLLSRLAAEG.HDL.SV.PLDLKD..HWAKHGTNRYITIK.........................................
A0A6G1EWY3_9ORYZ/1-335               ................................................................................................................................................MDDD..A..SMS...LR...................................GWGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.Lh............hqHVShHQPPHHH.PRDcggnggmsngg..........................................ampateapsipINFVRND.MW...MH.P....QHhhp.........................rdpKVL..H..T.L.A..V.G.HGghiaha.......................ahhepvgY.G.M.IPG.....tTH..S.A..H.T.LQMMQ....................................................Q........PEPQPQ..P...P..P.-...P.....PA...PKEE.C.....I....S...S.....P..L.IEENV.PV..INE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDG-....---.......APNVPA.........................PRRR.GP.KK....AIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGTP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
S8E434_9LAMI/1-284                   ...............................................................................................................................................l----..-..---...-R...................................NWG-.Y.YEP.........PLK.SHLG.LQ.LMP.SVA.....DR...D.I...KP...............FLSGRDN.P.I...............-MV.STTGAFH.PRDcvite......................................................pplshIDYVR-E.TW...IN.H....KD...............................KFL..H..M.L.P..G.N.PY....................................S.S.I.LAE......PS..GsH..H.S.MAMVH....................................................Q........---PET..N...N..E.A...A.....MP...NVEE.P.....V....V...P.....P..K.TETGP.NK..KRG.....GGGG.A.PA-..-..A.....T..P.K...TAKA.........KKAR.KGPPAP..KESA-....---.......--KPSV.........................QRAK.AA.KK....NVE.VC..I....N.G....I.D...........MDI.TD.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISMHPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YDF.NS.PIDLRT..YWAKHGTNKFVVIR.........................................
A0A1S3UIJ9_VIGRR/60-338              ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............YLPARDP.S.V...............-LM.GASGTFH.PRDcvvs.......................................................eapmqLNYVR-D.NW...TS.Q....RD...............................RYF..S..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..V.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.IEELV.VK..KEG.....GQSK.K.RQT..K..G.....A..L.T...TPKA.........KKPR.K----P..KDNG-....--N.......VPV---.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A2Z7BPF1_9LAMI/1-309               ................................................................................................................................................MDGN..G..EAN...LR...................................NWGF.L.QQQs.......nSLK.GHLG.LQ.LMS.SVV.....EK...P.S...YGggv.........hdnPY-----.-.Nplq.........fsvMPS.TNGGPFH.HHRvg...........................................................gvpETHSPMD.YW...MN.H...nRD...............................KYL..N..V.L.P..G.N.HHngy.............................yqssY.G.V.LPE......SS..L.AmtH.S.IQL--....................................................P........QQMNIS..K...H..E.-...D.....LI...PQME.E.....S....C...E.....E..M.NNGID.IG..--G.....DVVK.K.RRG..G..K.....S..P.T..sTPKE.........KKPRtRAPRAP..KDEST....---.......---PMV.........................HRAR.AP.KK....RAE.VV..I....N.G....I.N...........MDI.SD.IPI.PICSCTGNP....QQC.YRWGSGGWQSACCTMGLSMHPLPMSTKRRGARIAGRKMSIGAFKKVLEKLASEG.YDF.SD.PIDLRS..YWARHGTNKFVTIR.........................................
A0A397ZHJ5_BRACM/1-311               ................................................................................................................................................MDDG..G..HRDngrHKap...............................qgQW-M.M.QHQ.........QQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AVS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQY-Rdnsmats.....................................rqhqphihH........QHHMLQ..L...T..E.N...N.....AY...ETRE.I.....G....T...S.....P..P.PTTGS.AL..A--.....-SAK.P.KRG..-..R.....K..V.K...EPKAa......anKRGP.KTQRKV..KKENE...dDLSk.....iMS--LDysee.................eeeaAGSK.SD.WK....SQE.MMvgL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SS.PVDLKD..RWAKHGTNRYITIK.........................................
A0A314XN37_PRUYE/9-223               ........................................................................................................................lacsscqawqsatqkllsqgvipq----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............SWL.APNGAFH.PRDcvvs.......................................................dapvpLNYMR-D.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....A..R.IEEPV.AN..KEG.....GPSK.K.RGS..G..G.....A..P.K...TPKV.........KKPR.K----P..KDNNN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARM---------------------.---.--.------..--------------leek.....................................
A0A0D3DW89_BRAOL/1-106               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.--MN.KK.IMS.ILA.....KR...D.A...--...............AVLERDQ.-.-...............ASS.AKKEALA.RPDprcfy......................................................sflplLALAARE.EA...LQ.Q....RD...............................KAL..T..-.-.-..-.E.RD....................................K.A.L.IEK......DD..A.F..A.A.LQHHV....................................................K........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------slnfalseekccegdddwycndv..................
A0A445DLQ6_ARAHY/1-275               ................................................................................................................................................MDDD..-..MLN...MT...................................NWG-.Y.YEP.........FKG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............FMPGRDP.-.T...............MLV.NTNGAFH.PRDcvvs.......................................................eaqmpINYVR-D.SW...IS.Q....RD...............................RFF..N..M.Q.P..T.N.PN....................................Y.P.V.LPE......TS..A.A..P.-.TQITQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....A....-...-.....D..I.VEETV.-Q..KEG.....VQPR.K.RQG..R..V.....A..S.T...TPKA.........KKPR.K----P..KDKS-....--N.......AP----.........................VQRS.KP.MK....TIE.FV..I....N.G....I.D...........MDI.SS.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSTYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.GN.PIDLRN..HWARHGTNKFVTIR.........................................
A0A4D8Z459_SALSN/1-288               ................................................................................................................................................MDDD..S..---...LR...................................NWG-.Y.YEP.........PLK.G-LG.LQ.LMS.SLT.....ER...D.T...KP...............FLTGRDN.P.V...............-MV.SASGSFH.PRDcvvae......................................................ppvthMDYVR-D.SW...IN.H....RE...............................KFL..H..M.F.P..G.N.PY....................................S.S.V.LPE......SS.vN.H..H.Q.MQMVQ....................................................Q........------..-...P..P.-...P.....QQ...QTET.A.....K....E...T.....R..T.SIEEP.VA..KEG.....SSAK.K.RAA..A..A.....T..T.K...TPKA.........KKTR.K-NPAP..KENGN....GNG.......--NPSA.........................QRAK.TA.KK....NVE.VV..I....N.G....M.D...........MDI.TG.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTTISMYPLPMSQKRRGARIAGRKMSQGAFKKVLEKLATDG.YNF.AN.PIDLRT..YWAKHGTNKFVIIR.........................................
A0A087HNI9_ARAAL/1-272               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPaa.....atTFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.S-YHPDP.PVH................................................................MSY----.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.NSp.................................nyG.N.V.LPE......TS..S.A..P.T.MPMN-....................................................-........LHHHHH..Q...T..E.E...N.....QV...KCEE.E.....I....-...-.....-..L.LPKKR.--..---.....-KPN.S.K--..-..-.....-..-.A...GSTP.........TKAK.K-PRKP..KDENS....NS-.......-TT-NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.IPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
B9RZ34_RICCO/6-230                   ................................................................................nrnhlipeastgaslphfawfypgsfysapktnsihsqgsqidepilpvppicsiapaaepakn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.NN..SGA.....KPAK.A.RKQ..K..P.....S..A.K...GSNQi.......pSKTF.K-LKQP..RKTSK....---.......KKGQSM.........................PEAK.RE.KR....NIN.VD..I....G.R....M.N...........FDL.SG.VPS.PFCSCTGMP....RVC.YKWGAGGWQSSCCTTNISEYPLPMSAARPGARMAGRKMSNGAYLKLLLKLAAEG.YDL.SH.PVDLKE..HWARHGTNKFVTIK.........................................
A0A067L8I4_JATCU/4-230               ........................................................................................ysnrnhmipeasagasvphfawfypnvyptpksssfnsqgipidgqqglpvtpirs----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.VA..PSA.....EPAK.N.NNS..G..S.....K..P.A...KTKKqkps.ikvsNQMP.SRISKP..KQPKK....SSR.......KKGQST.........................PEAN.RE.KR....NLD.VD..I....D.I....R.N...........FDF.SG.VPS.PFCSCTGMH....RVC.YKWGAGGWQSSCCTTNISEYPLPMSSTRAGARMAGRKMSNGAYLKLLLRLAAEG.YDL.SH.PVDLKN..HWARHGTNKFVTIK.........................................
A0A2I0WBB0_9ASPA/21-311              ................................................................................................................................................MDDN..V..HKE..nVRhktdh........................yksvhaQW-M.M.PQH.........QMK.DSPA.LK.LMT.LLT.....ER...D.N...--...............AIQELNI.-.-...............AIS.EKRAALA.ERD................................................................MAIVHRD.GA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.MER......DN..A.L..A.A.LDYAR....................................................Q........--NSLN..G...H..G.V...P.....AS...PPQH.L.....T....E...P.....Y..P.MPTTA.SD..DAI.....KGRK.A.KRS..-..R.....K..E.K...KDQA.........KKAS.KTPKKG..RIGGG...eDLN......kQISDFK.........................YQEW.KV.WK....VQD.LG..L....N.Q....V.P...........FDE.SI.MQRpPGCSCTGKL....QHC.YKWGSGGWQSACCTKTLSMYPLPVMPNKRHARVAGRKMSGSAFVKLLTRLAAEG.YDL.SA.PLDLKD..HWAKHGTNRYITIK.........................................
A0A0B0NBF7_GOSAR/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
M0TCN9_MUSAM/2-184                   ....................................................................................................................................idiqtmpiaeee----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...-TDD.K.....V....A...T.....T..P.PPIPK.LR..K-Q.....HSST.K.KSG..R..V.....A..A.K...VLRP.........KEPK.KQLPNP..TKKKG....---.......---GSS.........................STGK.RE.KK....NQDsVA..E....Q.G....T.M...........LDI.SS.VPV.PVCSCTGVP....RQC.YRWGSGGWQSSCCTTTISEYPLPMSPTRPGARLAGRKMSIGAYGKLLQRLSAEG.FDL.SY.AVDLKD..HWARHGTNKFVTIR.........................................
A0A1R3JF42_9ROSI/8-232               ........................................................................................nmmpdtntgssaspfswfygnymtkpglsslqraqighepgllvdpirsisaptte----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...--SE.N.....I....D...D.....L..R.SKTTK.VG..KQK.....PSVK.D.S-N..P..V.....A..S.K...VLRP.........KQPK.KKPSTP..KKAKG....P--.......----IT.........................PEAK.RE.KK....NLN.ID..L....D.G....T.N...........FDF.SG.VPS.PFCSCTGVA....RVC.YKWGAGGWQSSCCTTNISEHPLPMSSTRPGARMAGRKMSNGAYLKLLLRLAAEG.HDL.SH.PVDLKH..HWARHGTNKFVTIK.........................................
A0A446WZG7_TRITD/1-330               ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnsgngfnpg.....................slngaknfhhhdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..VT-.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.RK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRIV---de.......................................
A0A445C1Y0_ARAHY/1-315               ...............................................................................................................................................mMDDG..Q..KHG..nSRhtidy........................yrgansPWSM.A.SQHqv.....tePNA.LVMN.KK.IRS.IMA.....ER...R.A...--...............ILELEA-.-.-...............AIS.EKNEALA.ARD................................................................EALRQRD.EA...IA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.RER......DN..A.L..A.A.LQNREdainfslgng................................vqrgskrmhhP........ANYLDN..M...T..D.-...A.....TY...NTKD.V.....R....I...T.....D..A.FPVTI.IP..S--.....DAIK.S.HQA..-..K.....K..T.K...ENKTi.......sPKAS.KTPSKG..KKMGE....DLN......qRASSEG.........................TKFK.SE.WD....RQD.VG..L....N.L....V.T...........FDE.TY.MPV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSVYPLPQLPNKRHARIGGRKMSGSVFTRLLSRFAAQG.HDL.SV.PLDLKD..YWARHGTNRYITIK.........................................
A0A2P5XDL7_GOSBA/285-566             ................................................................................................................................................MDE-..N..ALN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................evhipMNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.LLE......TP..A.A..Y.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPEA.........KKPK.K----P..KENAN....YT-.......-----V.........................QCVK.SA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SS.PIDLRS..HWARHGTNKFVTIR.........................................
M0RLG3_MUSAM/81-224                  ..............................................................................................................................................pa----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..R.....P..Q.K...SSKA.........KKPK.K-VAAP..KDETT....NG-.......-----S.........................VSHG.KS.SR....SSG.MV..I....N.G....I.T...........LDI.SG.IPT.PVCSCTGKP....QPC.YRWGAGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLTEEG.HNL.SN.PIDLRP..LWAKHGTNKFVTI-s........................................
A0A2G3CF61_CAPCH/10-292              ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEQ.........SLR.GNLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGVFH.SRDsiipe......................................................aplshIDYVR-D.GW...IN.H....RE...............................KFL..N..M.F.P..G.S.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMIQ....................................................Q........------..-...P..D.A...-.....--...-TKD.V.....G....-...V.....N..A.EEPPS.VR..KES.....GHSK.R.KTG..G..A.....T..P.K...APKA.........KKSK.KASSVP..KENGN....---.......---PSV.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.TG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A5N6QP07_9ROSI/2-290               .........................................................................................................................................vpqhqvk----..-..---...--...................................----.-.-E-.........PNA.LIMN.KK.IMS.IIA.....EK...D.A...--...............AIRERNA.-.-...............ALS.EKNDAWA.ARD................................................................EALRQRD.EA...IS.Q....RD...............................---..-..-.-.-..-.-.--....................................V.A.L.MER......DN..A.L..A.A.LQV-Rdqamnfplgg...............................gilrgskrmhhP........SNHLVN..V...A..E.-...A.....PY...STKE.S.....Q....I...T.....D..A.FPITV.IA..S--.....EAVK.S.HRA..-..K.....R..T.K...ENKAv.......sSKAS.KTPRKG..KKVGE....DLN......rQAACDG.........................TKYR.SE.WD....SQD.LG..L....N.L....V.T...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTRLSLYPLPQMPNKRHARVGGRKMSGSVFTRLLSRLAAEG.HDL.AL.PLDLKN..FWARHGTNRYITIK.........................................
A0A4D9A1R0_SALSN/1-300               ................................................................................................................................................MDES..G..REN...TRqrmdgy.......................hkvpvpQWNP.M.PQYqi.....kePIA.FQLN.AK.LMM.LCN.....ER...D.D...--...............ATRERDR.-.-...............ALT.EKKSALD.ERD................................................................VAIKQLD.AA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................E.A.L.RER......DN..A.I..A.A.LQFHE....................................................Stm...ndlVNSSAR..G...S..K.R...T.....HH...PMKE.D.....C....I...R.....D..A.FPVSQ.VP..HES.....PVSK.K.GTR..A..K.....A..N.K...DAQA.........RSA-.RSPKKV..KKIGD....DLN.......RQVKT-.........................EGYK.AE.WD....AQD.LG.sM....N.Q....I.M...........FDE.SS.MPG.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTSLSMYPLPQMPNKRHARMGGRKMSGSVFSRLLTRLAEAG.QDL.SV.SVDLKE..YWAKHGTNRYITIK.........................................
A0A5N5NPJ7_9ROSI/1-363               ................................................................................................................................................MDDG..G..HREngrIKadqyktaqgqhvasdfslpfpvliiliflllllllQWL-.M.-QP.........QPS.M---.KQ.IMN.IMA.....ER...D.A...--...............AILERNM.-.-...............ALS.EKKAANA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.T.LQYREnslpggnlsncapgf......................hnsrgvkhthqqqqqH........AQHLPH..M...N..E.-...G.....PY...GARE.M.....Q....T...S.....D..A.VPESP.VA..S--.....EVAK.P.QRG..-..K.....R..P.K...DAKAtp.....snKKTS.KSPRKV..KRESE....DTN......mMFGKSHewkneqdmd......gggddlnkqlAASK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPP.PVCSCTGVF....RQC.YKWGNGGWQSSCCTTTLSIYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.QDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A498JUJ2_MALDO/1-311               ................................................................................................................................................MDDG..R..QHEngrHKmdyyr.........................ggtasPWNM.M.AQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DN..A.Y..A.A.LHS-Rdnavnfplgg...............................gapraakrmhrP........SNHSVT..L...D..D.-...V.....HY...STKD.M.....H....I...T.....E..A.YPVSV.IS..T--.....EDVK.S.RQT..-..K.....Q..A.K...ENKA.........SRAK.QSRKKV..GED--....-LNr.....qASSD-G.........................IKYK.SE.WD....THD.LG..L....N.L....V.T...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SM.PLDLKE..YWSRHGTNRYITIK.........................................
I1K6R5_SOYBN/1-317                   ................................................................................................................................................MDDG..R..QHEngrHKmeyy..........................rgahsLWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILEIEL.E.A...............AIS.EKNEALA.ARD................................................................AAIRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRNnsvnfpfggg................................iqcgskrmhhS........SNHLSN..M...T..E.-...A.....AY...NTKD.M.....I....I...R.....D..A.SPVTV.IP..S--.....EAVN.S.HQS..-..K.....R..S.K...ENKVi.......nSKAS.KPPCKV..KKMGE....DLN......rQASSEG.........................TKIR.SE.WD....RQD.VG..V....N.L....V.A...........FDE.TI.MLV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
D7MFP8_ARALL/23-282                  ................................................................................................................................ngrykpdynkgtqsvn----..-..---...--...................................---M.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKEINE.-.-...............AVA.ATKEALA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MET......ES..A.L..N.A.LRYRE....................................................Nnl....nyILSCAK..R...G..G.S...H.....SC...VTDE.S.....H....L...P.....A..P.SPIST.IP..P--.....EAAH.T.KLA..-..K.....R..K.K...ESKQ.........GA--.--RSKG..KKVGE....DLN......rQVASPG.........................KKSR.KD.WD....SYD.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRVGGRKMSGSVFSRLLSLL----.---.--.------..--------------tir......................................
A0A4V6D249_SETVI/1-316               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KP...............LLPNGGN.F.Lqhhghh..naphqhqHQH.HTQHPHH.PRGggggsgaps.............................................gmpteppavhMDFVRNE.AW...LH.P....SQ...............................---..H..H.H.-..Q.H.HH....................................Q.H.Q.HPR......QP..K.M..M.Q.PQAQQ....................................................Q........PQPQPQ..P...Q..D.-...P.....PP...PKEE.S.....M....P...Q.....P..L.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGTP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A0E0QVN9_ORYRU/1-290               ................................................................................................................................................MNDD..A..SMSsmgLR...................................GWGA.F.YEP.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KH...............LLSATPF.L.H...............HHQ.HQQYVPH.HHH................................................................QPHHPRD.CG...TN.A....NA...............................---..N..G.N.G..N.G.VG....................................Y.G.M.MPA......TH..T.L..R.M.LQHQP....................................................E........PQPQLQ..H...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..K-P.....PPPK.K.RQQ..G..R.....Q..P.K...VLRP.........KKPK.K-SAAP..CEDGA....PP-.......--SAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.RICSCTGAP....QQR.YRWGAGGWQSACCTTTVSTYPLPMSMKPRGARIAGRKMSHGAFKKVLEKLASEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A059AVZ4_EUCGR/1-285               ................................................................................................................................................MDGD..N..SLN...MR...................................NWGY.Y.EPT.........ATM.RGLG.LN.LMS.SVP.....E-...-.-...KP...............LFDSRSA.A.V...............MAA.SNGSAYH.HRDlgas.......................................................qavypMDYMR-D.AW...MS.P....RE...............................KFF..N..P.M.S..G.N.HN....................................Y.S.M.IPE......TS..T.A..H.H.MQMVQ....................................................P........PDL--S..K...D..E.-...-.....RA...TQVE.Q.....V....-...-.....-..G.IGNEI.I-..-EN.....GPSK.K.RPG..P..K.....G..P.K...SPKP.........KKAK.RGPRAP..KAET-....---.......APS--V.........................PRAR.TI.KK....TTE.LM..I....N.G....I.N...........MDI.SC.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGLSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.TN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0D3GCC3_9ORYZ/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A0K9R4Q4_SPIOL/1-278               ................................................................................................................................................MDGD..G..GLN...MR...................................NWG-.Y.YDP.........-PM.KHLN.LQ.LMS.NMA.....DR...K.-...-P...............LLGTRDS.-.-...............LIA.NTNGAFN.QRDyvv.........................................................pnyqVDYMMRD.AW...IH.R....DN...............................KYL..N..M.L.P..T.P.HS....................................Y.A.I.PTE......TP.pT.H..H.P.MQMLR....................................................Q........------..-...P..E.-...-.....-S...SNEE.R.....T....-...V.....R..M.EPVTE.IN..--N.....GPLK.K.RSA..G..K.....S..E.K...APKT.........KKPK.KAPTGP..KEGGS....---.......--GS-G.........................QRAK.SA.KK....TTE.VI..I....N.G....I.D...........MDI.ST.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTSMSMYPLPMSVKRRGARIAGRKMSLGAFKKVLEKLAAEG.YNF.TN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A5C7I8A9_9ROSI/1-315               ................................................................................................................................................MDDD..G..QNEngrYKmeyy..........................kgahaPWNM.M.PQHqm....kepNNA.LVMN.KK.LMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AIS.EKREALA.VRD................................................................QALEERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................D.A.L.MAR......DN..A.L..A.A.LHYREsainfpmggg................................vqrgakrmhqP........TYHPSD..V...V..E.-...-.....DF...NSGD.M.....H....I...T.....D..A.HPISI.IS..C--.....ETSK.S.HQA..-..K.....R..T.K...ENKAv.......mSKPS.ASPRKV..KKVGE....DLN......kKVASEG.........................KKLR.SD.WD....SLD.VG..L....N.L....V.N...........FDE.AT.MPV.PICSCTGSP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.HDL.SL.ALDLKN..YWARHGTNRYITIK.........................................
A0A2R6PZN3_ACTCC/1-308               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW--.F.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKTAMA.ERD................................................................MAILQCD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnmspcppgc......................qisrgvkhmhhpqqqH........VHHHPH..M...S..E.-...A.....SY...TSRD.I.....H....T...S.....E..P.IPMSP.VA..A--.....EPAK.P.RRT..R..-.....-..T.K...EANAvt.....pnKKPS.RSSKKV..KTEPA...dDLN.......---KQV.........................GVSK.SD.WK....DKD.LG..L....N.E....V.A...........FDD.S-.MPV.PVCSCTGTF....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARIGGRKMSGSAFNKLISRLAAEG.YDL.ST.PVDLKD..NWAKHGTNRYITIK.........................................
A0A2I4ENY7_JUGRE/1-337               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMT.IIA.....ER...D.A...--...............ALQERNL.-.-...............ALS.EKKAAFA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnslssgnmsscppg.......................cqisrgvkhihhpqqH........VHHLPH..M...G..E.-...A.....SN...NIRD.M.....H....T...S.....D..G.LAASQ.VE..S--.....ETAK.S.RRA..-..K.....R..T.K...ETKGmt.....taSKAS.KPPRKI..KSESD....DLNk.....iMFGKSQewkggpemg......vgsddlnrqsGASK.SD.WK....GQD.LG..L....N.Q....V.S...........FDD.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5D2S4A2_GOSMU/1-211               ................................................................................................................................................MDGA..G..QLEngrCKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....D..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN.......RQ----.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vdtefapaqefpdiatsgemvdg..................
A0A0D3DPQ3_BRAOL/1-271               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.S-A.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.-QNGSYH.HPE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.ATp.................................nyG.N.A.LPE......TS..S.A..P.S.MHHHQ....................................................-........----TE..D...D..P.-...V.....KC...EEEE.-.....-....-...-.....-..-.----E.IV..Q--.....-PNK.K.RKP..-..N.....S..K.A...GTAT.........TKGK.K-PRKP..KEEND....SKT.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A2H3XTM7_PHODC/1-276               ..................................................................................................mdgrgrlgtriwefsnhtghaesvlkpvsglsvpnsigsgrqetsl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.-RM................................................................SSYINRD.SI...AG.E....CN...............................SGA..M..D.F.S..W.I.PQ....................................R.S.F.MSQ......TK..N.M..N.S.SHA-T....................................................P........VNSEMI..D...A..Q.G...V.....PV...AAEG.A.....M....Q...E.....G..V.LEAKP.LK..VRK....kHPST.R.KNN..H..T.....A..T.K...LLRQ.........KEPK.KQPSVP..AEKKG....---.......---NST.........................SKGK.RE.KK....TQD.II..V....D.G....T.M...........VDF.SN.VPV.PVCSCTGVP....HQC.YRWGAGGWQSSCCTMSISEYPLPMSPSRPGARLAGRKMSIGAYRKLLHRLAAEG.HDL.SY.AVDLKD..HWARHGTNKFVTIK.........................................
A0A3B6IT63_WHEAT/1-349               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg..agHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqhqhqhhhqnq..hqqqhqhqhqhsreqKVL..H..A.V.P..L.G.PAghighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A2J6M965_LACSA/1-290               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALD.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................S--..-..-.-.-..-.-.--....................................-.A.M.QQR......DE..A.I..A.T.LRF-Qgtnnnnn.....................................nnfiistlP........-ENTPT..Q...G..Q.N...R.....NF...TNQE.I.....H....H...M.....F..E.IPNDN.TY..QVQ.....VQVQ.S.TTK..-..S.....K..S.K...SPRVrrrr.gesvKFTN.QEIHHM..LEIGE....D--.......-----TyevepqsyktkgvkspmigrrrgesVKLK.VE.EW....KDE.SE..L....N.Q....V.S...........FDD.LT.MPV.PVCSCTGVP....QPC.YRWGSGGWQSACCTTTMSMYPLPQVSNKKYSRVGGRKMSGGAFSKLLTRLSSEG.YDL.ST.PLDLKE..HWAKHGTNRYSTVK.........................................
A0A1U8KKL4_GOSHI/1-311               ...........................................................................................................................................mhqps----..-..---...--...................................----.-.---.........---.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A427B317_ENSVE/1-279               ................................................................................................................................................MDGD..G..GMG...MR...................................NWA-.Y.YEQ.........TLK.GNLG.LQ.LMS.PVAa...eHE...S.T...KP...............LLSNGGF.-.L...............-RR.DCDVAEP.SVP................................................................MGFVR-N.GW...IN.Y....RE..............................nKMV..H..M.L.P..L.N.HG....................................Y.S.V.LPD......AH..G.V..H.A.PSMIQ....................................................-........-----Q..M...V..P.P...-.....--...PKDE.K.....V....-...-.....P..A.MENET.VT..AKE.....APLK.K.RSQ..-..A.....Q..A.R...PCKP.........SKPK.KPKKAP..TPKDE....-TN.......GHS--G.........................GRGR.AI.KK....NTD.IV..I....N.G....F.D...........LDI.SR.IPT.PVCSCTGTL....RQC.YRWGVGGWQSACCTTSISMYPLPMSTKRRGARICGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRP..YWAKHGTNKFVTIR.........................................
A0A2G9HBJ5_9LAMI/1-280               .............................................................................................................................................mde---D..-..--S...LR...................................NWG-.Y.YEP.........PLK.GHLG.LQ.LMS.SVA.....ER...D.T...KP...............FLSGRDN.P.I...............-MV.STNGAFH.PRDcvvte......................................................ppvthMDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.N.PY....................................N.S.V.LAE......PS..GtH..H.S.IQMVH....................................................-........------..Q...P..D.-...-.....--...TTKE.A.....-....-...R.....P..S.MEESV.VK..KEG.....GPAK.K.RSA..A..A.....T..P.K...TPKG.........KKPR.K-GSTP..KENGN....---.......---PSV.........................QRAK.TA.KK....NVE.VV..I....N.G....V.D...........MDI.TG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..YWAKHGTNKFVIIR.........................................
A0A2R6RIS5_ACTCC/1-299               ..........................................................................................................................................ehnsti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.S...--...............AIREKNM.-.-...............ALD.ERRRAFA.ERD................................................................MAMLQRD.AA...IA.E....RNsav........................eerdKAL..S..A.L.Q..F.Q.ESsm................................neN.H.I.SPDspgngmTC..G.A..K.P.LYYHQ....................................................Q........MHPIPQ..P...V..E.-...T.....GY...DPRE.I.....P....T...S.....N..P.FQSTG.VA..YEP....eKLPR.K.AKQ..A..E.....Q..T.K...GSST.........KKPS.KSPRKG..KRVSE....DLSh.....gW-KSEQdldd................ndedlDGEL.GL.WK....DDD.LG..L....N.Q....I.H...........FDE.ST.MPA.PVCSCTGLP....QPC.YKWGNGGWQSACCTTAMSVYPLPQMSDKRYARVGGRKMSGSAFAKLFHRLIVEG.HDL.ST.PLDLKD..HWSKHGTNCYSTVK.........................................
A0A2R6XFD0_MARPO/97-401              ................................................................................................................................................MDDE..G..RVG...VR...................................RRM-.I.CDQ.........---.--TA.LK.LVK.AIA.....ER...D.A...--...............AILERNS.-.-...............AIA.EKKAACV.ERD................................................................AALLRCD.LA...FS.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.VER......DA..A.V..A.A.LGAVRagkfatftewtrhgsp....................navtsktlqppvvdssP........--FSVD..F...A..S.A...A.....AC...QWKS.A.....V....G...R.....T..N.ICSEY.IQ..KQS.....MAGN.V.RES..Q..R.....D..L.R...SKRKi.......gKDTK.QGFLSS..RK---....---.......-----Rppeq................klliyQREN.LD.QN....ERGsSV..T....E.E....V.A...........DEN.IC.NSI.PYCSCTGVN....QPC.YKWGNGGWQSACCTTMISMYPLPMNPKKRSSRLAGRKMSAGAFEKLVEKLTLEG.VNV.RC.PIDLKD..HWAKHGTNRYVTLR.........................................
A0A5N6PUE6_9ASTR/1-292               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHIG.LQ.LMS.PFG....dLR...D.T...KP...............FLSSRET.P.Iminpn....ggaataA--.----AYH.HHHhnq..........................................................plpMHYMR-D.SW...A-.Q....RE...............................RLL..H..M.L.P..G.N.PN....................................-.-.F.VSN......TS..I.S..N.P.IHIMQ....................................................P........VGPSNS..T...K..D.-...P.....RI...NMED.I.....G....G...G.....T..G.GDDDG.DG..DGI.....SPVK.K.RSS..S..A.....-..L.S...TASK.........TRGK.K-PRKA..KEPA-....--N.......Q---SG.........................QRTK.LM.RR....NID.LV..I....N.G....V.D...........MDI.SG.IPI.PVCSCTGSP....QQC.YRWGSGGWQSACCTTTVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.DN.AIDLRA..HWAKHGTNKFVTIR.........................................
A0A1E5V748_9POAL/72-415              ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YDP.........-VK.SDLG.LQ.LMS.SMP....aDR...D.T...KS...............LLPAGAF.-.Lqqh.........ghhNAP.HQLHSHH.SRDsngggasgg..............................................mptephsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghprhgghp...........gngghavhhhptgY.G.M.MPD......--..A.P..H.T.LQMMQ....................................................P........-QLQSQ..L...Q..E.-...P.....PP...CKED.G.....V....P...P.....L..L.VEDHS.VV..KTE.....PPVK.K.RQQ..G..Rqq.drQ..P.K...SPKP.........KKPK.K-AAVP..REDG-....---.......TINGHA.........................PRGR.GP.KK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.SN.PIDLKT..FWAKHGTNKFVIIR.........................................
A0A1U7Z932_NELNU/1-277               ................................................................................................................................................MDDD..G..-LN...IR...................................NWG-.Y.YEP.........--R.GHLG.LQ.LMS.TVA.....ER...D.T...KT...............LISGRDS.T.V...............-MV.GANGAFH.PRDcgvs.......................................................eapvhMEYVK-D.SW...MN.-....RE...............................RFL..H..M.L.P..G.N.PN....................................F.A.V.LSE......AS..T.A..H.H.LQMIQ....................................................P........------..-...-..-.-...P.....DS...SKDE.R.....V....-...-.....A..R.IEEAG.GK..K-D.....GPLK.K.RQS..G..R.....A..Q.K...SPKA.........KKPK.R-VPAP..KDESN....S--.......----SV.........................SRAK.AG.KK....NMG.VV..I....N.G....V.N...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNL.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
M4CTH5_BRARP/1-296                   ................................................................................................................................................MDDG..G..HRDngwHKas...............................hgKW-M.M.QQHq.......pQQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..A.A.LQY-R....................................................D........SSMSTS..R...Q..H.Q...P.....HI...HHML.Q.....V....T...E.....N..T.YETRE.TE..TSP....pPPTK.P.KRG..-..R.....K..A.K...EPKAap.....anKRGP.KTQRKV..KKENE...dDLTk.....lMFDEEA.........................TGSK.SD.WR....GQEtVG..L....N.R....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A445JC15_GLYSO/1-279               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....ER...D.T...KP...............FLPGRDP.-.A...............MLM.GANGTFH.PRDcvvs.......................................................eapmpLNYVR-D.SW...IN.Q....RD...............................RFF..H..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..G.A..P.N.LKIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.VEEVV.VK..KEL.....GKSK.K.RHT..K..G.....A..L.S...TPKA.........KKPR.K----P..KDNS-....--N.......VPV---.........................QRAK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SD.LPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A151T2P1_CAJCA/1-278               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMN.....DR...D.T...KP...............FLPGRDP.P.-...............MLM.GANGTFH.PRDcvvs.......................................................easipLNYVR-D.NW...IS.Q....RD...............................RFF..N..M.Q.P..P.N.PN....................................Y.T.V.LPE......TS..G.A..P.S.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.VEELV.VK..KEA.....GQPK.K.RQT..R..G.....A..L.T...TPKA.........KKPR.K----P..KDNS-....--N.......VS---V.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A1S4CDX5_TOBAC/1-309               ...............................................................................................................................................m-DG-..N..GMN...IR...................................NWG-.F.FEPa......atVLK.GHLG.LQ.LMS.SMD.....E-...-.-...KP...............LFGNIRD.-.H...............HHH.HNHQTHQ.PHHptvmestnggafh......................................hhrvcgisetpmpIEYMR-D.SW...VN.H....KDy............................rdKYL..N..V.L.S..G.N.HHyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQIHE....................................................-........------..-...-..-.Q...P.....NL...VKVE.P.....D....-...-.....P..Q.LEEVC.LE..RDI....gGLAK.K.RGA..G..K.....SqlL.K...SPKS.........KKAK.KATRIP..KVEST....---.......-P--SV.........................PRAR.AP.RK....SAE.VV..I....N.G....I.T...........MDI.SV.IPI.PVCSCTGVA....QQC.YRWGCGGWQSACCTTNLSSYPLPMNTKRRGSRIAGRKMSLGAFTKVLEKLASEG.YNF.SN.AIDLKP..YWAKHGTNKFVTIR.........................................
A0A2I0INV4_PUNGR/1-94                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPP.PVCSCTGVP....RQC.YKWGSGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGGAFGKLLSRLAAEG.HDL.SS.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1Q3C349_CEPFO/1-152               .............................................................................................................................................mpl----..-..---...--...................................----.-.---.........---.-VMN.KK.IMG.ILV.....EK...D.A...--...............AIRDRNM.-.-...............AIE.EKKEALL.APD................................................................QALEQPD.KA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.M.MER......DN..A.I..A.M.SQYQEnainyplgg.................................gaqrggkrihH........ATYHPI..D...M..D.-...K.....TL...NTGE.I.....H....V...I.....G..A.FPIST.IP..P--.....EAVM.S.RWA..-..K.....R..T.K...DNKVv.......pLKTL.KSPRKT..EK---....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------swg......................................
A0A5A7VKB5_CUCME/1-277               ...............................................................................................................................................m-DGD..-..ALN...MR...................................NWG-.Y.YEP.........SLK.AHLG.LQ.LVS.TIG.....ER...D.V...KH...............FMPGRDP.-.S...............AIV.NMNAAFH.PRDsvvs.......................................................eapvsTNWAR-D.GW...MN.Q....RD...............................KLF..N..V.L.S..P.N.TS....................................Y.S.L.LAE......TS..A.A..Q.P.LQMLQ....................................................P........------..-...-..-.-...L.....DT...SRDE.M.....V....-...-.....L..K.IEEPP.VK..KGT.....KQPK.K.RQN..G..G.....A..P.K...SPKP.........KKPR.K----P..KSNDP....---.......----SF.........................QQVK.AP.KK....KME.LV..I....N.G....F.D...........MDI.SS.IPI.PVCSCTGTP....HQC.YRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
BBRD_ORYSJ/1-331                     ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDD.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A368PY20_SETIT/1-341               ................................................................................................................................................MDDD..G..NLS...IR...................................NWG-.F.YDT.........-MK.GNLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPTSAF.L.Qhh..........ghhNAP.HQLHSHH.SRDsgggggasg.............................................smptephsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghgghp...........ghgghavhhhptgY.G.M.MPD......--..A.P..H.T.LQMMQ....................................................P.......qLPSQPQ..E...-..-.-...P.....PP...CKED.H.....V....P...T.....P..P.VEDHS.VV..RTE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-PAVP..REDG-....---.......AVNGHA.........................PRGR.GP.RK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNAKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A0D2Q547_GOSRA/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqH........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
M4END8_BRARP/1-286                   ...............................................................................................................................menggqcangsdylkga----..-..---...HS...................................MWNM.L.PHHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKIEALA.ARD................................................................QALLQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................N........SLNFAL..S...G..G.K...R.....CQ...GADD.D.....D....D...D.....V..L.FTIDD.LC..P--.....----.-.TTS..T..N.....T..T.K...AIKR.........KKEN.K--PKG..KKVGE....DLN......lLVAAPG.........................KKRK.KD.WD....TNH.FG..L....N.L....V.T...........FDE.KT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTTLSLYPLPQKPNKRHSRVGGRKMSGNVFSRLLSHLAAEG.YDL.SS.RVDLKD..YWARHGTNRYITIK.........................................
A0A5J5ARF5_9ASTE/25-147              ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVG.....ER...N.T...KS...............FLSGRDH.T.V...............-MV.NTHGVFH.PRDcgvs.......................................................eapvhMDYVR-D.SW...VN.Q....RE...............................KFL..N..M.L.P..G.N.PN....................................F.A.V.LPE......PS..G.T..H.S.MQILQ....................................................P........PESSK-..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------dvrvgmedp................................
A0A078I0K6_BRANA/1-282               ................................................................................................................................mesdgrynpdyykegt----..-..---...HS...................................VWNT.M.PNHhqt..kedqHNA.LVMN.QK.IMS.ILA.....ER...D.A...--...............ALKERDD.-.-...............ALA.AKQEALA.ARD................................................................EALDQRD.KA...LS.L....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DS..A.L..S.A.LQF-R....................................................-........-EHNLN..Y...I..L.-...S.....RA...KLGS.S.....H....L...P.....N..P.SPLST.IP..HEA.....APSK.R.K--..-..-.....-..-.K...KRKP.........ET--.--RSKG..KRVGE....DLN......hHVASPG.........................KKCR.KD.WD....SNV.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RHC.YKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQG.HDL.SS.PVDLKD..YWARHGTNRYITI-m........................................
A0A2P5XDJ8_GOSBA/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpivs.......................................................eahipMNYVR-D.SW...IA.D....RD...............................KFF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPKA.........KKPK.K----P..KENAN....---.......---SAV.........................QRVK.PA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
B2Z458_VITVI/1-337                   ................................................................................................................................................MDEG..G..HREngrHKadpy..........................kavhsQW-L.M.-QH.........QPT.M---.KQ.IMA.IMA.....ER...D.T...--...............AVQERNL.-.-...............ALS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnslnggnmspcppg.......................cqisrgvkhmhhpqpH........LHHPTH..L...S..E.-...A.....AY...SARE.M.....H....I...G.....D..A.LPVSP.VA..S--.....EAAK.S.RRA..-..K.....R..P.K...EAKPms.....snKKAS.KPLKKP..KREGE....DLNk.....iVFGKSRewkggqdms......sggddlnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.T...........FDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SI.PVDLKD..HWAKHGTNRYITIK.........................................
A0A6D2LAV7_9BRAS/56-258              .............................................................................................gsssnvmpfprdyntvpeapfmsyswlnqhrdskffnnflappdqsrtqpm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..Q.....L..L.Q...IPKPe.......iKRRQ.CSEAGS..KRKLK....DNN......nVLGMQR.........................ERSP.LR.KK....TIS.MV..I....N.G....V.S...........MDI.GC.LPV.PVCSCTGPG....QPC.YRWGCGGWQSSCCTTNVSMYPLPMSTKRRGTRIAGRKMSLGAFRKVLEKLSSDG.FDF.SN.PIDLKS..HWAKHGTNKFVTIK.........................................
A0A5P1FQI4_ASPOF/1-225               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................MALFQRD.AA...IN.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.IER......DN..A.I..A.A.LEYSRgr................................................niS........HHHHHQ..H...Q..N.I...P.....HS...SSLE.S.....S....G...S.....P..Y.NHRGE.VH..INE.....QINE.P.KAE..T..V.....V..S.K...KSKQ.........RKNK.RSNS--..-ELNN....NLK.......PQDVIS.........................KKHR.KE.WK....VED.LG.gL....N.E....V.V...........FDE.SS.MPV.PVCSCTGKY....QPC.YKWGNGGWQSACCTTTISMYPLPVMPNKRHARVNGRKMSGSVFTKLLSKLASEG.HDL.SM.PLDLKD..HWSKHGTNRYITIK.........................................
A0A1J7HNR7_LUPAN/1-286               ................................................................................................................................................MDGD..N..GLN...MR...................................NWGY.Y.-EAt.......tPFK.NHLG.LQ.LMS.SMP.....EK...Q.-...-P...............LLGARNA.-.-...............---.-AAAPFH.RRDtgml.......................................................qpaypMEYMR-D.AW...IG.Hn..hRD...............................KFMniN..M.I.P..T.N.NN....................................Y.S.V.VPE......TS..S.A..H.Q.MQMVD....................................................-........--VQSQ..P...A..D.-...-.....-Q...SEEE.T.....P....-...-.....-..-.VEEEP.PV..EMV....nGTGK.K.RGK.gA..K.....V..P.K...ASKA.........KKPK.RGPREP..KDEN-....---.......TT--SV.........................QRAR.TI.KR....SAE.IV..I....N.G....I.D...........MDL.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLKN..YWAKHGTNKFVTIR.........................................
A0A5J5BWQ5_9ASTE/2-306               .........................................................................................................................................dhnhlti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.G...--...............AIREKNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...IA.E....RNaaiger..................ddaiaalQ--..-..-.-.-..-.-.-Frdssmngn...................nmtppdspgN.G.I.IRG......AK..H.I..H.H.QQ---....................................................Q........MHHMPL..L...P..E.-...A.....AQ...YIRE.I.....P....T...S.....D..A.FQITE.VA..SES.....AKPK.K.VRQ..M..K.....E..T.K...AIST.........KKSL.KSAGKG..KNGSE....GLSk.....qIITTSNgwknep............dmggdedLDNK.LI.MW....KDD.SG..L....N.Q....V.N...........FDD.SA.MPV.PVCTCTGIP....QPC.YKWGNGGWQSACCTTTMSMYPLPQMSNKRHSRVGGRKMSGSAFTKLLNRLGGEG.HDL.ST.PLDLKD..HWAKHGTNRYST--qk.......................................
Q8LKV1_SOYBN/1-282                   ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LA.GTNGAFH.HRDiggmp......................................................qatypMEYMR-D.AW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VI..EKE....nGTRK.K.RQS..S..K.....V..P.K...SPKA.........KKPK.RGPRAP..KDES-....---.......AP--AV.........................QRAR.IP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A1U8L3Y7_GOSHI/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KS...............FIPMRNP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................eapnpMNYVR-D.SW...IS.Q....RE...............................KFF..N..M.L.P.gI.S.PN....................................Y.G.I.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.S...P.....NS...STRD.E.....R....V...V.....G..R.VEEPP.AT..KES.....VELK.K.RQS..E..S.....A..P.K...TPKT.........KKPR.K----P..KDNTN....---.......---SSV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.NN.PIDLRT..HWARHGTNKFVTIR.........................................
V7CPG3_PHAVU/64-342                  ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............YLPARDP.A.L...............-LM.GANGTFH.PRDcvvs.......................................................eapmqLNYVR-D.NW...TS.Q....RD...............................RYF..N..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..V.A..P.Y.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.IEELV.VK..KEG.....GQSK.K.RQT..K..G.....A..L.T...TPQA.........KKPR.K----P..KDNS-....--N.......VPV---.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A1U8AMF6_NELNU/1-329               ................................................................................................................................................MDDG..S..QREngrHKdqyk...........................tvhsQW-M.I.PQH.........--Q.M---.KQ.VMA.LMA.....ER...D.A...--...............AIQERNV.-.-...............ALA.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.A.LEYREnalsgsgvptc..............................ppgcgvprgtkH........VHHLTH..L...T..E.-...A.....PY...HARD.M.....H....I...T.....E..A.YPLSS.AP..A--.....EAHK.P.RRA..K..R.....T..K.K...ESKAv......plKRSQ.QPSSKG..KKGGE....DLNk....lvTV---Aklhdwrsgqda...ngsgedlkkqlAVSK.PD.WK....GQD.LG..L....N.Q....V.N...........FDE.ST.MPV.PVCSCTGVL....QQC.YKWGNGGWQSACCTTTLSSYPLPVMPNKRHARIGGRKMSGSAFTKLLSRLAAQG.HDL.ST.PVDLKD..HWAKHGTNRYVTIK.........................................
D7KCI3_ARALL/1-277                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............-MI.GPNGSYH.HQE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TAp.................................nyG.N.V.LPE......TS..S.A..P.S.MQMNL....................................................-........-HHHHQ..T...E..E.-...-.....--...----.T.....-....-...P.....V..K.LEEEI.VV..Q--.....-TKK.R.KTN..A..K.....A..G.S...TAKA.........KK--.--PRKP..KDENS....NSN.......NNNTNV.........................SRVK.PV.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A2J6KJR6_LACSA/1-330               ................................................................................................................................................MDES..G..HRE..nGRqkp.............................pqgQW-L.M.-QH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MALLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.MER......DN..A.I..T.T.LQYREnsmnnsnnnnns...........................nntpspcppgcqiS........RSVKHV..H...H..P.H...A.....YL...QHHE.M.....Gg..gI...G.....D..S.IPTSP.PA..---.....PEPK.S.RRV..-..K.....R..V.K...ETKPp.......aKKTS.RMSKKV..KMECD....DLNk.....aMFEEPHdwnkggddsg....ggggggvddlnRGVK.SE.WK....DQD.LG..L....N.H....V.A...........FDE.ST.MPI.PVCSCTGVF....RPC.YKWGNGGWQSSCCTTTMSMHPLPSLPNKRHARVGGRKMSGSVFNKLISRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
B9GQZ0_POPTR/1-336                   ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqgQWL-.M.-QP.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnslpsgnmttcppgf......................hnsrgvkhmhhqqqqH........THHLPH..M...N..E.-...G.....PY...GTRE.M.....Q....T...S.....D..A.LPVSP.VA..S--.....EVAK.P.QRG..-..K.....R..P.K...DAKAtp.....snKKTS.KSPRKV..KRESD....DTD.......MFGKSHewkngqdmd......gggddpnkqlAASK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPA.PVCSCTGVF....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.QDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
G7I6G1_MEDTR/1-340                   ................................................................................................................................................MDDR..E..NGR...HKadqy..........................ksaqgQW-L.M.QQH.........QHQ.HPSM.KQ.IMS.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.T.LQFREnalanggmsscppg.......................cqisrgvkhihhlpqQ........VNHLPN..M...G..D.-...S.....SY...GTRE.L.....H....T...T.....D..A.LPAAP.VS..L--.....EVGK.P.PRR..A..K.....R..P.K...ESKSds.....pnKKTP.K-SRKV..KKEGD....DLNk.....tMFANNKelewksseei....ingdddlnkqlAISK.AD.WK....PQD.LA..L....N.Q....V.A...........YDD.ST.MPA.PACSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0K9RZC6_SPIOL/36-231              ....................................................................................trngfspfqgtqnnpdgglpavpircmpineptnvvadaqtqiteppsipiknpkrnpid----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........-AAL.K---EP..KPKI-....--Kk.....gRSSKAK.........................GGGA.RK.NK....NPN.FH..N....N.D....S.S...........TEA.SG.IPA.PICSCTGAA....RQC.YRWGSGGWQSSCCTTNISEYPLPMSATRAGARTAGRKMSHGAYDKLLQRLSAEG.YDL.EF.PIDLKD..HWAKHGTNKFVTIK.........................................
A0A0D2PW98_GOSRA/1-211               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN.......RQ----.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vdtefapaqefpdiatsgemvdg..................
A0A2I4H7T8_JUGRE/4-233               ..................................................................................ysnrntmipeatagasvphftwfypgsflsaskassnpfqgtqtnpepglpvgpirtiaatt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.EPMKN.VN..STT.....KTAK.G.RKQ..K..N.....S..M.K...GPNQis....skaFKPK.QAKKTP..KKTK-....---.......-GQSMP.........................DGKR.EK.RM....MIN.ID..M....D.K....A.G...........FDS.SE.VPP.PYCSCTGVA....RLC.YKWGAGGWQSSCCTINISEYPLPMSSTRPGARMAGRKMSNGAYGKLLLRLAAEG.RDL.TH.PVDLKD..HWARHGTNKFVIIK.........................................
A0A2G3BW01_CAPCH/1-313               ................................................................................................................................................MDDG..G..QRE...NKrhrmny.......................skggyaPWNV.V.PPYqm.....rdQEA.FIMN.TK.IRM.VFA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKKEALA.ERE................................................................FAIQQRD.TA...FA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFLEstmngtlsc.................................rkrgtkrpnqP........KNHCNN..N...S..D.-...S.....VC...INRD.V.....P....V...A.....D..A.FSIST.MS..S--.....DAGK.A.LQG..-..K.....R..S.K...VNKTm.......sMKSA.KFPRKT..KKVKE....DLN.......RQF-ST.........................DGSK.AE.WD....AQD.LG.sV....N.Q....I.Q...........FDE.ST.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHGRLGGRKMSGSVFSRLLTRLALAD.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
A0A5D2WFM6_GOSMU/1-149               .........................................................................................................................................mmpqhhv----..-..---...--...................................----.-.KEQ.........SNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCRE....................................................N........AKNFPF..G...S..G.-...-.....-I...QRGR.T.....C....K...S.....C..P.VKRTK.VN..KAV.....SSKS.P.R--..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------kikkvaedlnrqvdtefapaqefpdiatsgem.........
A0A4S4DY60_CAMSI/8-289               ................................................................................................................................................MDDD..G..-LN...MR...................................NWGY.Y.EPT.........SLK.GHLG.LQ.LMS.SMA.....ER...D.A...KP...............FLSGRDH.G.V...............-IL.SPNGAFH.PRDctvs.......................................................eapvhMDYMR-D.SW...VN.H....RD...............................KFL..N..M.L.P..G.N.PN....................................F.M.V.LPE......PS..A.T..H.P.LQILQ....................................................P........------..-...-..-.-...P.....DT...SNDE.R.....V....-...-.....-..V.MEDQG.VR..KEG.....GSLK.K.RTG..G..S.....T..P.K...APKP.........KKTK.KGPSVP..KENGN....S--.......----SV.........................QRAK.PA.KK....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
Q2PQR3_9BRAS/1-277                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............-MI.GPNGSYH.HQE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TAp.................................nyG.N.V.LPE......TS..S.A..P.S.MQMN-....................................................-........LHHHHQ..S...E..E.N...-.....--...----.-.....-....-...P.....V..K.LEDEV.VQ..P--.....NNNK.K.RKT..-..-.....N..P.K...AGSA.........TKAK.K-PRKP..KDENS....NNN.......NT--NV.........................SRVK.PA.KK....SVD.MV..I....N.G....V.S...........MDI.SG.LPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A3L6TEV9_PANMI/1-363               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KP...............LLPNGGN.F.Lqhhghh..naqhqhqH--.-------.--Qhhpqhshhprgggggg................................sggapggmpteppavhMDFVRNE.AW...LH.P....SQhhhqhqhq..............hqhqhprqqKVL..H..H.L.P..V.G.PVghvghpghg.................ghavhhrpsgY.G.I.MAD......AH..G.V..H.T.LQMMQ....................................................Pqa....qpQPQPPQ..Q...P..Q.D...P.....PP...TKEE.S.....M....P...Q.....P..P.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKT..FWAKHGTNKFVVIR.........................................
I1L405_SOYBN/1-282                   ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LA.GTNGAFH.HRDiggmp......................................................qatypMEYMR-D.AW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VV..EKA....nGTRK.K.RQG..P..K.....V..P.K...SPRA.........KKPK.MGPRAP..KDEN-....---.......APS--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPV.PVCSCTGVH....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
M4E2L2_BRARP/16-270                  ....................................fhpndsrkikkklfregailplkqaiemdpylsrnhmkpatstskdtglptsnplwfhsyypvprttgidlsqppqaepaelamvpqvrlfppptrgyihdvelksst----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.--M..L..S.....P..S.K...ALKP.........KPQS.KKRSAP..KTPKK....TL-.......----SI.........................PEIK.RE.KK....NPD.IN..V....V.D....IsS...........FDV.SG.VPP.PVCSCTGVP....KVC.YKWGMGGWQSSCCTISISTFPLPMSTTRPGTRLAGRKMSNGAYVKLLMRLAGEG.YDL.TC.PVDLRN..HWARHGTNKFVTIK.........................................
A0A4D9A1R0_SALSN/310-601             ................................................................................................................................................MDEN..G..REN...RRhrmd..........................yhkvpQWNA.M.PQHqi.....kePIT.FGMN.AR.LVM.LCN.....ER...D.D...--...............AIRERDR.-.-...............AMA.EKKAALD.ERD................................................................AAVKQLD.TA...VM.E....RD...............................---..-..-.-.-..-.-.--....................................E.A.L.RER......DN..A.I..A.A.LQFHE....................................................N.......tVNALLV..S...S..A.R...G.....SK...RTHH.P.....T....R...E.....D..C.IRDDA.SY..E--.....APLS.K.KGT..K..A.....K..A.N...KDSP.........MRSA.RSPKKG..KKIGE....DLN.......RQVT-T.........................DGSK.AE.WD....AQD.LG.sM....N.Q....I.M...........FDE.SS.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTSLSVYPLPQMPNKRHARMGGRKMSGSVFSRLLTRLGAAG.QDL.SI.PVDLKD..YWAKHGTNRYITIK.........................................
A0A398ACT8_BRACM/121-278             .............................................................................................................................kpeagevdeslkrrqcggg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....Q..R.A...DPKA.........KKER.K----L..-----....KDN.......IVPRM-.........................QRER.SPlRK....SIE.MV..I....N.G....V.T...........IDI.GC.LPV.PVCSCTGLS....QQC.YRWGCGGWQSACCTTNVSMYPLPMNTKKRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SS.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A6A3BGV6_HIBSY/43-155              ........................................................................................................................rrdepglvvtpirticpttesgnk----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....N..D.WETKI.TQ..VRKh...kYSVK.G.SNQ..-..I.....A..S.K...VLGP.........KQPM.KKPSFP..KKVKG....---.......---PNI.........................PEAK.RE.KN....NLN.VD..L....N.R....T.K...........FDF.SG.VPS.PICSCTGVA....R--.------------------------------------------------------.---.--.------..--------------shqar....................................
A0A1D6KJP9_MAIZE/1-289               ..............................................................................................................................................md-DDD..G..SLG...IR...................................NWG-.F.YDT.........-MK.GNLG.LQ.LMS.SMP....pDR...D.T...KP...............LLPRAGF.-.Lqqhg......hhnasHQL.HAQQSQH.YRDstcgggasg.............................................gmpteqhsihMDFSRNE.AW...LH.P....SHhhqh.......................phdqKVL..H..S.R.P..T.V.PAghvghpghgsh.............pvhgghivhhhpT.G.Y.GSI......SD..A.Q..H.T.LQMMQ....................................................P.......qLESQLQ..E...P..P.-...-.....-P...CKGD.E.....A....P...P.....P..P.IEDHS.VV..STG.....PPVK.K.RQR..G..Qqq.srQ..P.K...SPKP.........KKPK.K-VAVL..PEGG-....ALN.......---GHA.........................PRRR.GP.KK....AVG.MV..I....N.G....I.E...........LDL.AN.LPT.PVCSCTGTP....QQC.YRSCCIFLSSASC-----------------------------------------.---.--.------..--------------hvafl....................................
A0A5A7PWA9_STRAF/1-300               .............................................................................................................................................mde---D..-..--S...LR...................................NWG-.Y.YEP.........PVK.GHLG.LQ.LMS.TVA....aER...D.T...KP...............FLPGRDH.N.P...............VMV.PSNGSYH.PRDcivtd......................................................ppvthMDYVR-D.SW...IN.N...hRE...............................KFP..H..I.F.P..G.N.PY....................................S.P.V.LAD......SS..A.A..G.P.HQSMQ....................................................M........VVHTHQ..Q...Q..E.-...-.....--...-TRS.T.....I....E...E.....P..L.TKKEP.GP..G-P.....GPSK.K.RG-..-..S.....G..P.K...APKP.........KKPR.RGP-GP..KENGNnggnSNN.......NN---Kdgn...................nsnNSAP.RA.KK....NVE.VV..I....N.G....V.D...........MDI.TG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNF.AN.PIDLRT..YWAKHGTNKFVII-s........................................
A0A2P5YAF1_GOSBA/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPARDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appipMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPD......TS..A.T..H.S.MPIWQ....................................................P........------..-...P..L.P...P.....DA...STRD.E.....R....V...V.....G..R.VEEPP.AS..KEG.....VQSK.K.RQG..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IA..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSNKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
A0A199VFR6_ANACO/1-302               ..............................................................................................................................................mk----..-..---...--...................................----.-.---.........---.EHHT.MK.LIA.LMT.....ER...D.T...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAIMQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.I.IER......DD..A.I..A.A.LELAResgmngnaknlhn..........................hqhnhqhhnnlsvV........QPSPPQ..L...S..D.A...P.....YD...HVRE.M.....H....I...M.....E..A.YPISA.AL..END....mKARK.P.KQT..R..K.....E..S.K...AQAAps.....psMKSS.-SKRKS..KRVGG...dDLNss...qvT----Iakthh...............nggggVKKK.NE.WK....DQD.LG..L....N.Q....V.T...........FDE.ST.MPV.PVCSCTGKF....RPC.YKWGNGGWQSSCCTTTLSMYPLPVMANKRHARMGGRKMSGSAFSKLLSRVAAEG.HDL.SM.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5D3CKW8_CUCME/1-313               ................................................................................................................................................MDDG..R..QHEngrHKldyf..........................rgspsPWNM.V.PPNhv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNL.-.-...............ALS.EKKDALA.ARD................................................................EALRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LEI-Rdnasnfplgg................................gvqrktkrlhH.......lSNHMPN..I...S..E.-...T.....SY...GTKD.V.....H....I...T.....D..A.FPITV.IA..S--.....EAVK.S.QQG..-..K.....R..A.K...DNKLv.......sSKTS.KP--PR..KKVGE....DLN......rHAATDG.........................TKYR.TD.WD....GQD.VG..L....N.L....V.S...........FDD.SS.MPA.PICSCTGFA....RQC.YKWGNGGWQSSCCTTHMSMYPLPHLENKRHARMGGRKMSGSVFTKLLSRLAAAG.HDL.SV.PVDLKD..HWARHGTNRYITIR.........................................
A0A397ZKB7_BRACM/1-287               ...............................................................................................................................menggqyangsdylkga----..-..---...HS...................................MWNM.L.PHHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKIEALA.ARD................................................................QALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................N........SLNFAL..S...G..G.K...R.....CQ...GADD.D.....-....-...-.....-..-.-DDDD.VL..FTI.....DDLC.P.TTS..T..N.....P..T.K...EIKR.........KKEN.K--PKG..KKVGE....DLN......lLVAAPG.........................KKCK.KD.WD....TNH.FG..L....N.L....V.T...........FDE.KT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTTLSLYPLPQKPNKRHSRVGGRKMSGNVFSRLLSHLAAEG.YDL.SS.RVDLKD..YWARHGTNRYITIK.........................................
I1K7L4_SOYBN/1-337                   ................................................................................................................................................MDDA..G..HREngrHKaadqy.........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.MIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAYMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.M.LER......DN..A.I..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhvhhpqqQ........VHHIPN..M...G..D.-...A.....SY...NTRE.M.....H....T...T.....E..V.LPAAP.IP..S--.....ETGK.S.RRA..-..K.....R..P.K...EPKSap.....pnKKTS.KPSKKV..KKESE....DLN......nMFGKAHewksgqemv......nggddlnkqlAVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAES.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A5J5ASN2_9ASTE/1-103               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....-MD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTTISIYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLASEG.YNF.SN.PIDLRT..HWAKHG--------fva......................................
A0A0B2PNG6_GLYSO/1-337               ................................................................................................................................................MDDA..G..HREngrHKaadqy.........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.MIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAYMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.M.LER......DN..A.I..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhvhhpqqQ........VHHIPN..M...G..D.-...A.....SY...NTRE.M.....H....T...T.....E..V.LPAAP.IP..S--.....ETGK.S.RRA..-..K.....R..P.K...EPKSap.....pnKKTS.KPSKKV..KKESE....DLN......nMFGKAHewksgqemv......nggddlnkqlAVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAES.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2G5ET17_AQUCA/1-270               ................................................................................................................................................MDDK..A..RLG...HR...................................NWD-.F.-ST.........---.QTVG.VP.FPS.GAN.....EH...H.A...-S...............FLKMGMH.-.P...............HRN.SMIPEAE.GSG................................................................MEFGS-H.VW...VH.Q....RN...............................-FL..S..A.A.K..T.N.PD....................................S.L.H.CTQ......IN..T.E..T.G.LPAVP....................................................-........-ISMFK..P...T..N.G...-.....--...PTND.T.....E....-...-.....-..H.VNNSS.KI..RK-.....QSFT.K.KSN..G..V.....A..S.K...PSKP.........KQPK.KPSDAS..TKKKG....DS-.......------.........................TSTV.KQ.KR....NLD.FV..I....D.G....T.T...........IDF.SQ.MPS.PVCSCTGAF....RQC.YRWGAGGWQSSCCTTSISEYPLPMSSSRPGARVAGRKMSNGAYGKLLQRLAADG.YDF.SD.AVDLKD..HWAKHGTNKFVTIK.........................................
M0U343_MUSAM/48-174                  ....................................................................................................................qatphkmssksprkikeghgddsnklfs----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........ANE.LS.VPA.PVCSCTGKL....RQC.YRWGDFGWQSSCCTSSLSMYPLPVMPNKRHARMGGRKMSGSAFRKLLRCLAVDG.YDL.SM.AVDLKN..HWAKHGTNRYITIR.........................................
A0A0E0B770_9ORYZ/54-339              ................................................................................................................................................MNDD..A..SMSsmgLR...................................GWGA.F.YEP.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KH...............LLSATPF.L.H...............HHQ.HQQHVPH.HHH................................................................QPHHPRD.CG...TN.A....NA...............................---..N..G.N.G..N.G.VG....................................Y.G.M.MLA......TH..T.L..R.M.LQHQP....................................................E........PQPQLQ..H...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..K-P.....PPPK.K.RQQ..G..K.....Q..P.K...VPRP.........KKPK.K-PAAP..REDGA....PP-.......--SAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.RICSCTGAP....QQC.YRWGAGGWQSACCTTTVSTYPLPMSMKRRGARIAGRKMSHGAFKKVLEKLASEG.YNL.NN.PIDLKT..FWAKHGTNK-----e........................................
A0A199UVC2_ANACO/1-207               ................................................................................................................................................----..-..---...MR...................................NWGY.Y.-DQ.........PIK.VNPG.LQ.LMS.SVA.....EH...E.K...KQ...............LFSNGGF.-.L...............-QR.DYSAPET.FAP................................................................IEFLK-N.SW...PN.Y....RE..............................aKMP..Q..M.M.P..T.N.PS....................................Y.D.L.LPS......AN..G.A..H.S.FQIMQ....................................................A........------..-...-..-.-...P.....SP...PKDD.N.....V....A...-.....-..P.MNEPQ.A-..TND.....KPPK.K.RSR..A..R.....P..E.S...ASKP.........RKPK.K-APVP..KEER-....KV-.......--N-SN.........................PRVR.NG.RK....SAD.IV..I....N.G....I.D...........LDL.SG.LPT.PVCSCTGAP....QQC.YRWGVGGWQSACCTTSISVY----------------------------------.---.--.------..--------------r........................................
A0A498HR19_MALDO/1-340               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HN.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQY-Rdnslnsgnvsscppgc...................qisrgvkhvhhtqqqqqH........VHHMPH..M...N..E.-...P.....SY...GSRD.M.....H....T...S.....D..S.ITMPP.DA..S--.....VPTK.S.RQP..-..K.....R..P.R...EPKTvq.....pnKKPS.KSPRKV..KRESE....DLNk.....mTFDKLHdwkggqdmg......sggddlnkqvVVSK.SD.WK....RQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PMCSCTGLL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A453QJ47_AEGTS/34-354              ......................................................................................................................................necgpydncs----..-..---...MF...................................QW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.IER......DN..A.L..A.A.LELARtngfnmnngtgfnpg.....................slngaknfhhqdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A4Y7K3U6_PAPSO/1-340               ................................................................................................................................................MDDS..G..QHGngrHRhesy..........................kqfhpQ---.-.--Fmlp..pqlmKDD.QARI.MK.FMS.ILG.....DR...D.T...--...............AIRERNL.-.-...............AIS.EKDAALA.ERD................................................................LAIMQRN.TA...IS.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.V.MER......DN..A.F..A.A.LKY-Klkssvigssvspacp......................sefdiargttymhqiQ........-HMQQN..H...M..A.K...A.....SY...NPRQ.M.....H....M...H.....D..N.TSLSA.VL..P--.....ESLK.P.GPG..G..R.....-..P.V...ENKVisss.emtaSKPP.S-RKRA..KREGE....GLNk.....hA--TVAntyeqym...........cgngsgeEEED.QQ.WT....KMEqRG..L....K.Q....V.N...........FDA.SN.MLP.PVCSCTGAL....QQC.YRWGKGGWQSACCTKTLSVYPLPVMDNKRSSRIGGRKMSGGAFTKLVSRLTAEG.HDL.SL.PLDLKN..HWSRHGTNRYSTIK.........................................
A0A2R6RMM6_ACTCC/1-309               ................................................................................................................................................MDDS..G..NREngrHKpt...............................qgQW--.F.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKTAMA.ERD................................................................MAILQCD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnmspcppgc......................qisrgvkhmhhpqqqH........GHHHPH..M...S..E.-...A.....SY...TSRD.I.....H....T...S.....E..P.IPMSP.VA..A--.....EPAK.P.RRT..K..R.....M..N.E...ANAVt......pnKKPS.KSSKKV..KREPA...dDLN.......---KQV.........................GVSK.SD.WK....DKD.LG..L....N.E....V.A...........FDE.S-.MPV.PVCSCTGNV....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARIGGRKMSGSAFNKLISRLAAEG.YDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A2H5QGA0_CITUN/1-311               ................................................................................................................................................MDDG..H..HEN...GRykmey........................ykgthaQWNM.M.PQHqm....kepNNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIRERNI.-.-...............ALT.EKREALE.TRD................................................................QALEERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................D.A.L.MAR......DS..A.L..A.A.LQYREaaanfssv...................................ggfqrggkrM........HHPAYQ..S...G..D.V...P....eAL...NSGD.M.....H....A...T.....D..A.KPITI.IP..S--.....-ETK.P.HQA..-..K.....R..A.K...ENKT........vTKPS.VSPRKV..KKVGE....DLN......kKVASDG.........................KKIK.SE.WD....SQD.-G..L....N.L....V.N...........FDE.TT.MPV.PVCTCTGTP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.HDL.SV.PLDLKN..FWAKHGTNRYITI-n........................................
A0A565C4J3_9BRAS/40-334              ................................................................................................................................................MENG..G..QYEngrYKpdyi..........................kgaqsMWNM.L.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.T...--...............ALQERNQ.-.-...............AVS.AKKEAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................Nsl...nfaLSGGKR..N...G..G.D...D.....GF...SVGE.T.....H....K...L.....E..A.FPISI.IP..P--.....EVAN.T.KVN..-..K.....R..K.K...ENKQ.........GQPK.-----V..KKVGE....DLN......hRVAAPG.........................KKSR.KD.WD....SND.VG..L....N.L....V.T...........FDE.TT.MPI.PVCTCTGSA....HQS.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRVEGRKMSGNVFSILLTRLAAEG.YDL.AC.PVDLKD..YWARHGTNRYITIK.........................................
A0A0D9VPE7_9ORYZ/1-94                ...............................................................................................................................................m----..-..---...--...................................----.-.---.........--K.GNLG.LQ.LMS.SVP....aDQ...D.T...KP...............LLQNGTF.L.Q...............HHT.HHNAPNH.PRDcggggasgg..............................................ltseppsvyIDIAHND.AW...MH.S....YQ...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------hqqcillnisicrsrrfmh......................
A0A2I0ISZ8_PUNGR/1-144               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLN.LQ.LMS.SMA....aER...D.T...KP...............FLSGRGD.P.T...............VLV.TTNGAYH.PRDslvsd......................................................tqvpySSYTR-E.GW...MN.Q....RE...............................KFY..S..M.L.P..T.N.PT...................................nY.N.V.LPE......TS..SeH..Q.S.LQMLQmpe..............................................plrD........-DNKMG..K...P..E.-...-.....--...----.-.....-....-...-.....-..-.-EQQA.VK..KE-.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------ngqtkkrq.................................
A0A5N6MKS1_9ASTR/1-260               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MT.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALE.ERKRAFA.ERD................................................................LAVLQRD.AA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.QER......DE..A.I..T.T.LRF-Rgnfinqn.....................................iisttsesP........-ERTQN..H...G..S.K...R.....GY...NYEE.T.....H....H...M.....F..E.IPDDY.QL..S-P.....ENIK.P.RKV..I..K.....K..P.K...SQSS.........RVGT.KRAGIV..TIKP-....DYE.......ASS---.........................SGAQ.LE.AW....KDE.LG..L....N.Q....V.N...........FDE.TG.MPV.PVCSCTGVP....QPC.YRWGSGGWQSACCTTTMSMYPLPLVTSKRYSRVGGRKMSGGAFTKLLTRLASEG.YDL.SN.PLDLKD..HWAKHGTNRYSTVK.........................................
A0A2G2X786_CAPBA/2-67                ....................................................................................................................................qviatisddqan----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....LLE.......MDSDKE.........................ADTQ.LT.SW....KDN.LW..L....N.Q....I.N...........FDE.SA.MPV.MVCSCTGTP....QPC.YKWGHV------------------------------------------------.---.--.------..--------------g........................................
A0A5D2ZQ20_GOSMU/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GYLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpivs.......................................................eahipMNYVR-D.SW...IA.D....RD...............................KFF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPKA.........KKPK.K----P..KENAN....---.......---SAV.........................QRVK.PA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A5J5AQ73_9ASTE/1-281               ................................................................................................................................................MDAD..G..-LN...MR...................................NWG-.Y.YEP.........SPK.GHLG.LQ.LMS.SMT.....EQ...D.T...KP...............FLSGRDH.T.F...............-MV.GANGVFH.PRNcmvs.......................................................easvhVDYVR-D.SW...VN.H....RE...............................KFL..N..M.L.P..G.N.PN....................................Y.A.V.LPE......PS..G.T..H.H.MQILH....................................................P........------..-...P..D.-...-.....-L...SKDV.K.....-....-...-.....V..D.MEDPS.VR..KEG.....GPLK.K.RTG..G..N.....T..P.K...APKM.........KKSK.KGPSVP..KDNGS....S--.......----SV.........................HRAK.PA.KR....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGIR....QQC.YRWGCGGWQSACCTTTMSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAET.YDF.SN.AIDLRT..HWAKHGTNKFVTIR.........................................
A0A6A6M8R2_HEVBR/1-337               ................................................................................................................................................MDDG..G..HREngrHKadqh..........................ktahgQWL-.M.-QA.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.M.MER......DN..A.I..A.T.LQYREnslasgnmsscppg.......................cqisrgvkhmhhpqqH........PHHVPH..S...S..E.-...A.....SY...GTRE.M.....Q....A...S.....D..T.VPISP.VG..S--.....EAAK.S.RRG..-..K.....R..S.K...DAKVmp.....pnKKTS.KSPRKV..KRENE....DLNk.....iMYGKSHewkngqdma......tegddlnkqlVASK.SD.WK....GQD.LG..L....N.Q....I.A...........YDE.ST.MPA.PVCSCTGVF....RQC.YKWGSGGWQSSCCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.YDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A0D9XHB9_9ORYZ/1-338               ................................................................................................................................................MDDD..G..NIT...LR...................................GWGG.F.YEPp.......pPPP.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSASPF.M.H...............HHA.HQHVPHH.QHHarecggaggngga.....................................pnggmppteapsmnMNFVRND.MW...MH.P....QHhs..........................retKVL..H..T.L.N..V.G.HGghivhs.......................ahhdpvgY.G.M.IPG......TH..S.G..H.T.LQMMQ....................................................Q........PEPQPQ..P...Q..P.-...P.....PP...PKEE.C.....I....S...S.....P..L.IEENV.PV..ISE....pPPPK.K.RRQ..G..R.....Q..P.K...VPRP.........KKPK.K-PATP..REDG-....---.......APNPPA.........................PRRW.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
E0CPJ5_VITVI/2-106                   ..................................................................................................................................ggdreirrekvhph----..-..---...-Gtt...............................qnQWL-.M.-QP.........Q-T.M---.EQ.LMA.ILA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAVLA.QRD................................................................LAILERD.AA...IV.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..V.I..S.T.LRYRG....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------nsmnscnwgkrken...........................
A0A4U5MNH1_POPAL/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNQG.LQ.LLSpTMP.....E-...-.-...KP...............SMGERSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYMR-D.VW...IG.H....RE...............................KPP..N..M.L.P..G.N.RN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...DNDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.SA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTANP....QQC.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A078HWN9_BRANA/1-296               ................................................................................................................................................MDDG..G..HRDngwHKas...............................hgKW-M.M.QQHq.......pQQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..A.A.LQY-R....................................................D........SSMSTS..R...Q..H.Q...P.....HI...HHML.Q.....V....T...E.....N..T.YETRE.TE..TSP....pLPTK.P.KRG..-..R.....K..A.K...EPKAaa.....asKRGP.KTQRKV..KKENE...dDLTk.....lMFDEEA.........................TGSK.SD.WR....GQEtVG..L....N.R....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A6G1DMV0_9ORYZ/69-392              ................................................................................................................................................MDDD..G..GLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMS.SVA....aDR...D.T...KP...............LLQNGTF.L.Q...............HHG.HHNAPNH.PRDcggggtsgg..............................................lpseppsihMDFARND.AW...MH.P....SQhqh........................qreqKVL..H..A.L.P..V.G.PAghighpghp.................ghsvhhhptgY.G.M.MPE......AH..G.L..H.T.LQMMQ....................................................P........-----Q..E...P..P.P...-.....--...PKEE.H.....M....P...E.....P..L.IEEHS.VV..RKE.....PPTK.K.RQQ..-..R.....Q..P.K...TPRP.........KKPK.K-PAAP..REDG-....---.......APNGHA.........................PCRR.GP.KK....VVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A1U8M6S5_GOSHI/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KS...............FIPMRDP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................eapipMNYVR-D.SW...IS.Q....RE...............................KFF..N..M.L.P.gI.S.PN....................................Y.G.I.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.S...P.....NS...STRD.E.....R....V...V.....G..R.VEESP.AT..KES.....VELK.K.RQS..E..S.....A..P.K...TPKT.........KKPR.K----P..KDNTN....---.......---SSV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.NN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A5N6NVY4_9ASTR/1-350               ................................................................................................................................................MDDN..G..HRE..nGRqkqpqgqvsfvytlvlc.fksyfhclypstnwvsyQW-L.M.QHQ.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............AIQERNL.-.-...............AMS.EKKTALA.ERD................................................................MALLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmshtnnntss...........................sscppgcqisrnvK........-----H..V...H..H.P...Q.....QY...HQED.T.....N....L...GggaggS..L.LPVSL.PP..---.....EPTK.F.RRA..-..K.....R..S.K...DIKSvt....stsNKNS.RSSRKV..KLECD....DLNk.....aMYEDTHdwegg..............gdgelnHGSK.PE.WK....DQD.LG..L....N.Q....V.A...........YDD.TT.MPI.PVCSCTGVF....RPC.YKWGNGGWQSSCCTTTMSVYPLPSLPNKRHARVGGRKMSGSVFNKLISRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A0E0EVC0_9ORYZ/1-42                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-------------------------------------MSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
D7LL18_ARALL/1-296                   ...............................................................................................................................................m-ENG..G..QYDngrFKpdyf..........................kgaqsMWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKKEAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.Y..A.A.LQHHE....................................................Nsl...nfaLSGGKR..V...D..G.D...D.....CF...GIGE.P.....H....K...L.....H..V.VPLST.IP..P--.....EVTN.S.TKV..T..K.....R..K.K...ENK-.........----.QGQSKV..KKVGE....DLN......rRVAAPG.........................KKSR.TD.WD....SQD.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGSA....HQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEG.YDL.SC.PVDLKD..YWARHGTNRYITIK.........................................
A0A2G9GYT6_9LAMI/1-295               ........................................................................................................................................mdhnhlti----..-..---...--...................................----.-.---.........---.----.KT.FMA.ITA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...VA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.M.QER......DE..A.I..A.S.LQFREssmndnttipds............................leselasgakslH........YQQQMH..M...S..E.T...-.....AY...SPRG.S.....L....-...-.....-..R.GGDNT.IT..EGS.....ETAK.P.RRG..-..R.....Q..P.K...DGKA.........TKSV.KTPRAG..KRAAE....GLS.......KEVNSNgwnneqg...........lesddedLDKQ.VS.W-....KDN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCTCTGSP....QPC.YRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFSKLLNRLAAEG.YDF.SA.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A6D2IG05_9BRAS/20-213              ..............................................................................................................................yfpvarttgidlsqvpea----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...DPDE.A.....V....M...V.....P..Q.ARLFP.PP..TRE.....SRND.T.ETV..K..Q.....T..S.T...NLSP.........SKAL.KPKPQI..KKRSA....PKN.......-PK-SI.........................PETK.RE.KK....NPD.IN..I....D.I....S.S...........FDV.SG.VPP.PVCSCTGVQ....RIC.YKWGMGGWQSSCCTISISTYPLPMSTTRPGSRLAGRKMSNGAYVKLLMRLAGEG.YDL.TL.PVDLKN..HWARHGTNKFVTIK.........................................
A0A1U7V3X9_NICSY/1-282               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGMYH.SRDsivpe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.N.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMVQ....................................................-........------..Q...P..D.-...-.....--...VTED.V.....R....-...-.....V..N.AEEPS.VK..NES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKLK.KGSSVP..KENGT....---.......-PR--V.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YSF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A1R3HVQ4_COCAP/1-303               ...............................................................................................................................mdgtrqqengrykpdyy----..-..---...-Kgv...............................hpPWNM.M.PQHhm....keqNNA.LSMN.KK.IMS.IFA.....ER...D.A...--...............AIQELNI.-.-...............AIS.EKKEALA.ARD................................................................EALLERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................G.A.L.MER......DN..A.L..A.V.LQYREnamnf.........................................pmqrgvK........--RMHP..T...Y..H.S...T.....DV...GEDG.E.....H....V...T.....D..A.LPVTT.IA..S--.....-EEG.K.RCS..V..N.....G..I.K...DNKV.........VSS-.KPPRKV..KKVAE....DLN......rQAVTEV.........................KRCK.SE.WN....SQD.VG..L....N.L....I.N...........FDE.TR.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLISRLAAEG.QDL.SI.PLDLKN..YWARHGTNRYITIK.........................................
B8BFL7_ORYSI/1-342                   ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A200Q549_9MAGN/71-155              ..........................................................................................................................................rgckdy----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.-----TGVL....HQC.YKWGKGGWQSACCTSTLSMYPLPTVPNKRHSRLGGRKMSGSAFNKLLSWLLAEG.HDL.LT.PLDLKD..H-------------cpdmgq...................................
C5Z506_SORBI/1-348                   ..............................................................................................................................................md-DED..G..SLG...IR...................................NWG-.F.YDT.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KS...............LLPNGAF.-.Lqhhg......hhnapHQL.HMQHSQH.PRGpagggasgg..............................................mptesqpihMDFSRNE.AW...LH.Q....SHhqr........................pseqKVL..H..S.R.P..I.R.PAghaghpghgghp...........ahvghivhhhptgY.G.M.VSD......--..A.Q..H.T.LQMMQ....................................................P.......qLETQLQ..E...P..P.-...-.....-P...CKEE.E.....A....P...P.....P..L.IEDHA.VV..STG.....PPVK.K.KQR..G..Rqq.nrQ..P.K...SPKP.........KKPK.K-IAVP..LEDG-....AL-.......--NGHA.........................PRRR.GP.KK....TVG.MV..I....N.G....I.E...........LDL.AT.IPT.PVCSCTGAP....QQC.YRWGPGGWQSACCTTSISTYPLPMSTKRRGARISGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
M0T1D8_MUSAM/50-225                  ................................................................................................................................rdcdvaepsvpmgfmr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.----N.VT..AKE.....APLK.K.RSQ..-..A.....Q..A.R...PCKP.........SKPK.KPKKVP..TPKD-....ETN.......GR--SG.........................GRGR.AI.KK....NTD.IV..I....N.G....F.D...........LDI.SR.IPT.PVCSCTGTL....RQC.YRWGVGGWQSACCTTSISMYPLPMSTKRRGARICGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRP..YWAKHGTNKFVTIR.........................................
A0A4S4E922_CAMSI/26-338              .......................................................................................................................................dctavphav----..-..---...--...................................----.-.---.........--E.HNLTiKT.YMA.IMA.....ER...D.A...--...............AIRDRNM.-.-...............ALD.ERRRAIA.ERD................................................................MAMLQRD.AA...IA.E....RNsai........................derdKVL..A..A.L.Q..F.R.ESsmnenn.......................ispdspgN.G.V.LRG......--..G.A..K.H.LHHHQ....................................................Q........MHHSVA..Q...L..A.E...T.....EY...DPRK.I.....P....T...S.....N..P.YQSTE.VA..C-E.....TTTK.P.RKV..-..K.....Q..A.K...ETKT.........KKPS.KSPRKG..KRGHE....GVSq.....aAMSTSNgwenedd...........lvgededLDGR.LV.MW....KDN.LG..S....N.Q....V.N...........FDE.ST.MPV.PVCSCTGLP....QPC.YKWGSGGWQSACCTTTMSMYPLPQMSNKRHARIGGRKMSGSAFTKLLNRLAAEG.HDL.FT.PLDLKD..HWAKHGTNRYNTVK.........................................
A0A5D2S131_GOSMU/1-285               .........................................................................................................................................mmpqhhv----..-..---...--...................................----.-.KEQ.........SNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....D..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A0D3CA79_BRAOL/1-269               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.QPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TSn.................................nyG.N.I.LPE......TS..S.A..Q.S.MRHHQ....................................................T........----IE..E...Y..P.-...-.....--...VKHE.Q.....-....-...-.....-..-.VEEIV.--..Q--.....-TNK.K.RKP.nT..K.....P..G.A...SAKA.........KK--.--PRKP..KEESD....K--.......-----S.........................IKVK.QA.KK....SVD.FV..I....N.G....V.N...........MDI.SD.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A5D2WXK6_GOSMU/42-234              .............................................................................................................qrtgihhepglivspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---ASI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A565CFF4_9BRAS/2-291               ...............................................................................................................................esengrykpdyykgtqs----..-..---...--...................................VWTV.M.PQHqi....keqHNA.LVMN.KK.IMT.ILA.....ER...D.A...--...............AIKERNE.-.-...............AVA.ARKEAXA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......ES..A.L..N.X.LQYRE....................................................Nnl....nyILSCAK..R...G..G.S...Q.....SC...LTEE.S.....H....L...P.....D..P.XPIST.IP..P--.....EAAN.K.RPA..-..K.....R..K.K...EXKQ.........GIRS.----KG..KKVSE....DLN......rQVASPG.........................KKCR.KD.WD....SND.XG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGTA....HQC.YKWGNGGWQSSCCTTTLSEYPLPQMPNKRHSRMGGRKMSGSVFSRLLSRLAGEG.HEL.SS.PVDLKD..YWARHGTNRYITIK.........................................
A0A3L6PFL1_PANMI/1-328               ................................................................................................................................................MDNL..G..HREngrQRpeqf..........................kavhtQW-M.M.PQL.........--K.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqgp....................plngtknihhhdqlshV........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIAT.AP..GSI.....GKGK.KpRKN..N..S.....Q..A.S...PLKRps....gvlRKTK.KAACDW..KNGGV....SGG......gADSTRA.........................SVMK.NE.WK....DQD.LG..L....N.Q....V.P...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A6A4Q7M0_LUPAL/1-306               ...............................................................................................................................mdggrqhqncrqkieyy----..-..---...-Rga...............................hsPWNM.D.AQHqhe..vkepNNA.LVMN.KK.IRS.IIA.....ER...Q.A...--...............VILELEL.E.A...............AIS.EKNEALA.ARD................................................................LALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DI..A.L..A.A.LQNWNnt...............................................vnlSl.....ggVQCGSK..R...T..H.Q...A.....TY...STKD.M.....P....I...R.....D..A.APVTV.IT..A--.....EAAK.S.RQA..-..K.....R..S.K...ENKV.........SNYK.A-SKSP..TKLGE....DLN......rHASSQG.........................TKIK.SE.WD....KLD.VG..L....N.L....V.A...........FDE.TT.MPA.PVCTCTGVP....RQC.YKWGSGGWQSSCCTNTLSMYPLPQLPNKRHTRIGGRKMSGSVFTRLLSRLASEG.HDL.SI.RLDLKS..YWARHGTNRYITIK.........................................
BPC3_ARATH/83-269                    .............................................................................................................................lnqhkdskffsnvpevsrm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.T.....Q....S...M.....Q..L.LQPEV.VT..EVD.....ESVK.R.RHCsgG..Q.....R..G.G...VPKV.........KKEK.K----L..KDN--....--N.......MPRVQR.........................ERSP.LL.RK....CIE.MV..I....N.G....V.S...........MDI.GG.LPV.PVCSCTGMP....QQC.YRWGCGGWQSACCTTNVSMYPLPVNTKRRGARIAGRKMSQGAFRKVLEKLSSDG.FDF.SN.PIDLKS..HWAKHGTNKFVTIR.........................................
W1P7C9_AMBTC/48-356                  .............................................................................................................................ligntsledrglkefassr----..-..---...--...................................----.-.---.........---.----.--.-MT.TVK....aER...D.A...--...............AVRERDM.-.-...............AIA.EKKAATS.ERD................................................................SAFNQRD.MA...LA.Q....RE...............................---..-..-.-.-..-.-.--....................................E.A.V.MER......DA..A.L..A.A.LESLKrdhpdwhayvaqlahifsstql.......gscvrearvdqpienyaynsnraD........GQMGLS..G...P..S.Q...P.....VV...APTD.G.....S....N...P.....D..M.GPTKN.GE..KRK....gGAWD.G.KKP..G..R.....R..N.S...ATNP.........AKKR.K-PAAE..KKVGI....AQ-.......---QNP.........................KPTG.QK.RR....ERG.SS..L....H.-....-.-...........-KS.LS.MPV.PYCSCTGAN....HIC.HRWGDGGWQSACCTPVMSVYPLPMNPYKKGYRLTGRKMSGGAFQKVLQRLGQQG.VDV.TK.PIDLKD..HWAKHGSNKYVMIK.........................................
A0A176VG35_MARPO/100-404             ................................................................................................................................................MDDE..G..RVG...VR...................................RRM-.I.CDQ.........---.--TA.LK.LVK.AIA.....ER...D.A...--...............AILERNS.-.-...............AIA.EKKAACV.ERD................................................................AALLRCD.LA...FS.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.VER......DA..A.V..A.A.LGAVRagkfatftewtrhgsp....................navtsktlqppvvdssP........--FSVD..F...A..S.A...A.....AC...QWKS.A.....V....G...R.....T..N.ICSEY.IQ..KQS.....MAGN.V.RES..Q..R.....D..L.R...SKRKi.......gKDTK.QGFLSS..RK---....---.......-----Rppeq................klliyQREN.LD.QN....ERGsSV..T....E.E....V.A...........DEN.IC.NSI.PYCSCTGVN....QPC.YKWGNGGWQSACCTTMISMYPLPMNPKKRSSRLAGRKMSAGAFEKLVEKLTLEG.VNV.RC.PIDLKD..HWAKHGTNRYVTLR.........................................
A0A2K3N7D6_TRIPR/9-295               ................................................................................................................................................MDGD..N..GLN...IS...................................NWG-.Y.YEPv.......sSFK.SHLG.LQ.LMP.SMP.....E-...-.-...KP...............LLGSHNA.A.V...............-LS.GSNGPFR.NRDiglp.......................................................qttypMDYMR-D.AW...IS.S....QRd.............................nKYM..NmnM.I.P..T.N.PP...................................gY.S.S.IPE......AS..S.A..H.P.IQMIR....................................................P........------..-...-..-.-...P.....EL...VKEE.R.....P....-...-.....-..-.TEEAP.VV..EKS....nGTGK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RGPRVP..KDENS....---.......-PS-VQ.........................RTPR.AP.KK....TTE.IA..I....N.G....I.D...........LDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTAISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A565BLX3_9BRAS/7-229               .....................................................................................................rnpllsatkaskdaglptsnahwfhsycpvpkttgidlskdpq----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....AD...PDESvM.....V....S...Q.....D..L.LFHPP.TR..ESK.....NDMK.-.-TV..K..Q.....K..S.T...NQSP.........SKAL.K-PKPP..RKKRS....ASSk.....sKQTPSI.........................PETK.RE.KK....NPD.IN..I....D.I....S.S...........FDV.SG.VPP.PVCSCTGVP....KVC.YKWGMGGWQSSCCTIDISTYPLPMSTTRPKARLAGRKMSNGAYVKLLMRLAGEG.NDL.SH.PVDLKN..HWARHGTNKFVTIK.........................................
A0A5B6VDB9_9ROSI/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqN........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A2I4GJ26_JUGRE/15-233              .......................................................................................tagasvphftwfypgsflsasktssnpfqgvqlnaqpslpvgpirtiavtpepvndi----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.-D..SAT.....KPAK.G.RKL..K..N.....S..V.K...GS-N.........QVAS.KV-FRP..KQTKK...tPKT.......TKGKSM........................pEGKR.EK.KI....LNN.IH..M....E.K....A.D...........FDF.SR.VPP.PYCSCTGVA....RLC.YKWGAGGWQSSCCTINLSEYPLPMSSTRPGARVAGRKMSNGAYGKLLLRLAAEG.CDL.TH.PVDLKD..HWARHGTNKFVIIK.........................................
A0A1S4APZ0_TOBAC/1-252               ...............................................................................................................................................m-DG-..N..GMN...IR...................................NWG-.F.FEPp......atVLK.GHLG.LQ.LMS.SMD.....EK...P.L...FG...............NIHDHHH.H.H...............HHH.HNHQTH-.--Qphhptvmestngga...................................fhhhrvcgisetpmpIEYMR-D.SW...VN.H....KDy............................rdKYL..N..V.L.S..G.N.HHyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQIHE....................................................Q........------..-...-..-.-...P.....NL...VKVE.P.....D....-...-.....P..Q.LEEVC.QE..RDI....gGLAK.K.RGA..G..K.....SqlL.K...SPKS.........KKAK.KATRVP..KVEAT....---.......---PSV.........................PRAR.AP.RK....SAE.VV..I....N.G....I.T...........MDI.SV.FPI.PVCSCTGAA....QQC.YRWGCGGWQSACCTTNLS------------------------------------.---.--.------..--------------.........................................
A0A3N6S4M6_BRACR/1-176               .......................................................................................................................................mqhlhhhqt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...--EE.N.....P....V...K.....C..E.EEEEE.IV..Q--.....-PNK.K.KKP..-..N.....S..K.A...STAA.........TKGK.K-PRKP..KEENN....SKN.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
H1ZN97_SOLTU/1-323                   ................................................................................................................................................MDDS..G..NRDngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnamtggqivr................................gvkhmhhpqqH........VHHQPH..M...G..E.-...P.....TY...NPRE.M.....H....M...V.....E..A.IPVSP.PA..P--.....EPAK.P.RRN..-..K.....R..A.K...EPKAvt.....gsKKTP.KASKKV..KRETE....DLN.......QTTYGKspewkgaqem....vgasddlnrqlAVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..NWAKHGTNRYITIK.........................................
A0A0D2R6V3_GOSRA/91-138              .............................................................................................................................................awh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----------------------------------GRKMSNRACIKFVLRLTAEG.HDL.SQ.PVDLKD..HCDRHGTNNFVTIK.........................................
A0A0D2Q3Y8_GOSRA/1-190               ...............................................................................................................................................m----..-..---...--...................................QWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN.......RQ----.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vdtefapaqefpdiatsgemvdg..................
I1JT52_SOYBN/1-338                   ................................................................................................................................................MDDA..G..HREngrHKaadqy.........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAFMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhihhpqqQ........VHHIPN..M...G..D.-...A.....SY...STRE.M.....H....T...T.....D..A.LPAAP.IP..S--.....EAGK.P.RRA..-..K.....R..P.K...EPKSas.....pnKKTS.KPAKKV..KKESE....DLNk.....vMFGKSHewksgqemv......nggddlnkqlTVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2Z7B8S9_9LAMI/1-280               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MA.ITA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFQ.ERD................................................................MAMLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.QER......DE..A.I..A.A.LQFREnsvraydalpd.............................tsgnelpsgdkhI........PYQQMH..V...S..E.-...-.....-A...PFSP.R.....-....E...S.....S..R.VDEHT.VM..EAP.....LIAK.S.R-K..G..R.....Q..P.K...DGKP.........AKSA.KSARIG..KRSSD....GLS.......KPVNSVasngwnke.........rvlesdeeDLDK.PV.SW....KDN.LG..L....N.Q....I.S...........FDD.SA.MPV.PVCTCTGSP....QPC.YRWGSGGWQSACCTTTISMYPLPQAANRRYSRVGGRKMSGSAFSKLLNRLAAEG.YDF.ST.PLDLKS..HWAKHA--------ne.......................................
U5CWY4_AMBTC/1-196                   .....................................................................................................................................mdegqrengrh----..-..---...-Kpdqyk........................amlghsQWN-.A.PQQ.........SMK.DHPA.FK.LMA.LMA.....ER...D.A...--...............AIQERNA.-.-...............ALS.DKRAALA.ERD................................................................LAISQRD.AA...YA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.L.QER......DA..A.I..A.A.LEYARdygmgtgqpqg..............................ppgamprapraH........VDPNSS..Y...P..P.R...D.....NS...QP--.-.....N....H...H.....N..V.TEAYP.IS..SSEp...aLNVK.P.KRA..-..-.....-..-.K...RPRK.........EGAN.KAPHQA..KKAG-....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------gprqrrskkqggsm...........................
A0A368PXT8_SETIT/1-341               ................................................................................................................................................MDDD..G..NLS...IR...................................NWG-.F.YDT.........-MK.GNLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPTSAF.L.Qhh..........ghhNAP.HQLHSHH.SRDsgggggasg.............................................smptephsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghgghp...........ghgghavhhhptgY.G.M.MPD......--..A.P..H.T.LQMMQ....................................................P.......qLPSQPQ..E...-..-.-...P.....PP...CKED.H.....V....P...T.....P..P.VEDHS.VV..RTE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-PAVP..REDG-....---.......AVNGHA.........................PRGR.GP.RK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNAKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A565C1V1_9BRAS/1-341               ................................................................................................................................................MDDG..G..HREngrHKaa...............................qgQW-L.M.-QH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.L..T.A.LQYREnsmataaaanmlacppg.................cqisrgvkxxxxxxxxxxX........XXXXPQ..L...S..E.-...N.....AY...ETRD.M.....E....P...N.....D..G.LPTST.PA..GSV....lESAK.P.KRG..-..K.....R..V.K...EPKAntq..taanKRGP.KNQRKV..KKESE...dDLTk.....iMFVKTThdytde............etskhvlIGSK.SD.WK....NQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A392N9P6_9FABA/1-94                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFIRLLSRFASEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A2I0IS76_PUNGR/1-108               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....-MD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTQVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A3S3MKL4_9MAGN/1-340               ................................................................................................................................................MDDG..G..QREngrHKpdqy..........................kgvhsQWTP.L.GPH.........QMK.DHHT.IK.LMS.IIA.....ER...D.A...--...............AYQERNI.-.-...............AIA.EKKAALA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DS..A.I..S.A.LEYARengmnssgtacpp..........................gvprgtkhghhphH........VAHALH..M...G..D.T...A.....PY...HARE.M.....P....I...T.....E..A.IPISV.AS..E--.....AAAK.P.RRA..-..K.....R..K.K...DTKAql....pssVKAS.KPRRKG..KKGGE....DLN.......KQVSGAkqlewkghel.....mgcedlnkqlSVTK.HE.WK....GQD.LG..L....N.Q....V.S...........FDE.TS.MPV.PVCSCTGSS....QQC.YKWGNGGWQSACCTTTLSMYPLPLMPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SV.PVDLKD..HWAKHGTNRYITIK.........................................
A0A397Y1T4_BRACM/1-296               ................................................................................................................................................MDDG..G..HRDngwHKas...............................hgKW-M.M.QQHq.......pQQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..A.A.LQY-R....................................................D........SSMSTS..R...Q..H.Q...P.....HI...HHML.Q.....V....T...E.....N..A.YETRE.TE..TSP....pPPTK.P.KRG..-..R.....K..A.K...EPKAaa.....asKRGP.KTQRKV..KKENE...dDLTk.....lMFDEEA.........................TGSK.SD.WR....GQEtVG..L....N.R....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTALSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHNL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2G2WRQ8_CAPBA/1-283               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEQ.........SLR.ENLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGVFH.SRDsiipe......................................................aplshIDYVR-D.GW...IN.H....RE...............................KFL..N..M.F.P..G.S.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMIQ....................................................Q........------..-...P..D.A...-.....--...-TKD.V.....G....-...V.....N..A.EEPPS.VR..KES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKSK.KASSVP..KENGN....---.......---PSV.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.TG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A022R8S9_ERYGU/1-341               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW-L.M.-QQ.........QPS.M---.KQ.IMG.FMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKTALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnainssnnnmspcppgcqiprgvkhmhhpqqhqqqqqqhihhhhhqshmaesP........YNNNNN..S...S..N.N...N.....NN...TRDN.M.....Q....M...S.....D..T.VPISP.VA..P--.....EPTK.T.RRA..-..K.....R..A.K...EAKPaat...aapRKAS.KNSKRV..KREED...nNLN.......DLNNLNkavfgk.............shdmelGGPK.LD.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGFL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEG.HDL.SN.PVDLKD..HWAKH---------.........................................
V4MTY3_EUTSA/1-278                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.SI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.S-NGSYH.HPE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TTs.................................hyG.N.V.LPE......TS..S.A..P.S.MQMNL....................................................H........NHHHHH..Q...T..E.-...-.....--...----.V.....N....-...P.....V..K.CEEEI.VQ..T--.....---K.K.RKS..-..-.....N..S.K...AGTA.........TKAK.K-PRKP..KEENS....NNN.......-NNTSV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A5D2WAA6_GOSMU/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KS...............FIPMRNP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................eapnpMNYVR-D.SW...IS.Q....RE...............................KFF..N..M.L.P.gI.S.PN....................................Y.G.I.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.S...P.....NS...STRD.E.....R....V...V.....G..R.VEEPP.AT..KES.....VELK.K.RQS..E..S.....A..P.K...TPKT.........KKPR.K----P..KDNTN....---.......---SSV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.NN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A251U8C7_HELAN/1-297               ................................................................................................................................................----..-..---...MR...................................NWGY.Y.EPP.........SFK.EHLG.LQ.LMS.PMG....dHR...D.P...KP...............FQTLRES.P.V...............MVN.PNVSTYH.HPHtrvvs......................................................dppmpM----NY.GW...IQ.-....RE...............................RLL..H..M.L.P..G.N.TN....................................F.S.V.LPN......TS..T.S..H.G.IHMVP....................................................P........PLDLSK..D...P..V.M...N.....MA...VENN.V.....V....VgkdS.....G..G.VGDES.VT..GNNgg.ngSSMK.K.RGT..T..T.....A..V.KipgEKKS.........KKPK.KTPSTP..KENG-....--N.......SS---G.........................HRAK.TI.KR....NVD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCTCTGAP....QQC.YRWGLGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.SD.AIDLRT..YWAKHGTNKFVTIR.........................................
A0A199UIX2_ANACO/1-280               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MA.LVA.....ER...D.E...--...............AIRERNI.-.-...............ALA.EKKAAQA.ERD................................................................MAFLQRD.AA...IT.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.IER......DN..A.L..S.A.LQYARengvngnncgpe............................cfppsrgaakhhH........YQQQPQ..Y...S..D.-...G.....YY...NDHE.A.....L....P...M.....S..T.APDGD.AA..K--.....SSHK.S.KRG..R..N.....D..P.T...KVQAsa....spsKKPL.K-KKSR..KVGGE....HFNn.....kQV---Tva.....................rlGAKH.HE.WK....GQD.LG..L....N.Q....V.V...........FDE.ST.MPV.PVCSCTGKY....QPC.YKWGDGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGSVFKKLISRLAAEG.YDL.SM.PIDLKD..HWAKHGTNRYITIK.........................................
A0A2G5F6N1_AQUCA/1-288               ................................................................................................................................................MDDD..S..GLG...IR...................................NWG-.Y.YEP.........SLK.GNLG.LQ.LMS.SVP....aER...D.T...KP...............FFSGREF.-.Sgrd........psaiMVS.ANGNYHH.HRDcgip.......................................................essipMDFMR-D.GW...LH.Q....RE...............................KFL..H..V.L.P..G.N.PN....................................Y.S.L.ICE......TS..G.S..Q.P.LHMLQ....................................................-........------..S...P..D.-...-.....-S...SKDE.R.....M....-...-.....I..R.MEEPE.IK..K-D.....GPLK.K.RPG..G..R.....T..Q.K...SPKT.........KKSK.K--AVP..KDETN....---.......A---SV.........................QRAK.PG.KR....NTA.LV..I....N.G....I.D...........FDI.SG.IPI.PVCSCTGIP....QQC.YRWGCGGWQSACCTTSISVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNL.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A0K9PN01_ZOSMR/1-299               ................................................................................................................................................MDDD..G..VLG...IP...................................NWGY.Y.DQP.........SKN.NQLG.LQ.LMS.GMS....lEQ...Q.QqgrKP...............VLSGNSA.T.Fl............hrDMT.EQQSVHS.STS................................................................MEIIR-E.GW...LH.H....RE...............................KLI..Q..M.F.P..P.N.HQ....................................N.C.Y.TLQfd.palPM..P.S..Q.S.LQALR....................................................P........TEQSK-..-...-..-.-...-.....EI...KIEE.E.....S....G...G.....R..R.TPQDV.TQ..TVV....pLKKK.K.KKQ..G..R.....P..C.K...VPKV.........TKQK.I-IREE..LDGGD....SSS.......VTK-VG.........................KSAS.SL.RK....NTE.VT..I....N.G....I.D...........LDN.SR.IPT.PVCTCTGAP....RLC.YRWGVGGWQSACCTTSISMHPLPVSTKRRGSRIAGRKMSHGAFKKVLEKLAGEG.YNL.SN.QIDLRS..HWAKHGTNKFVTIR.........................................
A0A397ZXL8_BRACM/28-229              .............................................................................................rwfhsyfpvprttgidlsqppqaepaelamvpqqvrlfppptreyihdveq----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....---K.S.STM..L..S.....P..S.K...ALKP.........KPQS.KKRSAP..KTPKK....TL-.......----SI.........................PEIK.RE.KK....NPD.IN..V....V.D....IsS...........FDV.SG.VPP.PVCSCTGVP....KVC.YKWGMGGWQSSCCTISISTFPLPMSTTRPGTRLAGRKMSNGAYVKLLMRLAGEG.YDL.TF.PVDLRN..HWARHGTNKFVTIK.........................................
A0A078I334_BRANA/302-570             ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.HPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.I.LPE......TS..S.A..P.S.MRHHQ....................................................-........------..T...T..D.-...E.....YP...GTHE.Q.....-....-...-.....-..-.VEEIV.--..Q--.....-TNK.K.RKP..-..-.....N..T.K...PGAT.........TKAK.K-PRKP..KEESD....K--.......-----S.........................IKAK.PA.KK....SVD.FV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A3Q7F6X9_SOLLC/1-300               .......................................................................................................................................mmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................ALI..Q..E.R.N..D.A.IAalrlq.........................dsstndN.N.M.VPD......SP..G.N..G.T.ESGAKhi................................................ynQ........QQMYRT..T...A..D.-...A.....AH...GSTE.D.....P....A...A.....G..Y.LKDTD.TS..E--.....--AK.I.PKK..V..K.....R..P.K...ESRH.........NKQA.KIPRVG..KISTD....SLS.......MQVIATtsddwvnl........qemdsdkegDTQL.TS.WK....-DN.LG..L....-.K....I.N...........FDD.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQG.YDL.SI.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A5P1F8K9_ASPOF/1-363               ...............................................................................................................................................mMDDN..Q..RENg.rHKadhy..........................ksihtQW-M.M.PQH.........QMK.DSQA.IK.LMT.VMA.....ER...D.N...--...............AIQERNI.-.-...............ALS.EKKAAQA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.MER......DN..A.I..A.A.LEYARengmnanssisgcpsgcsasr..........gmkhthhhhhnhqqqqslhvhP........GPSPPQ..L...A..N.D...P.....YN...HSRE.M.....H....V...T.....E..A.YPIST.AS..EGAvm.vrKVKR.P.RKD..T..R.....A..Q.V...QPQAsa.....lpRKTK.SRKGKR..SFGGE....DLN.......KQA--Tyvkpldewrnem.ggsgenlnnkqgTKHH.NE.WK....DQD.LG..L....N.Q....V.T...........FDE.ST.MPV.PVCSCTGKY....QPC.YKWGNGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGTVFTKLLSRLAAEG.HDL.SV.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1U8AGT5_NELNU/1-283               ................................................................................................................................................MDEK..G..GLG...IR...................................NWD-.F.SEQ.........SVG.VDAV.LK.PVS.GVP.....VP...S.G...--...............----TSG.H.Q...............AAF.LKMGAYA.NRN................................................................SMVPQAD.TG...AS.T....ME...............................--Y..G..G.H.C..W.V.HP....................................R.N.F.LPP......NK..A.N..P.S.LQA-T....................................................P........LNTETG..L...PvvP.T...G.....LG...VPTD.G.....H....N...N.....E..F.GSKST.KI..RKQ.....QPSA.K.KAN..R..V.....A..S.K...ALRP.........KQPK.KKPSVS..TTTKK....KN-.......---NSM.........................STAK.HE.KK....NLD.IV..I....G.G....A.T...........LDF.SR.IPA.PICSCTGVA....RQC.YRWGAGGWQSSCCTTNISEYPLPMSSKRPGARMAGRKMSNGAYAKLLQRLAAEG.HDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
M5XE43_PRUPE/1-337                   ................................................................................................................................................MDDS..G..HREngrIKaeqy..........................kaaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALQ.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.MER......DN..A.I..A.N.LQYREnslnngnvsscppg.......................cqisrgvkhmhhpqqH........VHHPPH..M...N..E.-...A.....SY...GTRD.M.....H....T...S.....D..S.VPMPP.DA..S--.....LPTK.S.RQP..-..K.....R..P.R...EPKTma.....pnKKTS.KSPRKV..KRESE....DLNk.....mTFDKLHewkgsqdmg......gggddvnkhlVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A1S4AUL0_TOBAC/1-306               ................................................................................................................................................MDDG..G..RRE...SRrhrmdc.......................skgghaPWNV.V.PPYqm.....kdQEA.FIMN.TK.IRM.LCA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKNTVLA.ERD................................................................LAIQQRD.TA...IA.E....RD...............................TAI..K..E.R.-..-.-.--....................................-.-.-.---......DN..A.I..A.A.LLFQEstmngtlgc.................................rtrgtkrpnqS........KNHCDN..S...T..D.-...S.....IC...INRD.V.....P....L...T.....D..A.FPISA.IS..S--.....EVAK.A.LQV..-..K.....R..T.K...GNK-.........--G-.-MSRKT..KKVNE....DLN.......RHLT-T.........................DGSK.AE.WD....AQD.LG.sI....N.Q....I.K...........FDE.SS.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVG.HDL.SL.PIDLKT..YWAKHGTNRYITIK.........................................
A0A0D3DIF6_BRAOL/1-269               .........................................................................................................................................mmpqhqi----..-..---...--...................................----.-.KEQ.........HNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKERNE.-.-...............ALA.AKQEALA.ARD................................................................EALQQRD.LA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......EN..A.L..T.A.LQHRE....................................................Nhl....nyILDCAK..R...G..G.Y...Q.....TC...FTEE.T.....H....L...P.....N..P.SPLST.IP..HEP.....PNTK.T.KKD..-..R.....K..Q.E...TARS.........KRK-.------..KSGGE....DLN......rQLASPG.........................KKCR.KD.WD....CND.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEG.HDL.SS.PVDLKD..YWARHGTNRYIIIK.........................................
A0A0E0HKD4_ORYNI/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A2G5EN89_AQUCA/1-343               ................................................................................................................................................MDDS..G..QREngrHKpdqy..........................kslhsQW-M.I.PPHl.......mKDH.HAMT.MK.FMS.ILA.....ER...D.A...--...............AIQERNL.-.-...............AVS.EKKAALV.ERD................................................................MAIMQRE.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.A.LEY-Rdsatvngstastcqp......................gcgipcgtkhmhhhqH........VHHPSH..L...N..E.-...A.....PY...NSRD.I.....N....I...S.....D..A.FPISA.AA..S--.....EAVK.P.RRA..-..K.....R..T.K...DAKAl......qsKKAF.KLSKKG..KRGND....DTNr.....qV-PF-Akplewkseqcm...ggggedmskqlAVSK.PD.WI....GQD.LG..L....N.Q....V.P...........FDD.SA.MPV.PGCSCTGVL....QQC.YKWGKGGWQSACCTTTLSMYPLPVMPNKRHARLGGRKMSGSAFSKLLSRLASEG.HDL.ST.PLDLKD..HWARHGTNRYITIK.........................................
A0A2H5NS33_CITUN/23-357              ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
B9RG56_RICCO/1-314                   ................................................................................................................................................MDES..G..QHHngrYKidyy..........................kaansPWSM.G.SPHpi....kepSNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIQERNM.-.-...............ALA.EKKEALV.ARD................................................................EALQQRE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREnamnfpfgng................................nqrgskriphP........VYNSNE..V...A..E.-...-.....AL...DGGE.M.....H....I...T.....D..A.FPITT.VA..A--.....ESGK.P.RQT..-..K.....R..S.K...ENKSv.......sMKAT.KSAKKG..NKVGE....DLN.......RQGPSD........................gKKFK.VE.WD....GQD.-G..L....N.L....V.N...........FDD.ST.MPV.PVCSCTGVP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLASEG.HDL.SL.PLDLKD..YWARHGTNRYITIK.........................................
A0A4D8YJH3_SALSN/1-292               ................................................................................................................................................MDEN..S..REN...RRhrmd..........................yhkvpQWNA.M.PQHqi.....kePIA.YGMN.AR.LVM.LCN.....ER...D.D...--...............AIRERDR.-.-...............AMA.EKKAALD.ERD................................................................AAVKQLD.AA...VM.E....RD...............................---..-..-.-.-..-.-.--....................................E.A.L.RER......DN..A.I..A.A.LQFHE....................................................N.......tVNALLV..S...S..A.R...G.....SK...RTHH.P.....T....R...E.....D..C.IRDDA.SY..E--.....APVS.K.KGT..K..A.....K..A.N...KDSP.........TRSA.RSPKKG..KKIGE....DLN.......RQVT-T.........................DGSK.AE.WD....AQD.LG.sM....N.Q....I.M...........FDE.TS.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTSLSVYPLPQMPNKRHARMGGRKMSGSVFSRLLTRLGAAG.QDL.SI.PVDLKD..YWAKHGTNRYITIK.........................................
A0A4D8ZPE6_SALSN/2-327               .........................................................................................................................wdpkaektlrgwtsrlilllmmd----..-..---...--...................................----.-.---.........--H.NHLTiKT.FMA.ITA.....DR...D.A...--...............AIREKNM.-.-...............ALE.ERKRAFQ.ERD................................................................MAMLQRD.AA...IA.E....RNaaiq......................erdeaI--..-..-.-.-..-.-.-Aslryressm..................ndntdipdsY.G.S.EHA......SG..G.K..H.I.IQYQQ....................................................Q........--QQMC..V...S..E.V...A....gYS...PKGN.L.....R....-...-.....-..-.GNEIV.VA..ETA.....ETPK.P.RRG..R..Q....tK..D.K...EGKA.........TKSA.KPPRAG..KRTAE....AVVk.....eEV---Nsdayngwsn......eqgldsdeeyLDKQ.VS.WK....D-K.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTSSP....QPC.YRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFNKLLNRLAGEG.YDF.SS.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A199UD04_ANACO/1-279               ................................................................................................................................................MDDN..G..QREssrHKadhy..........................ktahaQW-M.T.NQN.........QLK.E--N.IK.IMA.LVA.....ER...D.E...--...............AIRERNI.-.-...............ALA.EKKAAQA.ERD................................................................MAFLQRD.AA...IT.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.IER......DN..A.L..S.A.LQYARengvngnncgpe............................cfppsrgaakhhH........YQQQPQ..Y...S..D.-...G.....YY...NDHE.A.....L....P...M.....S..T.APDGD.AA..K--.....SSHK.S.KRG..R..N.....D..P.T...KVQAsa....spsKKPS.K-KKSR..KVGGE....HFNn.....kQV---Tva.....................rlGAKH.HE.WK....GQD.LG..L....N.Q....V.V...........FDE.ST.MPV.PVCSCTGKY....QPC.YKWGDGGWQSACCTTTLSMYPLPVMPNKRHARVG--------------------.---.--.------..--------------pqderqc..................................
A0A1R3IZ11_COCAP/410-674             ....................................................aalaakepealpfcaiaygltdvllhnqitamqmgsysnknmmpetntgssaspfswfygnymtkpglsslqraqighepgllvapirsisa----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...PTTE.S.....E....N...N.....D..D.LRSKTtKV..GKQ....kPSVK.D.S-N..P..V.....A..S.K...VLRP.........KQPK.KKPSTP..KKAKG....P--.......----IT.........................PEAK.RE.KR....NLN.VD..L....D.G....T.N...........FDF.SG.VPS.PFCSCTGVA....RVC.YKWGAGGWQSSCCTTNISEHPLPMSSTRPGARMAGRKMSNGAYLKLLLRLAAEG.HDL.SH.PVDLKH..HWARHGTNKFVTIK.........................................
A0A0S3TBV9_PHAAN/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.GTNGAFH.HRDigms.......................................................hatypMEYTR-D.AW...IS.S...yRD...............................KYM..N..M.I.P..T.S.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....E....-...-.....-..-.VEEEA.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A2U1LP63_ARTAN/1-273               ................................................................................................................................................MDDD..G..---...LR...................................NWG-.Y.YEP.........-FK.EHLG.LQ.LMS.PMG....dHR...D.T...KP...............YFSSREN.P.L...............LLN.PNGATYH.HPHtrmvs......................................................eptghMNYMR-D.GW...IQ.-....RE...............................RFH..H..M.Q.P..G.N.PS....................................Y.S.A.LSN......TM..S.S..H.D.MHLVP....................................................-........------..-...-..-.A...L.....DM...SKDH.V.....-....-...M.....N..M.LEEDN.--..---.....---A.K.RGS..T..S.....A..P.K...TPRT.........KRPK.KGSLTP..KVNGK....---.......-P--PG.........................HRAK.TV.KK....NVD.MV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGSP....QQC.YRWGAGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.AN.AIDLRT..YWAKHGTNKFVTIR.........................................
A0A4P1RQN4_LUPAN/1-221               ..........................................................................................................................................mphaay----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.--P................................................................MDYMR-D.VW...ISsQ....RE...............................KYM..N..M.I.P..T.N.LT....................................Y.G.G.IPE......TS..S.A..H.H.MQMIQ....................................................P........------..-...-..-.-...P.....KD...QKEE.R.....-....-...-.....-..A.IEEEP.VV..EKV.....SGTG.K.KRQ..S..K.....V..P.K...SPKA.........KKPK.RGPRVP..KDER-....---.......APS--V.........................QRAR.VP.KK....SVE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGMSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A061G7A0_THECC/7-236               .................................................................................snknmmpetntgssvspfslfytgnyiptsrpglsslqgtqihhepglvvapirsiapttesg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....K....N...N.....D..L.GSKST.RV..GKQ.....NPSV.K.GSN..Q..I.....A..S.K...VLRP.........KQPK.KKPSVP..KKAKG....TV-.......-----I.........................PEAK.RE.KK....NLN.ID..L....D.G....T.N...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGAGGWQSSCCTINISEYPLPMSSTRPGARMAGRKMSNGAYLKLLLRLAAEG.HDL.SH.PVDLKE..HWARHGTNKFVTIK.........................................
A0A5A7RIQ8_STRAF/1-300               ................................................................................................................................................MDDS..S..HREngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMS.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DN..A.I..A.T.LQYREnalhn..........................................npntnN........NTNISQ..C...P..P.G...C.....QIgrgVKHI.H.....H....P...H.....P..L.IEPNY.ES..GPS.....PAEP.A.KSS..A..R.....R..N.K...RAGS.........KRAA.T-PKKV..KQEGP....ADQ.......AHDW-Ragp..................glglKQEQ.QQ.WK....EQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAGEG.HDL.SS.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2J6LFC6_LACSA/1-295               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMSpIVD.....HR...D.T...KP...............FLSSREN.P.I...............IMN.PNMTPYH.RSSipse........................................................ppipLHYMR-D.GW...IQ.-....RE...............................RLL..H..M.L.P..G.N.PS....................................F.S.I.IPD......TS..T.S..Q.S.MHMMP....................................................P........-APPPD..S...T..K.E...L.....GM...NLED.L.....Q....A...P.....P..D.GSDTG.GG..GGG....gGSVK.K.RGA..G..Atv.saT..P.K...QPRA.........KKPK.KAASIP..KETG-....---.......-----N.........................QRSK.SI.KR....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGVP....QQC.YRWGAGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLGSES.YNF.AN.AIDLRA..HWAKHGTNKFVTIR.........................................
A0A2C9U605_MANES/1-280               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........TFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLSGRDP.N.N...............IVV.GANGAFH.PRDcvvs.......................................................dapvpMNYVR-D.SW...IS.Q....RE...............................KFL..N..M.L.P..P.N.PG....................................Y.A.V.LPE......TS..G.A..H.S.MQVLQ....................................................P........------..-...-..-.-...P.....NT...SRDE.-.....K....V...G.....G..R.IEEPS.VN..KES.....SQLK.K.RQG..G..G.....A..P.K...TPKA.........KKPR.K----P..KDNSN....---.......---NAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A6A4N5Z9_LUPAL/1-335               ................................................................................................................................................MDDP..G..HREngrHKpdqy..........................kspqgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............AVS.EKKAALA.ERD................................................................MAFLQRD.TA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREnslttgsmsacppg.......................cqisrgvkhmhhpqqQ........VHHLHN..M...S..D.-...A.....SY...GTQE.M.....T....T...T.....D..A.LPEAP.IP..S--.....EAGK.S.RRA..-..K.....R..P.K...EAKSis.....pnKKAS.K--RKV..KMESE....DLNg.....mMFGKTPewkssqelf......nggddlnkqsVVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGAL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKKHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A444YGC4_ARAHY/1-339               ................................................................................................................................................MDDA..G..HREngrHKadqy..........................ksspgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............LIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.AA...IT.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.IER......DN..A.I..A.A.LQYREnsltnssmpsscppg......................cqisrgikhmhhpqqQ........VHHMPN..N...M..G.D...G.....SY...TARE.M.....H....T...S.....D..S.LPTVP.IP..S--.....EAGK.S.RRG..-..K.....R..P.K...EPKSvs.....pnKKAS.KGTRKV..KRDDE....DTHk.....mMFGKANewkssqemi......ngsedlnkqlEVTK.AD.WK....SQD.LA..L....N.Q....V.A...........YDE.ST.MPA.PGCSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLATEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A444GC96_ENSVE/1-283               ................................................................................................................................................MDDD..G..GMG...MR...................................NWAY.F.-DQ.........TLK.GDSG.LH.PMS.SMA....aEY...G.A...--...............---PKPS.F.L...............---.-PNGAFH.RREcfip.......................................................eqpdrMDITR-N.EW...IN.L....RE..............................nDVL..H..M.L.P..M.N.DC....................................S.S.A.MGDa...gvSH..G.A..H.S.FSMMQ....................................................S........----TP..L...P..P.-...P.....EG...DK-I.T.....A....V...D.....D..E.LGKDV.PQ..K--.....-RSQ.P.RAQ..T..C.....P..H.K...ASKP.........KRLK.K-VAVS..KDESS....SR-.......M----G.........................HEGR.NL.RQ....SSA.LN..I....N.G....I.D...........LDV.SN.IPT.PLCSCTGMP....HQC.YRWGAGGWQSACCTTGISTYPLPMSTKRRGARIAGRKMSQGAFKKVLANLAAKG.YNL.SD.PIDLKP..YWAKHGTNKFVTIR.........................................
A0A200PRX2_9MAGN/1-143               ..............................................................................................................................................mh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.--HQQ....................................................H........MHHSPH..M...A..E.-...A.....YY...NSRE.M.....H....T...N.....E..A.IPISV.VS..S--.....VSPK.P.RRD..-..R.....Q..T.K...EHKA.........ISSN.KRALNP..SRKVG....KR-.......GCNDL-.........................NRCS.DP.WR....GHD.LG..L....N.H....V.Y...........FDD.SN.MSV.HVCTCTGVL....QQC.YKWGKWGWQSACCTSTLSMYPLLVVPNKRHS-----------------------.---.--.------..--------------.........................................
A0A078FCL6_BRANA/1-279               ...............................................................................................................................mesggqydngrckpdyf----..-..---...-Kgt..............................ppsVWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............ALKERNE.-.-...............ALA.AKKEALA.ARD................................................................EALEQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......ET..A.L..N.A.LHY--....................................................P........EKNNLN..Y...I..L.-...-.....SC...AKRG.E.....T....E...R.....S..H.LPNPS.HI..S--.....----.-.---..-..-.....-..-.-...-TKP.........TKRK.IETKQG..NKLGE....DLNr.....lAAS-PG.........................KKCR.KD.WD....VNE.VG..L....N.L....V.A...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGSGGWQSSCCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGQG.QDL.SS.PVDLKD..YWARHGTNRYITIK.........................................
A0A4U5QKH1_POPAL/1-284               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........PVK.GNLG.LQ.LMSpTMP.....E-...-.-...KP...............FLGSRSA.A.I...............-MT.SMNGGFN.HKDvgvs.......................................................qpmhpMEYMR-G.AW...IG.Q....RE...............................KFI..N..V.L.P..G.N.HN...................................yA.A.V.FPE......TS..S.A..H.H.MQVFQ....................................................P........------..-...-..-.-...P.....YS...TKDE.P.....L....-...-.....E..L.VEEAG.VV..EKV....nGPNK.K.RQR..Q..K.....A..P.K...SPKA.........KKGK.RGPQVP..KPED-....TL-.......----SV.........................QRVR.SA.KK....TAE.IM..I....N.G....I.N...........MDI.SV.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTCISVYPLPMSMKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A1U8KYL5_GOSHI/1-336               ................................................................................................................................................MDDG..G..HREngrLKadqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqH........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A1J6JJF0_NICAT/1-313               ................................................................................................................................................MDDG..G..RRE...SRrhrmdc.......................skgghaPWNV.V.PPYqm.....kdQEA.FVMN.TK.IRM.LCA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKNTVLT.ERD................................................................LAIQQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFQEstmngtlgc..................................rtrgtkrpnQ.......tKNHCDN..S...T..D.-...S.....VC...INRD.V.....P....L...T.....D..A.FPISA.IS..S--.....EVAK.A.LQV..-..K.....R..T.K...GNKGm.......sRKSV.KSPRKT..KKVNE....DLN.......RHLT-T.........................DGSK.AE.WD....AQD.LG.sI....N.Q....I.K...........FDE.SS.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVG.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
G7LI34_MEDTR/1-312                   ................................................................................................................................................MDDD..R..QYEngrHKmdyy..........................rgahsLWNV.D.PQHqi.....keQNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............ALLELEL.E.A...............AIS.EKNEALA.ARD................................................................VALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRNstanfpfngg................................iqrgskrmhhS........SNHISN..M...T..E.-...A.....AY...STTD.I.....I....I...R.....D..A.SPVTV.IT..S--.....EDVK.S.HLT..-..K.....R..T.K...ENKA.........---S.QTPTKI..KKMGE....DLNr.....kAYS-EG.........................TKIK.SE.WD....RQD.VG..L....N.S....I.A...........FDE.TV.MPV.PVCTCTGVP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGNVFRRLLSRFASEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A4P1R441_LUPAN/1-338               ................................................................................................................................................MDDD..V..-LN...MS...................................NWG-.Y.YEP.........FKG.GHLG.LQ.LMP.GMT.....DR...D.T...KS...............FLPGRDP.S.MfvgvndrdskpyssgR--.-------.--DssmfigandrdskpflsgrdppmfvgtndrdmrqflsgrdpsmligangnmhpqdcvvsealmpMNYVR-G.GW...IS.P....RD...............................RFF..N..L.P.P..V.T.PN....................................Y.A.V.LPE......TS..A.P..L.S.MQTIQ....................................................-........------..L...P..D.-...-.....-T...SRDE.K.....V....-...-.....D..S.IEDSI.VK..KGG.....GQSK.K.RQS..R..G.....P..L.S...TPEA.........KKPR.K----P..KDNSN....SL-.......-----V.........................QRVK.PV.KK....TVE.LV..I....N.G....I.D...........MDL.SG.LPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLEAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A0A0LLL3_CUCSA/1-338               ................................................................................................................................................MDDS..G..HREngrHKpdqy..........................ksaqgQW--.M.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnsinnnlscppgcq........................iargvkhihhpqqqH........THHVPH..M...N..E.-...N.....NY...NSRE.M....lA....S...N.....D..P.CPTSP.VA..S--.....ESTK.A.RRN..-..K.....R..P.K...EGKTvp....tpnKKVS.KGPRKV..KREAE....DLNk.....iMLGKSQewkdgigim......sagddlnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PICSCTGVI....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEG.HDL.SA.PVDLKN..HWAKHGTNRYITIK.........................................
A0A3L6TF08_PANMI/1-342               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YDT.........-VK.GSLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPAGAF.L.Qhh..........ghhNAP.HQLHPHH.SRDsggggtsgg..............................................mptepqsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvahpghgghp...........ghgghavhhrptgY.G.M.IPD......--..A.P..H.T.LQMMQ....................................................V.......qPQLQSQ..L...Q..E.-...P.....PP...CKED.D.....V....P...P.....P..L.VEDQS.LV..KTE.....PPVK.K.RQR..G..R.....Q..P.K...SPKP.........KKPK.K-AAVP..REDR-....A--.......-VNGHA.........................PRGR.GP.KK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A2G9HRG8_9LAMI/129-194             .................................................................................................................................vavqelphdatnqel----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.----------------------------PGKRISGRKMSRGPYRKLLYTLAIGG.RDL.SQ.PVDLKN..HWAKHGTNMFVTIK.........................................
A0A4U5M4Q4_POPAL/19-297              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SYK.EPLG.LQ.LMP.AMV.....DR...D.S...KH...............LLPRRDP.N.N...............IML.GATGAYL.PRDslvs.......................................................dasmhMNYMR-D.SW...IN.-....RE...............................KIL..N..M.L.P..P.N.PS....................................Y.V.V.HPE......TS..G.A..Q.S.MPMLQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....S..R.IEEPS.VS..KEG.....SQLK.K.RQV..G..G....tA..P.K...TPKP.........KKPR.K----P..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.VN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A0L9VHR7_PHAAN/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.GTNGAFH.HRDigms.......................................................hatypMEYTR-D.AW...IS.S...yRD...............................KYM..N..M.I.P..T.S.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....E....-...-.....-..-.VEEEA.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5N5LG96_9ROSI/1-321               ................................................................................................................................................MDDG..G..QHQngrYKmdyykaa.....................hphphppAWNM.M.SQHqv....keqTNA.LAMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............ALA.ERKEALA.ARD................................................................EAIQQRE.KA...LV.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.V.FQYREntmnypssgg................................sqrgtkriphP........VYHSNG..M...S..E.-...E.....AL...DTGE.M.....Q....V...T.....D..A.LPISS.VT..A--.....ETGK.A.RQT..-..K.....R..S.K...ENKAv.......gLKAA.KPPRKG..NRVSE....DLN.......RQGASD........................gKKIK.VE.WD....SQE.VG..L....N.L....I.N...........FDE.TT.MPA.PVCSCTGVS....RQC.YKWGSGGWQSACCTTTLSSYPLPQMPNKRHARVGGRKMSGNVFTRLLSRMAAEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
D7MS41_ARALL/1-332                   ................................................................................................................................................MDDG..G..HREngrHKaa..............................aqgQW-L.M.-QH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtaaatnmsacppgc................qisrgvkhlhhphmhhhhQ........QHHIPQ..L...T..E.-...N.....AY...ETRE.M.....E....P...N.....D..G.LPTSP.PA..GSA....lESAK.P.KRG..-..K.....R..V.K...DPKAtaq..ttanKRGP.KNQRKV..KKESD...dDLNk.....iMFVKTThdytee............dsskhilIGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGV-....---.-------WQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2H3YTL8_PHODC/74-427              ................................................................................................................................................MDNS..G..QREngrHKtdqy..........................kqvhtQW-M.M.PQY.........QLK.ENQT.IK.FMA.IMS.....ER...D.N...--...............AIQEHNI.-.-...............ALA.EKKAALA.ERD................................................................VAILQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARengmntngatacppgcaa...............prgskhihhhqqqhlqhihP........SPPQLS..D...A..PyN...H.....YN...HARE.M.....H....I...T.....E..A.FPIST.AS..E--.....SAAK.G.RMV..K..R.....P..R.K...ETKVqn....spyKKSS.KTPRKS..RKGGG...eDLNr....qvT--I-Akpasdwrgev....gggddlnervsLTKH.QE.WK....GQD.LG..L....N.Q....V.T...........FEE.AT.MPT.PVCSCTGKY....QQC.YKWENGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEG.HDL.SQ.SVDLKD..HWAKHGTNRYITIK.........................................
A0A2K3PLB5_TRIPR/1-282               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FKA.GNLG.LN.LMP.GMN.....DR...E.T...KP...............FFPPGRD.P.A...............MLV.GANGTFH.PRDdvaav......................................................essnpLNYGR-D.NW...IN.Q....RP...............................RFY..N..M.Q.V..N.N.PN....................................Y.A.V.PPE......TS..Q.G..P.S.FPFIP....................................................-........----SA..V...T..D.P...-.....--...PRNE.N.....V....-...-.....D..E.IEELA.VK..KEG.....GKAK.K.RKS..K..A.....A..P.T...TPKA.........KKPR.K----Q..KDNS-....--N.......VSG---.........................QGVK.PP.KK....TVA.LE..I....N.G....I.E...........MDI.SG.LPV.PVCSCTGNP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.AN.AIDLKT..HWARHGTNKFVTIR.........................................
A0A6A2YA02_HIBSY/1-198               ................................................................................................................................................MDE-..N..ALN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMP.SMA.....DR...D.T...KS...............FIPMRDP.N.F...............-LA.TPNVAFH.PRDcvvs.......................................................easipMNYVR-D.SW...IS.Q....RE...............................KFL..N..I.M.P..AvS.PS....................................F.G.I.VPE......TP..A.A..H.S.LSVLL....................................................-........------..-...P..P.L...D.....SS...RKDE.-.....R....V...A.....G..R.VEEPP.AS..KES.....VQLK.K.RQG..E..A.....A..P.K...TPKT.........KKPR.K--RKD..NTDS-....---.......----SV.........................QLVK.PA.KK....SMD.IK..I....N.G....Y.D...........IDI.SG.F--.---------....---.------------------------------------------------------.---.--.------..--------------rprvpepls................................
B2Z456_VITVI/1-307                   ................................................................................................................................................MDDG..G..QREngrHKldyy..........................kgpqnPWNM.M.PQHhl.....keQNA.LTMN.KK.VVN.ILA.....ER...D.N...--...............AIRERNI.-.-...............ALS.EKKAALE.ERD................................................................EALMQRD.AA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.A.LRYREsvisiqr......................................gtkrmdhP........PNHAAN..G...A..E.-...G.....SY...NTRE.V.....H....I...T.....D..A.FPIST.IA..A--.....DSVK.S.RKR..-..-.....-..T.K...ENKAv.......sSKGL.KPPRKG..KKVNE....DLNr.....qVISD-G.........................LKIK.SE.WD....SQD.LG..L....N.L....V.T...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAAEG.HDL.SM.PLDLKD..YWAKHGTNRYIIIK.........................................
A0A1S4A1E5_TOBAC/1-282               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGMYH.SRDsivpe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.N.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMVQ....................................................-........------..Q...P..D.-...-.....--...VTED.V.....R....-...-.....V..N.AEEPS.VK..NES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKLK.KGSSVP..KENGT....---.......-PR--V.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YSF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A5N6N5G5_9ASTR/11-196              .............................................................................................................................saqfpqvpfsttvtssnpc----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...---K.T.....T....Y...T.....E..A.VPIRC.VA..PST.....EAIK.N.KRK..-..E.....I..P.Q...APKTp......tkNKPY.K-SKKS..KKQT-....---.......-----V.........................LKPN.VE.RK....NLD.NV..F....D.E....T.Q...........FDF.SK.VPP.PVCSCTGVA....RQC.HKCGINGWQSACCNSKISVFPLPMSPWRPGARVGGRKMSHGAYRKLLCRLASEG.HNL.SN.PVDLKA..HWAKHGTNNFVTIK.........................................
A0A161YE95_DAUCS/1-294               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LQ.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.M.RER......DE..A.M..A.T.LRY-Kggssvnenntssdf.......................pnngvgrgtksiqedQ........QMHIMY..D...M..S.S...G.....KY...SPGD.I.....M....-...T.....D..S.YQIND.VP..T--.....EHVK.P.RKV..-..K.....Q..T.E...ENKEf.......pKKPA.KSRRVS..RKGAE....NLK.......KEGSASasnickie.........qdlgadenQGSQ.IA.GW....KDS.LE..L....N.Q....V.N...........FDD.SA.MPI.PVCSCTGVP....QPC.YKWGNGGWQSACCTTTMSMYPLPQVSNKRYSRVGGRKMSGGAFSKLLTRLHDEG.YDL.SS.PLDLKD..HWAKHGTNRYSTVK.........................................
A0A061DYQ6_THECC/1-310               ................................................................................................................................................MDGA..G..QQEsgrYKldyy..........................kgahtPWNM.M.PQHhm....keqNNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AIS.EKKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MDR......DN..A.L..A.V.LQYREnamnfplg....................................ggiqrggkR........MHPTYH..S...T..D.V...G.....ET...LNSE.M.....H....V...T.....D..A.LPVST.IA..C--.....EEGK.S.RPV..-..K.....R..T.K...ENKA.........VSSK.-SARKV..KKVAE....DLN......rQAGTEV.........................KKCK.SE.WN....GQD.IG..L....N.M....V.N...........FDE.TT.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTMSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.QDL.SI.PLDLKN..YWARHGTNRYITIK.........................................
A0A314US08_PRUYE/79-389              ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A392N575_9FABA/1-282               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FKA.GNLG.LN.LMP.GMN.....DR...E.T...KP...............FFPPGRD.P.A...............MLV.GANGTFH.PRDnvaav......................................................essnpLNYGR-D.NW...IN.Q....RP...............................RFY..N..M.Q.V..N.N.PN....................................Y.A.V.PPE......TS..Q.G..P.S.FPFIP....................................................-........----SA..V...T..D.P...-.....--...PRNE.N.....V....-...-.....D..E.IEELA.VK..KEG.....GKVK.K.RKS..K..A.....A..P.T...TPKA.........KKPR.K----Q..KDNS-....--N.......VSG---.........................QGVK.PP.KK....TVA.LE..I....N.G....I.E...........MDI.SG.LPV.PVCSCTGNP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A6A5NKI8_LUPAL/1-337               ................................................................................................................................................MDDD..V..-LN...MS...................................NWG-.Y.YEP.........FKG.GHLG.LQ.LMP.GIT.....DR...G.T...KP...............FLPGRDP.S.Mlv...........ggNDH.DSKPYLS.DRDpsffigvndrdskpflsgrdpsmfvgendrdvklflpgrdpsifiggngtmhprdcivseapmlMNYVR-D.GW...IS.Q....RD...............................RFF..N..M.P.H..V.A.PN....................................Y.A.I.LPE......TS..A.L..T.S.LRTVQ....................................................-........------..L...P..D.-...-.....-T...SRDE.K.....V....-...-.....D..S.IEDSV.VK..K-G.....GQSK.K.RQS..K..G.....A..L.T...TPKT.........KKPR.K----S..KDNS-....--N.......ASV---.........................QSAS.PI.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PINLRT..HWARHGTNKFVTIR.........................................
A0A6A3BT02_HIBSY/1-284               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMT.SMA.....EL...D.T...KP...............FIPDRDP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................dapipMHYIR-D.TW...IS.Q....RE...............................KIF..S..M.M.P..P.S.TAp..................................sY.G.I.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..P.P...P.....DT...ITRD.E.....S....V...V.....G..R.VEEPP.VS..QED.....AQSK.K.RQG..G..P.....G..P.K...TLKA.........KKPR.K----P..KDDTN....ST-.......-----V.........................QRVK.PP.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEN.YNF.SN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A2I4HAQ6_JUGRE/1-280               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLPGRDP.NsI...............MVN.PVNGTFH.PRDcvvs.......................................................eapvpLNYVR-D.SW...AN.Q....RD...............................KFL..N..M.L.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................-........------..-...-..-.P...P.....AL...PRDE.R.....V....-...-.....S..K.IEEPP.VK..NER.....GQMK.K.RQS..G..D.....A..P.K...TPKA.........KKPR.K----P..RDNNN....---.......---SSV.........................QRVK.PA.KK....NID.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A4S4E5Z2_CAMSI/101-412             ................................................................................................................................................MDDG..G..KPEhgwHRmdyy..........................kgvhtPWNM.M.PQHqm.....keANA.CLMN.KK.IMQ.IIA.....EK...N.A...--...............AVEEMNR.-.-...............AIT.EKNAAIE.ERN................................................................EAVKQRD.EA...IA.A....RN...............................---..-..-.-.-..-.-.--....................................N.A.F.RER......DS..A.I..A.A.LRFQEnsmngtlgyg................................iqhgtkrmhhP........TNHPAA..S...A..A.E...A.....AY...NRRE.A.....Q....I...T.....D..T.FPMPT.IP..S--.....EAVN.S.HQA..-..K.....R..A.N...ENKA.........VSS-.KVSKKG..KKVGE....DLN.......RHVT-T.........................DGSK.AE.WD....AQE.LG.lI....N.E....V.N...........FDE.ST.MSP.PVCSCTGLP....RQC.YKWGNGGWQSSCCTTTLSAYPLPQMPNKRHVRMGGRKMSGSVFTRLLSRLAAGG.HDL.SI.PLDLKD..YWSKHGSNRYITIK.........................................
A0A444E869_ENSVE/5-345               ................................................................................................................................................MDEG..G..QRGngrYKtdqy..........................kpshaQW-M.A.PQH.........HLK.E--N.QT.IKL.IMA.....ER...D.K...--...............ALQERDL.-.-...............AIS.EKKAALV.ERD................................................................MAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.VER......DN..A.I..A.S.LEYARengmstscgpgcpsgh....................hgskhtyhyhhqqhlqH........IHPPSQ..Q...L..V.-...D.....AS...GQKK.D.....A....Q...G.....E..M.FPISA.AS..ETG....vKALK.A.KRG..G..K.....G..T.K...VQSSs.......lKKPR.KSKRDG..GDNLS....KQV.......TSAK-Ragewrgevg......vgedltkqvsMAKC.HE.WK....SQD.LG..L....N.Q....V.A...........YDD.TT.MPV.PVCSCTGKY....RQC.YKWGNGGWQSACCTMTLSMYPLPVMPNKRHARVGGRKMSGSAFRKLLSRLASEG.HDL.SL.PVDLRE..HWAKHGTNRYITIK.........................................
A0A0D3HAK6_9ORYZ/1-342               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.L...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
J3MAZ1_ORYBR/1-330                   ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQWMM.P.QQR.........HLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slngsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SVGK.A.KRS..K..K.....N..N.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSG--Ygdd..................sahaSVMK.NE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVIPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A4D9AJW2_SALSN/1-315               ................................................................................................................................................MDGN..G..NMN...LR...................................SWA-.F.LEPp......asNWK.NHLG.LQ.LIP.SIT.....E-...-.-...KPlfggncg.dgfrehqN------.-.Lhp..........spvMSS.INGGPFH.HHRvg...........................................................gisESHIPVE.YW...MN.Q....NK...............................EYL..N..M.Y.S..G.N.HQsay.............................yqssY.G.V.SPE......TS..S.A..Q.S.LQM--....................................................P........QQLNLQ..K...T..E.-...N.....VM...SKME.E.....V....C...E.....E..K.DDGGG.SS..GSA.....MVVK.K.RGG..S..K.....V..T.C...STPI........eKKPRtRTPRAP..RDEHE....HE-.......-PTPSS.........................NRAR.RP.KK....RAE.IV..I....N.G....I.N...........MDA.SE.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTHMSEYPLPPSEKRRGARIAGRKMSIGAFKKVLEKLASEG.YNF.SN.PIDLRS..HWAKHGTNKFVTIR.........................................
A0A1R3GRU4_COCAP/1-282               ................................................................................................................................................MDDD..P..--T...FR...................................NWG-.F.YEPt......ppSFK.GHLG.LQ.LMT.SMA.....ER...D.T...KP...............FIPGRDP.N.L...............-MI.NPNAGFH.PRDcvvs.......................................................eatipMNY--RD.GW...IS.-....RD...............................KFF..S..M.L.P.pT.V.PN....................................Y.G.M.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DP...STRD.E.....R....M...V.....G..R.VEEPP.AN..KEG.....VQLK.K.RQA..G..A.....T..P.K...TPKP.........KKPR.K----P..KDNTN....S--.......----TV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A4U5NJT2_POPAL/1-279               ................................................................................................................................................MDDD..A..-LN...MH...................................NWG-.Y.YEP.........SYK.EPLG.LQ.WMP.SMV.....DR...D.T...KH...............FLPRRDP.I.N...............IMI.GANGAYL.PHDcvvs.......................................................dapehMNYMR-D.SW...IN.-....RD...............................KFL..N..I.L.P..P.N.PN....................................Y.V.V.PTQ......TS..G.A..H.S.MQMLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.R.....L....-...-.....S..R.IEEPS.VS..NEG.....NQLK.R.RQV..G..G....tS..P.K...TPKA.........KKPR.K----P..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PICSCTGTP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
K7L5P7_SOYBN/1-279                   ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....ER...D.T...KP...............FLPGRDP.-.A...............MLM.GANGTFH.PRDcvvs.......................................................eapmpLNYVR-D.SW...IN.Q....RD...............................RFF..H..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..G.A..P.N.LKIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.VEEVV.VK..KEL.....GKSK.K.RHT..K..G.....A..L.S...TPKA.........KKPR.K----P..KDNS-....--N.......VPV---.........................QRAK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SD.LPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
B9S3E4_RICCO/1-36                    ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-----------------------MSTKIHGARIAGRKMCQGAFKKVLKKLVAEE.---.--.------..--------------tvvhf....................................
A0A4U5MN81_POPAL/1-244               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........TVK.GNLG.LQ.LMApTMP.....E-...-.-...KP...............FSGSRSA.A.I...............-MT.SMNGGFH.HRDigvs.......................................................qhmfpMEHMR-D.AS...ID.K....RE...............................KFH..H..V.F.T..G.N.HD....................................Y.D.MvFPE......TS..S.A..N.H.MQMFQ....................................................P........------..-...-..-.-...P.....NS...ENDE.I.....L....-...-.....D..Q.VEGAG.VV..EKE....nGPDK.K.KQR..P..K.....A..L.K...CLKA.........KKGK.RGPQVP..KPDGS....P--.......----SA.........................QQGK.SA.KK....TVE.IM..I....N.G....I.S...........MDI.SL.FPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTCISVHPLPMSLKRRGARIAGRKM----------------.---.--.------..--------------y........................................
A0A1U8ASZ1_NELNU/1-284               ................................................................................................................................................MDDD..G..-LN...IR...................................NWGY.Y.EPQ.........HLK.GHLG.LQ.LMS.TVA.....ER...D.T...KA...............FFAARDS.A.A...............VMV.SPNGAFH.PRDcgvs.......................................................eapvhMDYMKDS.WA...TA.T....RE...............................RLL..H..M.M.P..G.N.PN....................................F.A.V.LSE......AS..A.A.hH.P.LQILQ....................................................P........------..-...-..-.-...P.....DS...SKDE.R.....V....-...-.....A..R.MEDSG.NK..K-E.....GPLK.K.RQG..G..R.....A..Q.K...SPKA.........KKPK.R-VPAP..KDESN....S--.......----AV.........................PRAK.AA.KK....STG.VV..I....N.G....V.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTSLSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLVSEG.YNL.SN.PIDLRP..YWAKHGTNKFVTIR.........................................
A0A1U8NCK4_GOSHI/42-234              .............................................................................................................qrtgihhepglivspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---ASI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A067H1J8_CITSI/23-357              ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............ALQERNL.-.-...............ATS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.S.LQYREnslggnmsscppg.........................cqisrgvkhmhhpqQ........HVHQLH..H...V..S.-...E.....AA...YSRE.M.....H....T...G.....D..A.LPVSP.GA..S--.....EAAK.P.RRY..-..K.....R..A.K...EPKVls.....pnKKTA.KSPRKV..KRENE....DLNk.....vVFG--Kpsewksvqdl....dggdddvnkqsTASK.SD.WK....GQV.LG..L....N.Q....V.T...........FDE.ST.MPP.PACSCTGVL....RQC.YKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A251S3H4_HELAN/2-275               .........................................................................................................................................dhnhfti----..-..---...--...................................----.-.---.........---.----.KT.FMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.M.QER......DE..A.I..S.T.IRF-Rsnfinen......................................misttseP........PENIQN..H...G..S.K...R.....GF...NDEE.M.....H....H...M.....F..E.IPEDY.QL..PPP.....ENTK.P.RKV..P..K.....K..T.K...SQSP.........HVGS.KRADV-..TNVTN....VNS.......DYEESS.........................SDAQ.LE.AW....KDE.LG..L....N.Q....V.N...........FDE.TA.MPV.PVCSCTGVP....QPC.YRWGSGGWQSACCTTTMSMYPLPLVTNKRYSRVGGRKMSGGAFTKLLTRLASEG.YDL.ST.PLDLKD..HWAKHGTNRYS---klk......................................
A0A1J7HYI5_LUPAN/2-306               ............................................................................................................................dgcrrhqdcrhkmeyygggv----..-..---...HS...................................PWNM.D.AQHqre...vkePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.EKNEALA.ARD................................................................LAFRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.E.MER......DI..A.L..A.A.LQNRNna...............................................vnfPs.....ggVQCGSK..R...K..H.Q...S.....AY...STKD.M.....P....V...R.....D..A.TPATV.IT..A--.....EAVK.S.RQA..-..K.....R..L.K...ENKVi.......nSKAS.KS---P..TKLGK....DLNr.....nASSQG-.........................TKIK.SE.WD....KLD.VG..L....N.L....V.A...........FDE.TV.MPA.PVCTCTGVP....RQC.YKWGSGGWQSSCCTTALSMYPLPQLPDKRHARIGGRKMSGSVFTRLLSKLASEG.HDL.SI.SLDLKS..YWARHGTNRYITIK.........................................
A0A398AGY9_BRACM/1-287               ...........................................................................................................................mesggqyengrynpdyykegt----..-..---...HS...................................VWNA.M.PNHhqt..kedqHNA.LVMN.QK.IMS.ILA.....ER...D.A...--...............ALKERDD.-.-...............ALA.AKQEALA.ARD................................................................EALDLRD.KA...LS.L....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DS..A.L..S.A.LQF-R....................................................E........HNLNYI..L...S..R.A...K.....LG...ASQS.S.....H....L...P.....N..P.SPLST.IP..HEA.....APSK.R.K--..-..-.....-..-.K...KRKP.........ET--.--RSKG..KRVGE....DHV.......-ASPG-.........................KKCR.KD.WD....SNV.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RHC.YKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQG.HDL.SS.PVDLKD..YWARHGTNRYITI-m........................................
A0A0E0IP32_ORYNI/1-342               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
A0A1S2Z1J0_CICAR/1-288               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPv.......sSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LLGGHNA.A.V...............-LS.GGNGAFH.HRDiglp.......................................................qttypMDYMR-D.AW...IS.S....QRdn...........................kyMNM..N..M.I.P..T.N.PG....................................Y.S.G.IPE......TS..S.A..H.H.IQMIQ....................................................P........------..-...-..-.-...P.....EL...LKEE.R.....P....T...E.....D..A.APPV-.VE..KTN.....GTGK.K.RQG..L..K.....V..P.K...SPKA.........KKPK.RGPRDP..KDENT....R--.......---SVP.........................RTPR.VP.KK....TTE.IA..I....N.G....I.D...........LDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTAISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5N6LH65_9ASTR/1-304               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMS.PMG....dHR...D.P...KP...............FQSLRES.P.V...............MVN.PNVSTYH.HPHtrvvs......................................................nppapMNYMR-D.AW...IQ.-....RE...............................RLL..H..M.L.P..G.N.TS....................................F.S.V.LPS......SS..T.S..H.S.IHMVP....................................................Pldl..skdPVMNMA..V...E..D.N...V.....AV...SKDS.G.....S....V...G.....G..G.SGTGN.SG..GDG.....GSIK.K.RGS..T..T.....A..P.K...ASGS.........RKPK.KTRKTP..STPKE....NGN.......SSG---.........................-HRA.KT.IK....NVD.VV..I....N.G....I.D...........MDM.SG.IPI.PVCTCTGAP....QQC.YRWGLGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.AN.AIDLRT..YWAKHGTNKFVTIR.........................................
A0A2G2V792_CAPBA/1-310               ................................................................................................................................................MDGN..G..SMN...IR...................................NWG-.F.LEPp......ttVLK.GNLG.LQ.LMS.SMD.....EK...P.H...FGnlrdyh...yhhqqqTHQPDHP.T.V...............MAS.TNGGAFH.HHRvcgls......................................................espmpMEYMR-D.AW...VN.H....KDy............................reKYL..N..V.L.S..A.N.HPyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQMYQ....................................................-........------..-...-..-.Q...P.....NL...VKVE.T.....A....-...-.....P..L.VEEVC.QE..RDT....gGIAK.K.RGA..D..K.....SpvL.K...SPKP.........KKAK.KATTAP..KDDST....---.......-P--SF.........................PRTR.AP.RK....SAE.VN..I....N.G....I.N...........MDI.SR.IPI.PICSCTGSS....QQC.YRWGCGGWQSACCTTNLSSYPLPMNIKRRGSRIAGRKMSLGAFMKVLEKLASEG.YNF.SN.PIDLRP..HWAKHGTNKFVTIR.........................................
A0A6A5NJV6_LUPAL/1-281               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LLGTRNA.-.V...............VLS.GNHGGFH.HRDigms.......................................................haaypMDYMR-D.AW...ISsQ....RE...............................KYM..N..M.I.P..T.N.LT....................................Y.G.G.IPE......TS..S.A..H.H.MQMIQ....................................................P........------..-...-..-.-...P.....KD...PKEE.R.....A....-...-.....-..-.IEEEP.VV..EKV.....SGTS.K.KRQ..S..K.....V..P.K...SPKA.........KKPK.RGPRVP..KDDG-....---.......APS--V.........................QRAR.VP.KK....SVE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGMSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTI-s........................................
A0A2I0I162_PUNGR/1-94                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTTISMYPLPQIPNKRHARVGGRKMSGSVFSKLLSRLAEEG.HDL.SV.PLDLKD..YWAKHGTNRYITIK.........................................
A0A0L9UU47_PHAAN/1-150               .......................................................................................................................medcrqnendihkmeyyrgphfmhq----..-..---...--...................................----.-.--Vk.......ePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............VILKLEL.E.A...............-AI.SEKNALA.AQD................................................................EAIQERD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LEQ......DN..S.L..T.T.LQS-Q....................................................N........TAYKTK..D...A..F.P...I.....TV...IPSE.V.....V....K...S.....H..Q.VNRAK.EN..K--.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------aigpkasnlpykhqvkepna.....................
A0A5P1EMS0_ASPOF/1-279               ................................................................................................................................................MDDD..G..GLN...MR...................................NWSY.F.DQP.........-LK.GSLG.LQ.LMS.NVA....qDR...D.T...KP...............LLSNGG-.F.L...............H-R.DCGVAEP.SVP................................................................MDFIR-D.SW...IH.H....NRd............................hnKIL..H..V.L.P..M.N.HHq..................................sF.N.M.IPD......TS..A.S..Q.T.IQILQ....................................................P........------..-...-..-.-...P.....NP...PKEE.K.....I....-...-.....P..Q.VDNFN.NH..IDT.....PSKK.K.RSQ..G..R.....P..I.K...SPKQ.........KKPK.KVNNHG..RDDAD....NVS.......-I----.........................-SKG.KI.KK....STA.LV..I....N.G....I.D...........LDL.SG.IPP.PVCSCTGNP....QQC.YRWGFGGWQSACCTMNISMYPLPMSAKRRGARIAGRKMSQGAFKKVLEKLAGEG.HNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A1U8KXT0_GOSHI/1-289               ...............................................................................................................................................m----..-..---...--...................................QWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A5N5HKP0_9ROSA/1-339               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................kaaqgQWL-.M.-HN.........QPS.M---.KQ.VMA.IMS.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DS..A.I..A.T.LHY-Rdnslnsgngsscppgc....................qisrgvkhmhhtqqqqH........VHHMPH..M...N..E.-...P.....TY...GTRD.M.....H....T...S.....D..S.ITMPP.ET..S--.....VPTK.S.RQP..-..K.....R..P.R...EPKTtq.....pnKKPS.KSPRKM..KRESE....DLNk.....mTFDKLHdwkggqdmg......segddlnkqvVVSK.SD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PMCSCTGLL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLTAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0D3HAK5_9ORYZ/1-342               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................xprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.X...P.....XQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
BBRC_ORYSJ/1-290                     ................................................................................................................................................MNDD..A..SMSsmgLR...................................GWGA.F.YEP.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KH...............LLSATPF.L.H...............HHQ.HQQYVPH.HHH................................................................QPHHPRD.CG...TN.A....NA...............................---..N..G.N.G..N.G.VG....................................Y.G.M.MPA......TH..T.L..R.M.LQHQP....................................................E........PQPQLQ..H...P..P.S...P.....PH...PKEE.C.....I....S...P.....P..L.MEENV.PV..K-P.....PPPK.K.RQQ..G..R.....Q..P.K...VLRP.........KKPK.K-PAAP..CEDGA....PP-.......--SAPA.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.RICSCTGAP....QQR.YRWGAGGWQSACCTTTVSTYPLPMSMKPRGARIAGRKMSHGAFKKVLEKLASEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
H1ZN91_SOLLC/1-323                   ................................................................................................................................................MDDS..G..NRDngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.F..A.T.LQYREtsmtagqivr................................gvkhmhhpqqH........VHHQPH..M...G..E.-...P.....TY...NPRE.M.....H....M...V.....E..A.IPVSQ.PA..P--.....EPAK.P.RRN..-..K.....R..A.K...EPKAat.....gsKKTP.KASKKV..KRETE....DLN.......QTTYGKspewkgaqem....vgasddlnrqlSVAK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..NWAKHGTNRYITIK.........................................
A0A2G3BFJ0_CAPCH/1-207               ...................................................mvmlrrdatlaernaliqerddaiialqlqdsstnndnmvpdspengtesdakhiygqqqilrtlaeaiiviatttydwailheidsdkkgyt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................---Q.LT.SG....KDD.WG..L....N.Q....I.N...........CDE.SA.MPV.PVCSCTGTP....QLF.YKSGHGGWQSACCTTTISMYPLPQISNKRYFRVGGRKMSGGGFSKLFNRLAAQG.YDL.SI.PLDLKD..HWAKRDTNRYNTLK.........................................
A0A2G2XG90_CAPBA/101-414             ..........................................................................................................................hsrwvfsicfpplmmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RNali........................qerdD--..-..-.-.-..-.A.IAalrlq.........................dsstndN.N.M.VPD......SP..G.N..G.T.ESGAK....................................................H........IYNQQQ..M...H..R.T...I.....AE...AAHG.S.....M....K...D.....P..A.AGYLK.DT..D-T.....SEVK.V.PKK..V..R.....R..P.K...ESRH.........NKQA.KIPRVS..KNGAE....SLN.......MQVIATtsddwanl........qemdsdkdgDTQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQG.YDL.SI.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A151RQK4_CAJCA/108-238             ......................................................................................................................................pgcqisrddl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......--NKQL.........................AVSK.AD.WK....GQD.LG..L....N.Q....V.S...........YDE.ST.MPA.PVCSCTSVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A453IJ74_AEGTS/1-92                ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...M-.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------.........................................
A0A0E0DW52_9ORYZ/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.I.PQTq.......rQLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........ESSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A5D2ZSH7_GOSMU/1-282               ................................................................................................................................................MDE-..N..ALN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................evhipMNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.LLE......TP..A.A..Y.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.AN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPEA.........KKPK.K----P..KENAN....YT-.......-----V.........................QCVK.SA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.SS.PIDLRS..HWARHGTNKFVTIR.........................................
A0A5A7VDN8_CUCME/1-338               ................................................................................................................................................MDDS..G..HREngrHKpdqy..........................ksaqgQW--.M.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnsinnnlscppgcq........................iargvkhihhpqqqH........THHVPH..M...N..E.N...-.....NY...NSRD.M....lA....S...N.....D..P.CPTSP.VA..S--.....ESTK.A.RRN..-..K.....R..T.K...EGKTvt....tpnKKVS.KGPRKV..KREAE....DLNk.....iMLGKSQewkdgigim......sggddlnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PICSCTGVI....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEG.HDL.SS.PVDLKN..HWAKHGTNRYITIK.........................................
M4EDF3_BRARP/1-279                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPaa.....atSFK.GNLG.LQ.LMP.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.QTGSYHH.QHH...............................................................hPEPHMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..A.T.TTp.................................nyG.N.V.LPQ......TS..S.S..P.S.MHMN-....................................................-........LHHHHH..Q...T..D.E..hP.....VK...CE--.-.....-....-...P.....D..I.IETKK.--..---.....RKPN.S.KAG..G..-.....-..-.-...--AA.........TKAK.K-PRKP..KEENG....DSN.......NAN--V.........................SRVK.PA.KK....SFD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
M0S854_MUSAM/76-210                  ...................................................................................................................................genetplkkrskg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......-----Rpq.....................kfPKPK.KS.KK....SAE.MV..I....N.G....I.S...........LNT.SG.IPT.PVCSCTGKP....QPC.YRWGAGGWQSVCCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLTEEG.HSL.CN.PIDLRS..FWAKHGTNKFVTIR.........................................
A0A5E4F3B1_PRUDU/30-366              ................................................................................................................................................MDDS..G..HREngrIKaeqy..........................kaaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKAALQ.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnslnngnvsscppg.......................cqisrgvkhmhhpqqH........VHHPPH..M...N..E.-...A.....SY...GTRD.M.....H....T...S.....D..S.IPMPP.DA..S--.....LPTK.S.RQP..-..K.....R..P.R...EPKTma.....pnKKTS.KSPRKV..KRESE....DLNk.....mTFDKLHewkgsqdmg......gggddvnkhlVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A2I0XBD4_9ASPA/1-312               ................................................................................................................................................MDDE..G..TPG...LQ...................................NWGR.Y.YRP........pPLK.GNLG.LQ.LMS.NVG.....EP...M.T...MP...............FLSGGHG.S.Ny............trREC.GMPEPFS.PKRcifspkg.................................................tpelssmpIDYSR-D.IW...FH.N....NDq............................ngKIL..H..V.F.P..G.N.HHqhsnsy........................gallpeA.T.V.ASA......GT..S.A..H.T.LQMLQ....................................................P........------..-...V..D.P...P.....KE...EKAA.V.....I....E...D.....P..G.VSQLD.IV..P--.....LKKR.S.KGQ..G..R.....P..F.K...HSKQ.........NMGK.K-AIAP..KEES-....-VN.......----SS.........................GRRR.SA.NK....NLD.MV..I....N.G....I.D...........LDL.SG.IPA.PLCTCTGQP....QQC.YRWGAGGWQSACCTTSMSMYPLPMSTKRKGARIAGRKMSQGAFKKVLEKLAGEG.QDF.SN.PIDLKP..FWAKHGTNKFVTI-s........................................
A0A1Q3C548_CEPFO/54-335              ................................................................................................................................................MDDD..A..-LN...IR...................................NWG-.Y.YEP.........TFK.GHLS.LQ.LMS.SMA.....DR...D.T...KS...............FLPARDP.N.L...............M-V.SSNGAFS.PRDcmvs.......................................................dtsipMNYVR-D.SW...IS.Q....RE...............................KFL..N..M.L.P..A.N.PS....................................Y.P.V.LPD......TS..A.T..P.S.MQQIL....................................................-........------..-...H..Q.Q...P.....NS...SRDE.R.....V....V...G.....N..R.MEEPS.VN..KEV.....VQLK.K.RHG..G..T.....G..P.K...APKV.........KKAR.K----P..KDSNK....T--.......----TV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A1S3BBW9_CUCME/1-338               ................................................................................................................................................MDDS..G..HREngrHKpdqy..........................ksaqgQW--.M.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnsinnnlscppgcq........................iargvkhihhpqqqH........THHVPH..M...N..E.N...-.....NY...NSRD.M....lA....S...N.....D..P.CPTSP.VA..S--.....ESTK.A.RRN..-..K.....R..T.K...EGKTvt....tpnKKVS.KGPRKV..KREAE....DLNk.....iMLGKSQewkdgigim......sggddlnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PICSCTGVI....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEG.HDL.SS.PVDLKN..HWAKHGTNRYITIK.........................................
A0A498ITJ6_MALDO/1-298               ......................................................................................................................................mdyyrggvas----..-..---...--...................................PWNM.M.AQQqa.....kePNA.LVMN.KK.IMS.IIA.....DR...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALRQRD.EA...LT.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.Y..A.A.LHS-Rdnavnfplgg...............................gaqrgakrmqrP........SNHSVT..L...A..D.-...V.....HY...STKD.V.....H....I...T.....E..A.YPISV.IS..P--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAK.QSRKKV..GEDL-....--Nr.....qASSD-G.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A078JRW0_BRANA/1-284               ...............................................................................................................................menggqyangsdylkga----..-..---...HS...................................MWNM.L.PHHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKMEALA.ARD................................................................QALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................N........SLNFAL..S...G..G.K...R.....CQ...GGDD.D.....D....-...-.....V..L.FTIDD.LC..P--.....----.-.TTS..T..N.....T..T.K...SIKR.........KKDN.K--PKG..KKVGE....DLN......lLVAAPG.........................KKCK.KD.WD....TNH.FG..L....N.L....V.T...........FDE.KT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTSLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSHLAAEG.CDL.SS.HVDLKD..YWARHGTNRYITIK.........................................
A0A2R6R6U2_ACTCC/1-296               ................................................................................................................................................MDDS..R..QHEngrHRidiy..........................kgmhtPLNM.M.PQYqv.....keVNA.FFMN.KK.IMH.IIA.....EK...D.A...--...............AIDEMNR.-.-...............AIN.DKNVALE.ELN................................................................DAIKQRD.EA...IA.A....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.RER......DS..A.I..A.A.LRFHE....................................................N.......sMNGTLGggA...N..R.A...I.....KR...AHHE.A.....Q....I...P.....E..A.IPISV.VS..S--.....EAAK.S.HQT..-..K.....Q..R.K...KKRG.........VSSS.KSPRKG..KKVGE....DLN.......RHVT-T.........................DGSK.AQ.WE....AQE.LG.lI....G.E....V.N...........FDE.ST.MSA.PVCSCTGVP....RQC.YKWANGGWQSSCCTTTLSMYPLPQMHNKRHSRMGGRKMSGSVFSRLLSRLAVDG.YDL.SL.PVDLKN..YWAKHGTNRYITIK.........................................
A0A078FN78_BRANA/1-286               ...............................................................................................................................menggqyangsdylkga----..-..---...HS...................................MWNM.L.PHHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKLEALA.ARD................................................................QALLQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................N........SLNFAL..S...G..G.K...R.....CQ...GADD.D.....D....D...D.....V..L.FTIDD.LC..P-T.....TST-.-.---..-..N.....P..T.K...EIKR.........KKEN.K--PKG..KKVGE....DLN......lLVAAPG.........................KKCK.KD.WD....TNH.FG..L....N.L....V.T...........FDE.KT.MPV.PVCTCTGSA....HQC.YKWGNGGWQSSCCTTTLSLYPLPQKPNKRHSRVGGRKMSGNVFSRLLSHLAAEG.YDL.SS.RVDLKD..YWARHGTNRYITIK.........................................
A0A4S4EG24_CAMSI/2-269               ......................................................................................................................stgaekpllggrshpavmatanggaf----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.H...............HMP.TNTGPFN.PRVcgvs.......................................................espmpMDYIR-D.VW...IN.Q....RE...............................KYL..N..A.L.P..G.N.HHh.................................snF.N.V.LPE......TS..G.G..Q.H.MQMLQ....................................................P........------..-...T..D.-...-.....-S...PKDE.S.....V....-...A.....Q..M.EETSA.KR..DSG.....GPLK.K.RAG..N..K.....T..E.K...SPKT.........KKAK.KAPISP..RDECS....-V-.......----SV.........................QRAR.AP.KK....SME.IV..V....N.G....V.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTSMSMYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLSSDG.YNF.SN.AIDLRT..HWAKHGTNKFVTIR.........................................
A0A175YQL4_DAUCS/1-287               ...............................................................................................................................................m--ND..G..GLN...SR...................................NWNF.Y.EQH........yNRP.GNLN.LH.LFP.SFE.....RR...I.S...GP...............FLGRENA.I.V...............-MN.QNGGQLC.PFVpe............................................................spLHVDPTK.DA...VA.R....DK...............................FVQ..Q..M.I.S..A.N.SS....................................F.A.G.YHE......HP..A.A..H.S.MHMLQ....................................................-........--QQLQ..Q...P..P.Q...Q.....H-...-EFP.K.....D....V...R.....V..A.VDTSV.KK..EDG.....APVK.K.RQS..L..A.....A..P.K...PPKA.........KKPK.RCQTIQ..KENGT....---.......--SS-G.........................HRAK.AA.RK....NMD.VV..I....N.G....I.N...........MDF.SS.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEN.FNF.AD.AIDLRY..HWARHGTNKFVTIR.........................................
A0A6A2ZG71_HIBSY/1-336               ................................................................................................................................................MDDV..G..HREngrVKtdqy..........................raaqgQW-L.M.HQP.........--S.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.DRD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.AER......DS..A.I..A.N.LHYQEnssssgnmsscpqg........................lhmsrgmkhmqhpqQ.......nIHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....S...A.....G..S.LPVMP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....anKKAS.KPPKKV..KQENE....ESNk.....iMPGKSRewkgpqdvd......gagddlnkqlVTAK.LD.WK....GKD.LG..L....N.Q....V.V...........FDE.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTALSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAEEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A1S4AAE8_TOBAC/1-332               ................................................................................................................................................MDDS..G..HHEngrHKpp...............................qgQW--.F.LQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKRATLA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.T..A.T.LQYQEnsmnsgnmspcppg.......................cqiarelkhmhhpqqH........VHHQPQ..L...G..E.-...P.....TF...NHSD.M.....H....M...N.....E..S.SIQSP.AA..P--.....EPTK.S.RRN..-..K.....R..S.K...EAKLvt.....ssKKTS.KPSKKV..KKEGE....DLNk.....sMLDESQewngaqemg......ggnddvnrqlGVTK.TD.WK....DQD.LG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTNNLSMYPLPTLPNKRHARIGGRKMSGSAFTKLLSRLAAEG.YDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A445KNR8_GLYSO/1-279               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GIT.....ER...D.T...KP...............FLPGRDP.-.A...............MLI.GANGTFH.PRDcavs.......................................................eapmpLNYVR-D.NW...IN.P....RD...............................RFF..N..M.QqP..T.N.PS....................................Y.A.V.LPE......TS..G.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DS...SSDE.K.....V....-...-.....D..R.VEEVA.VK..KEG.....GQSK.K.RQT..K..G.....A..L.S...TPKA.........KKPR.K----P..KDNG-....--N.......APV---.........................QRAK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPT.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A3N6RK03_BRACR/1-269               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.HPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TSn.................................nyG.N.I.LPE......TS..S.A..Q.S.MRHHQ....................................................T........----ID..E...Y..P.-...-.....--...VKHE.Q.....-....-...-.....-..-.VEEIV.--..Q--.....-TNK.K.RKP.nT..K.....P..G.A...SAKA.........KK--.--PRKP..KEESD....K--.......-----S.........................IKVK.QA.KK....SVD.FV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A0D9WLD5_9ORYZ/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngypqg.....................slngsknihhhdqlshA........QASPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SVGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSS...dWKNv.....gMSDCGDds....................anaSVMK.ND.WK....DKD.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVIPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A200QQX0_9MAGN/1-326               ................................................................................................................................................MDGS..G..QREngrHKqdmyn.........................rgthnPWSL.-.PPYl.......mKDH.HALS.IK.FMT.LLN.....ER...D.T...--...............AFQERDL.-.-...............ALA.EKKAALA.ERD................................................................MAILQRD.TA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.Q.LER......DN..A.I..A.A.FEYQEnitmngssgacppg........................cgaprgmkhvhrlsH........VHHSSH..I...A..E.-...P.....AY...NTRE.M.....H....V...S.....D..A.YPISV.AS..S--.....EPVK.P.RRG..-..K.....R..T.K...DTKAms.....cnKSPS.KRSRKS..KKGSG....HEWgs...deDLNKQM.........................TGIK.SE.WK....DQD.LG..L....N.Q....V.N...........FDD.ST.MPV.PVCSCTGML....QPC.YKWGQGGWQSACCTTTMSMYPLPVMPNKRHARIGGRKMSGGVFTKLLSRLASEG.HDL.ST.PLDLKD..HWSKHGTNRYITIK.........................................
M0ZWF8_SOLTU/5-320                   ...........................................................................................................................................rvksa----..-..KFS...MY...................................QW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnamtggqivr................................gvkhmhhpqqH........VHHQPH..M...G..E.-...P.....TY...NPRE.M.....H....M...V.....E..A.IPVSP.PA..P--.....EPAK.P.RRN..-..K.....R..A.K...EPKAvt.....gsKKTP.KASKKV..KRETE....DLN.......QTTYGKspewkgaqem....vgasddlnrqlAVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..NWAKHGTNRYITIK.........................................
A0A1U8AU50_NELNU/1-322               ..........................................................................................................................................mndviy----..-..---...--...................................MW-M.I.PQHqm.....keHHA.LTVK.QQ.IMA.IAA.....ER...D.A...--...............AIQERNM.-.-...............AFS.EKKVALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DN..A.I..A.A.LEYREsamngsgtptcppg........................cevprgmkhihhpkH........---GYH..P...P..H.L...G.....EA...PHHS.R.....N....I...S.....E..A.FPISA.AA..AAPv..eaFNFN.P.HRV..K..A.....P..T.K...ESKAvlf..kkssKWTT.KSSKKG..KKGGE....DLNkh...asV----Avaks.................hdwkSGPE.SE.WK....GQE.LG..L....N.Q....V.S...........FDE.ST.MPP.PVCSCTGVQ....KQC.YKWGNGGWQSACCTTTLSMYPLPVMPNKRHVRVGGRKMSGSAFNKLLSRLAAQG.HDL.ST.PIDLKD..HWAKHGTNQYITIK.........................................
A0A251UNX4_HELAN/1-316               ................................................................................................................................................MDDN..G..HREngrQKqp...............................hgQW-L.M.-QH.........QPT.M---.KQ.IMT.IIS.....ER...D.A...--...............AIQERNL.-.-...............AMS.EKKTALA.ERD................................................................MALLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmsnsnnnt................................psscppgcqiS........-RNVKH..V...H..H.P...Q.....QY...QQDD.T....nL....G...S.....G..L.LPASP.PP..E--.....-PAK.S.RRA..-..K.....R..T.K...EIKPgt....ptaNKTS.RSSRKV..KLECD....DLNk.....aMYEDAHdwdgg..............gggelnHGPK.PE.WK....DQD.LG..L....N.Q....V.A...........YDD.TT.MPI.PVCSCTGVF....RPC.YKWGNGGWQSSCCTTTMSMYPLPSLPNKRHARVGGRKMSGSVFNKLINRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A5C7HBI0_9ROSI/24-215              ......................................................................................................................tsgtslnpssglpvtpirsiasttes----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.VNNVD.PS..G-T.....KSSK.V.KRQ..K..S.....S..M.K...GGSN.........QVGS.K-VVKP..KKASG....SKK.......AKGQTL.........................PETK.RE.KK....NPN.ID..M....D.G....M.N...........FDF.SG.VPS.PVCSCTGTT....RVC.YKWGAGGWQSSCCTISVSEYPLPMSSTRPGVRLAGRKMSNGAYLKLLLRLASED.HDL.SL.PVDLKD..HWARHGTNKFVTIK.........................................
A0A0E0IP30_ORYNI/1-342               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A067K5V2_JATCU/1-318               ................................................................................................................................................MDDG..G..QHH..nARfkmey........................lkaansTWSL.M.PPPpaq..ikeqSNA.LVMN.KK.IMA.ILA.....ER...D.T...--...............AIKERNM.-.-...............AIA.ERREALA.ARD................................................................EALQQRE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREngmnfplsng................................nqrgskriphP........LYNPNE..V...V..-.-...E.....AL...NAGE.M.....H....I...T.....D..A.FPLTT.IS..A--.....ESLK.Q.QRQ..P..K.....R..T.K...ENKAv.......sMKAT.KSSRKG..NKVGE....DLN......rQGVPEA.........................KKFK.AQ.WD....SHV.AA..L....N.L....V.N...........FDE.ST.MPV.PVCSCTGVP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLASGG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A540L8E0_MALBA/1-311               ................................................................................................................................................MDDG..R..QHEngrHKmdyyr.........................ggvasPWNM.M.AQQqa.....kePNA.LVMN.KK.IMS.IIA.....DR...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALRQRD.EA...LT.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..V.Y..A.A.LHS-Rdnavnfplag...............................gaqrgakrvqrP........SNHSVT..L...A..D.-...V.....HY...STKD.V.....H....I...T.....E..A.YPISV.IS..P--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAK.QSRKKV..GEDL-....--Nr.....qASSD-G.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A0K9P6X8_ZOSMR/19-309              ................................................................................................................................................MDDD..G..VLG...IS...................................NWGY.Y.DQP.........SKN.NQLG.LQ.LMS.GMSleqqqQR...G.R...KP...............VLSSNAA.T.Fl............hcDMT.EQQSVRS.STS................................................................MEIIR-E.GW...LH.N....RE...............................KMI..Q..M.F.P..P.T.HH....................................-.-.-.---......--..N.C..Y.T.LQF-D....................................................P........APTTEQ..S...K..E.-...-.....-I...KIEE.E.....SgrrrT...H.....Q..D.VPQTV.VP..LNK.....KKKK.N.KQD..-..Q.....P..C.K...IPKV.........AKSK.I-VRDE..MDGGD....SSS.......VPKVG-.........................RSDS.SV.RK....NTE.VT..I....N.G....I.D...........LDI.SR.IPT.PVCTCTGVP....RPC.YRWGVGGWQSACCTTSISMHPLPVSTKRRGSRIAGRKMSHGAFKKVLEKLAGEG.YNL.SN.RIDLRS..HWAKHGSNKFVTIR.........................................
R0HTS8_9BRAS/43-336                  ...............................................................................................................................................m-ENG..G..QYDngrFKpdyl..........................kgaqsMWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKKEAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.Y..A.A.LQHHE....................................................Nsl....nfALSGGK..R...A..D.G...D.....DC...FGTE.T.....H....K...L.....A..V.FPLST.IP..P--.....EVTN.T.KVN..-..K.....R..K.K...ENKQ.........G---.--QVKL..KKVGE....DLN......rRVAAPG.........................KKSR.TD.WD....SQD.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGSA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEG.YDL.SC.PVDLKD..YWARHGTNRYITIK.........................................
A0A2H3XU47_PHODC/47-303              ....................................................................................................................haesvlkpvsglsvpnsigsgrqetslr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.--M................................................................SSYINRD.SI...AG.E....CN...............................SGA..M..D.F.S..W.I.PQ....................................R.S.F.MSQ......TK..N.M..N.S.SHA-T....................................................P........VNSEMI..D...A..Q.G...V.....PV...AAEG.A.....M....Q...E.....G..V.LEAKP.LK..VRK....kHPST.R.KNN..H..T.....A..T.K...LLRQ.........KEPK.KQPSVP..AEKKG....---.......---NST.........................SKGK.RE.KK....TQD.II..V....D.G....T.M...........VDF.SN.VPV.PVCSCTGVP....HQC.YRWGAGGWQSSCCTMSISEYPLPMSPSRPGARLAGRKMSIGAYRKLLHRLAAEG.HDL.SY.AVDLKD..HWARHGTNKFVTIK.........................................
A0A1S3X6F2_TOBAC/42-270              ...............................................................................................................wfetqmgprpgsypmasqvnhkvetfdshfpwt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........--HQDN..R...F..P.-...A.....TK...DGSK.S.....K....P...Y.....A..A.VPIRS.VA..PTG....eQHMN.V.KVK..A..K.....R..Q.K...VKKN.........KMSA.KELREI..ASKLF....KVE.......QPENKPs......................asKRTK.GE.SRcgeaTVT.KN..P....N.S....V.I...........ADF.CG.VPP.PFCSCTGVA....RRC.YKCGVYGWQSSCCTTTLSEYPLPMNPSKPGNRLGGRKMTNGAYTKLLLRLAAQG.RDL.SN.PVDLKN..HWAKHGSNKFITIK.........................................
A0A2P6PZ01_ROSCH/1-342               ................................................................................................................................................MDDG..G..HREngrLKaeqqy.........................kaaqgQWL-.M.-QH.........QPH.QPSM.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AFS.EKKTALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DN..A.I..A.T.LQYREnssltsgnvsscppg......................cqisrgikhmhnpqqH........VHHLPH..M...N..E.-...A.....SY...GTRE.M.....H....T...N.....D..S.LPLPP.DP..P--.....TAPK.S.RQT..-..K.....R..P.K...EPKTmp.....pnKKPV.KSPRKV..KRESE....DLNk.....mTFD--Rlhewkggqem....cggaedlnkqlVVSK.SD.WK....CQD.LG..L....N.Q....V.A...........YDD.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTMSIYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A444ZYT1_ARAHY/1-303               .......................................................................................................................................mdssqheng----..-..---...-Rhnmdy........................yrgahsLWNM.D.SQHrv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...AI...............LVLELEA.-.-...............AIS.EKNEALA.ARD................................................................LALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.KER......DN..A.L..T.A.LKSQNif...............................................ksgD.......gVQRGSK..R...M..R.Q...T.....AC...SPKD.I.....S....R...R.....D..V.SPMTA.KV..S--.....EAVK.S.NQA..K..R....mQ..D.K...NVIN.........SKVS.KPHSKA..KKMGE....DLN......rQAASEG.........................IKFK.SE.WD....MQD.VG..L....N.L....V.A...........FDE.TI.MPV.PICTCTGVP....RQC.YKWGNGGWQSSCCTTTLSVYPLPQLPNKRHARIGGRKMSGSVFTRLLSRFALQG.HDL.ST.PLDLKN..YWARHGTNRYITIK.........................................
A0A5J5AMR9_9ASTE/1-299               ..........................................................................................................................................mdqnhl----..-..---...--...................................----.-.---.........---.--MI.KT.YMA.IMA.....ER...D.A...--...............AMRERSM.-.-...............ALE.ERKRALA.ERD................................................................LAMLQRD.AA...IA.E....CNaakserde..............afaalrfqeS--..-..-.-.-..-.-.-Smngnhm.......................ntpdspeN.G.I.ILR......TK..Q.I..H.H.QQQMH....................................................-........-YHMAH..F...L..E.-...A.....AQ...YSRE.V.....P....P...V.....D..A.FQVTG.VA..F--.....DTAK.P.RNV..-..K.....Q..T.K...DTKGi......stSKSS.KSPGKG..KKGF-....GGN.......GCKDEHdfdg.................needLNRK.LV.VW....DDD.SG..L....N.Q....V.D...........YDD.SA.MPL.PVCSCTGVP....QPC.YKWGNGGWQSACCTTTMSMYPLPQMSNKRYSRVGGRKMSGSAFRKLLNRLATEG.HDL.ST.PLDLKD..HWAKHGTNRY----saqk.....................................
A0A067KPQ0_JATCU/4-278               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........TFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLPGRDP.N.N...............IMV.GASAAFH.PRDcvvs.......................................................dapvpMNYVR-D.SW...MS.R....VN...............................---..-..M.L.P..P.N.PN....................................Y.A.V.LPE......TS..S.A..H.S.LQVLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.R.....V....-...-.....A..R.IEEPN.VN..KEG.....SQLK.K.RQG..G..G.....A..P.K...TPKA.........KKPR.K----P..KDNSN....---.......---NAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2R6S2P0_ACTCC/1-294               ..........................................................................................................................................ehnlti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNA.-.-...............ALD.ERRRAFA.ERD................................................................MAMLQRD.MG...IA.E....RN...............................---..-..-.-.-..-.-.--....................................T.A.I.EER......DK..A.L..A.A.LQFREssmnenymsphslg........................dgiacggkhlhhqyQ........VHSTPH..L...A..E.T...A.....YD...PSET.P.....T....S...P.....S..E.IPTSN.SF..QSTgv.asNTAK.P.RKV..-..K.....Q..P.K...EIKEt.......sTKKS.KSPRQG..KRGIE...qDL-.......GGDDED.........................LDGP.FV.VL....TDS.LG..L....N.Q....V.I...........FDE.ST.MPG.PICSCTGAP....QPC.YKWGNGGWQSACCTTTISVYPLPQMSNKRHARVGGRKMSGGAFAKLLNRLAAEG.HDP.YT.PLDLKD..HWSKHGTNRYSTLK.........................................
A0A1U7V4R1_NICSY/1-309               ...............................................................................................................................................m-DG-..N..GMN...IR...................................NWG-.F.FEPa......atVLK.GHLG.LQ.LMS.SMD.....E-...-.-...KP...............LFGNIRD.-.H...............HHH.HNHQTHQ.PHHptvmestnggafh......................................hhrvcgisetpmpIEYMR-D.SW...VN.H....KDy............................rdKYL..N..V.L.S..G.N.HHyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQIHE....................................................-........------..-...-..-.Q...P.....NL...VKVE.P.....D....-...-.....P..Q.LEEVC.LE..RDI....gGLAK.K.RGA..G..K.....SqlL.K...SPKS.........KKAK.KATRIP..KVEST....---.......-P--SV.........................PRAR.AP.RK....SAE.VV..I....N.G....I.T...........MDI.SV.IPI.PVCSCTGVA....QQC.YRWGCGGWQSACCTTNLSSYPLPMNTKRRGSRIAGRKMSLGAFTKVLEKLASEG.YNF.SN.AIDLKP..YWAKHGTNKFVTIR.........................................
A0A2G9H957_9LAMI/3-167               ...................................................................................................................................sdpgiaavpirtv----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.-A..P-K.....KPGK.K.W-E..R..K.....T..N.Y...SYKM.........QPFA.SHISKP..KELKK....KTC.......ASE---.........................---K.AK.PK....SKP.EV..H....E.E....N.R...........FDF.SN.VPS.PFCSCTGVA....RRC.YKSGAGGWQSSCCTNSLSEYPLPLNPLKPGKRISGRKMSRGP--GLLYTLAIGV.HDL.SQ.PVDLKN..HWAKHGTNMFVTIK.........................................
A0A5N5HAD8_9ROSA/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.T...KP...............FVPGRDP.T.V...............-MV.SANGAYH.PRDcvvs.......................................................daqlpMSYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN...................................yA.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...P..-.-...-.....EP...SRDE.R.....V....-...-.....G..R.IEEPV.VP..KEV.....GTSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----A..KDNT-....---.......--NPSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PICSCTGVP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.TN.PIDLRS..HWAKHGTNKFVTLR.........................................
V4KPA5_EUTSA/1-164                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GSLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGREP.N.L...............M-I.GSNGSYH.PREh..............................................................eSSIPMNY.SW...MN.Qp..kDN...............................KFF..N..M.L.P..P.N.YN....................................N.M.M.HQP......VL..N.S..S.R.FKENSipp..............................................pppP.......lEDKLNK..K...R..K.T...K.....SC...NTTT.T.....L....K...A.....K..K.LQKPK.LE..SDT....tNNVQ.H.QQQ..Q..Q.....R..V.K...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------pvkkr....................................
A0A5N5N220_9ROSI/1-313               ..............................................................................................................................medqngrykmdyyksahp----..-..---...HP...................................PWNM.M.PRNqv....keqTNA.LAMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............AFA.EKKEALA.ALD................................................................EAIHQRE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.V..A.A.IQYQEnamnyplsgg................................sqrgskriphP........VYHSSD..V...S..E.-...-.....AL...DRGE.M.....H....I...T.....N..A.LPISS.VP..A--.....ETAK.S.RQT..-..K.....R..S.K...ENKAv.......gLKAV.KSPRKG..NRVGE....DLN.......KQGASD........................gKKIK.VE.WD....SQD.AH..L....N.L....I.N...........FDE.TT.MTA.PVCSCTGAP....RQC.YKWGSGGWQSACCTTTLSSYPLPQMPNKRRARVGGRKMSGNVFTRLLSRLAAEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A061FDZ3_THECC/1-336               ................................................................................................................................................MDDS..G..HREngrLKtdqy..........................rtaqgQW-L.M.HQP.........--S.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.AER......DN..A.I..A.N.LQYREnslatgnmpscppg.......................cqisrgvkhmqhpqqN........VHHLPH..I...N..E.-...A.....PY...NSRE.M.....H....S...S.....D..T.LPVTP.GT..S--.....ESAK.S.KQG..-..K.....R..G.K...EAKVia.....ssKKAP.KPLKKV..KRENE....DLNk.....iMFGKSHewkggqdag......gggddlnkqlVATK.SD.WK....GQD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHTRIGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1E5UWH8_9POAL/1-371               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMS.P-P.....DR...D.T...KP...............LLPNGSN.F.Lqhhghh..naqqqhqHQH.HPQHSHH.PRGgggggggsssa.........................................pggmpteptavhMDFVRNE.AW...LH.P....SQhhhqhhh................qhqhprqqKVL..H..H.L.P..V.G.PVghvghpghg.................ghavhhhptgY.G.M.MAD......AH..G.V..H.T.LQMMQpqaqpqp.....................................qpqpqpqpQ........PQPTPQ..P...Q..D.-...P.....PV...PKEE.S.....M....P...D.....P..L.IEDHP.VI..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPNP.........KKPK.K-VAAP..KENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A068UIH3_COFCA/1-332               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnsinsgnmspcppg.......................cqitrgvkhmhhpqqH........VHHQPQ..V...N..E.-...P.....PY...GSRD.M.....P....I...S.....D..A.IPISP.GV..L--.....EPAK.S.RRT..-..K.....R..T.K...DPKAvt.....stKKAS.KSSKKV..KREGE....DLNk.....tMFGKSHewkpgqevg......sgtddlnrqlGVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A3B6TI19_WHEAT/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngtgfnpg.....................slngaknfhhqdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A0S3TC91_PHAAN/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.ATNGAFH.HREigms.......................................................hatypMEYVR-D.AW...ISsQ....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....E....-...-.....-..-.VEEEA.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5J5B4K1_9ASTE/1-124               ................................................................................................................................................MDDS..G..HHEngrQKp................................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....EK...D.A...--...............ALQERNL.-.-...............ALS.EKKKALA.ERD................................................................LAIMQRD.SA...IM.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYRE....................................................S........SMNSGN..M...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------spcppgcqisrglkhmhhpaaacttsd..............
A0A2R6XFD8_MARPO/59-363              ................................................................................................................................................MDDE..G..RVG...VR...................................RRM-.I.CDQ.........---.--TA.LK.LVK.AIA.....ER...D.A...--...............AILERNS.-.-...............AIA.EKKAACV.ERD................................................................AALLRCD.LA...FS.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.VER......DA..A.V..A.A.LGAVRagkfatftewtrhgsp....................navtsktlqppvvdssP........--FSVD..F...A..S.A...A.....AC...QWKS.A.....V....G...R.....T..N.ICSEY.IQ..KQS.....MAGN.V.RES..Q..R.....D..L.R...SKRKi.......gKDTK.QGFLSS..RK---....---.......-----Rppeq................klliyQREN.LD.QN....ERGsSV..T....E.E....V.A...........DEN.IC.NSI.PYCSCTGVN....QPC.YKWGNGGWQSACCTTMISMYPLPMNPKKRSSRLAGRKMSAGAFEKLVEKLTLEG.VNV.RC.PIDLKD..HWAKHGTNRYVTLR.........................................
A0A0E0B768_9ORYZ/1-341               ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppspateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKAL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.L...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
B9S7E0_RICCO/1-283                   ...........................................................................................................................................mddpe--DT..L..NMN...IR...................................NWG-.Y.YEP.........NFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLPGRDP.N.G...............IMV.GANGAFH.PRDcvvs.......................................................dapgpMNYMR-D.SW...IS.Q....RE...............................KLF..N..M.L.P..P.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQVLQ....................................................P........------..-...-..-.-...P.....NP...SRDE.R.....A....-...-.....G..R.IEEPS.VH..KES.....SQLK.K.RQS..G..G.....A..P.K...TPKA.........KKPR.K----P..KDNSN....---.......---NAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
V4KBG9_EUTSA/1-281                   ...............................................................................................................................................mMDED..G..-LS...NR...................................NWGY.Y.EPS.........QFR.PNLG.FQ.LIP.SII.....DR...N.E...KP...............FLCPQNP.N.L...............ITP.NNGYRGG.--Sss...........................................................snvMSFPR-D.YT...VS.D....AP...............................-F-..-..-.-.-..-.-.MS....................................Y.S.W.LNQ......HR..D.S..K.F.FSNSP....................................................Nn......pSNHHTF..L...V..P.-...D.....TS...RTQP.-.....M....Q...L.....L..Q.IPKPE.FS..EVD.....ESLK.R.RHF.sG..G.....E..R.A...GPKA.........KKER.K----L..KDSN-....---.......VPRMQ-.........................RERS.PL.RK....SIE.MV..V....N.G....V.S...........MDI.GC.LPV.PVCSCTGMA....QPC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SS.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A1S2Y5R8_CICAR/1-338               ................................................................................................................................................MDDR..E..NAR...HKadqy..........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.Q...--...............AIQERNL.-.-...............ALS.EKKAAXX.XXX................................................................XXXXQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..AtT.LQF-Renalanggmlscppg......................cqisrgvkhihhlpqQ........VNHLPN..M...G..D.-...S.....SY...GTRE.L.....H....T...T.....N..A.LPEAP.IP..A--.....EVGK.P.TRR..A..K.....R..P.K...ESKSvs.....pnKKTP.KTTRKV..KKESE....DLNk.....tMFANNKtlewkssqdi....mnggddlnkqiAVSK.AD.WK....PQD.LA..L....N.Q....V.A...........YDD.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSVYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1Q3BQ07_CEPFO/1-337               ................................................................................................................................................MDDA..G..HREngrHKpdqy..........................ktaqaQW--.F.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.S.LQYREnslasgnmtscppg.......................cqisrgvkhmhhppqH........AHHVSH..M...N..E.-...A.....PY...TTRE.M.....H....T...S.....D..A.LAVSS.VS..S--.....EAAK.P.RRG..-..K.....R..T.K...EPKVms.....psKKAS.KPPRKI..KQESE....DLNq.....mMFGKSHewkggqdmg......sgggdqnkqlVASK.TD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPA.PMCSCTGIF....RQC.YKWGNGGWQSSCCTTTVSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A6A4PIQ5_LUPAL/1-305               ....................................................................................................................................mdggrqhqdcrh----..-..---...-Kveyr..........................ggvhsPWNM.D.VQHlre...vkePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.EKIEALA.ARD................................................................LAFRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MEC......DI..A.L..A.A.LQNRNnaan............................................fpagG........VQCGSK..R...M..H.Q...A.....SY...STKD.K.....P....V...R.....D..T.TPVTV.IT..A--.....DAVK.S.HKA..-..K.....K..L.K...ENKV.........INSK.A-SKSP..TKLGE....DLN......rHASSQG.........................TKIK.SE.WD....KLD.VG..L....N.L....V.A...........FDE.TI.MPA.PVCTCTGVP....RQC.YKWGSGGWQSSCCTTALSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEG.HDL.SV.PLDLKS..YWARHGTNRYITIK.........................................
A0A0P0VV53_ORYSJ/1-34                ...............................................................................................................................................s----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.--------P....QQW.YRWGAGGWQFACCTTSISTYPLPMTH----------------------------.---.--.------..--------------tev......................................
A0A2R6Q264_ACTCC/1-299               ..........................................................................................................................................ehnsti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.S...--...............AIREKNM.-.-...............ALD.ERRRAFA.ERD................................................................MAMLQRD.AA...IA.E....RNsav........................eerdKAL..A..A.L.Q..F.Q.ESsmnenh........................ispdspG.N.V.MAR......--..G.A..K.S.LYYHQ....................................................Q........MHPIPQ..Q...V..E.-...T.....GY...DPRE.I.....P....T...S.....N..P.FQSTG.VA..YET....eKLPR.K.AKQ..A..E.....Q..T.K...GSST.........KKPS.KSPRKG..KRVSD....DISh.....gW-KSEQdldd................needlDEEL.GL.WK....DDD.LG..L....N.Q....I.N...........FDE.ST.MPA.PVCSCTGLP....QPC.YKWGNGGWQSACCTTAMSVYPLPQMSDKRYARVGGRKMSGSAFAKLFHRLTAEG.HDL.SA.PLDLKD..HWSKHGTNRYSTA-k........................................
A0A445JV22_GLYSO/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGCNA.A.V...............-LS.GTNGAFH.HRDiggmp......................................................qatypMEYMR-D.AW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................P........------..-...-..-.-...L.....EL...PKEE.R.....P....-...-.....-..-.VEEAP.VV..EKSn...gGTRK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RGPRAP..KDEN-....---.......APS--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SR.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTI-s........................................
A0A5D2WGI1_GOSMU/1-168               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCRE....................................................N........AKNFPF..G...S..G.-...-.....-I...QRGR.T.....C....K...S.....C..P.VKRTK.VN..KAV.....SSKS.P.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------rkikkvaedlnrqvdtefapaqefpdi..............
A2Y8V8_ORYSI/1-274                   ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LESIP....................................................Y........LNSSRS..A...G..K.-...A.....KR...PKKN.S.....S....-...-.....-..-.-QA--.--..---.....SPLK.-.RPS..G..-.....-..-.V...LRKT.........KKPS.GDWKNV..GMSGC...gDD-.......--SAHA.........................SVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDD.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A2I4DVH4_JUGRE/18-353              ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqgQW-L.M.-QH.........QPS.M---.KQ.IMG.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.F.LER......DN..A.I..A.T.LQYREnsltsgnmscppgc........................qisrgvkhihhpqqH........THHLPH..M...G..E.-...A.....SY...NTRE.M.....H....T...T.....D..A.LAISQ.VA..S--.....EAAK.S.RRA..-..K.....R..T.K...ETKGmp.....sdKKAS.KSPKKI..KRESD....DLNk.....iMFGKTHewkggqdmg......gggddlnrqsGGSK.SD.WK....GPD.LG..L....N.Q....V.A...........FDD.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHTRVGGRKMSGSAFAKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A8D197_POPTR/1-279                   ................................................................................................................................................MDDD..A..-LN...MH...................................NWG-.Y.YEP.........SYK.EPFG.LQ.WMP.SMV.....DR...D.T...KH...............FLPRRDP.I.N...............IMI.GANGAYL.PHDcvvs.......................................................dapehMNYMR-D.SW...IN.-....RE...............................KFL..N..I.L.P..P.N.PN....................................Y.V.V.PQQ......TS..G.A..H.S.MQMLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.R.....L....-...-.....S..R.IEEPS.VS..NEG.....NQLK.R.RQV..G..G....tS..P.K...TPKA.........KKPR.K----P..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PTCSCTGTP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A2R6R5R7_ACTCC/1-287               ..........................................................................................................................................ehnlti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALD.ERRRAFA.ERD................................................................MVMLQRD.AA...IA.E....RNtai........................eerdRVL..A..A.L.Q..F.R.--....................................-.-.-.---......--..-.-..-.-.----Essvnenymsph..............................spkdeivrkgkH........LHHQYQ..V...H..S.T...PhlaetTY...DPSE.I.....P....S...S.....S..P.FQSTG.VA..S--.....NTAK.P.QKV..-..K.....Q..P.K...EIKGt.......sTKKS.KSPRKG..KRGKE...qDL-.......GGDDED.........................PDGP.FV.VL....TDS.LG..L....N.Q....V.I...........FDE.ST.MPV.PICSCTGAP....QPC.YKWGNGGWQSACCTTTISVYPLPQMSNKRHARVGGRKMSGGAFAKLLNRLAAEG.HDP.YT.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A287PDI9_HORVV/1-252               .............................................................................................................................................hqh----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............--Q.HQHQHQH.QHQ................................................................HQLQHQH.QH...QH.S....RE..............................lKVL..N..A.V.P..V.G.PAphighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PDEE.K.....I....T...P.....P..L.VEDHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...VPKP.........KKPK.K-DATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A068U164_COFCA/5-323               ................................................................................................................................knyeyfhfrngllvsp----..-..---...--...................................AWLV.M.-DH........nHFS.I---.KT.YMA.ITA.....ER...D.A...--...............AIQERNM.-.-...............ALE.ERKRAFS.ERD................................................................MAMLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.QER......DE..A.I..A.A.LQI-Rdcsvnnmlsds.............................aedgvadgtedmH........YQHMHH..A...M..V.N...A.....AF...SPRD.I.....L....T...S.....E..T.FNSAQ.VA..S--.....ETAK.A.TKV..-..R.....Q..P.K...EGKM.........TKSV.KSPRSP..KRRAE...gMIKp.....lTPA--Ssngwnagh.........dlkreeelEGHL.GT.WK....D-N.IG..L....N.Q....I.N...........FDE.TA.MPV.PVCSCTGTP....QPC.YKWGNGGWQSACCTTTMSVYPLPQVSNKRYTRVGGRKMSGSAFNKLLNRLVAEG.HDLySA.PLDLKE..HWAKHGTNRYSTLK.........................................
A0A0D9VRN8_9ORYZ/1-231               ................................................................................................................................................MDDD..A..SLS...FR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMS.SVP....aDQ...D.T...KP...............LLQNGTF.L.Q...............HHT.HHNAPHH.PRDcgggasgg...............................................lpteppavhIDFARND.AW...MH.P....SQ...............................-HQ..H..P.H.P..S.Q.HQhlreqkvhappvrvgpaghighpglgghavhhhptgY.G.M.LPE......AH..G.L..H.T.LQMMQ....................................................P........-----Q..E...P..P.P...-.....--...LKEE.H.....I....S...E.....P..L.IEENS.VV..RSE.....LPTK.K.RKQ..-..R.....Q..P.K...TPRP.........KKPK.K-PPAP..REDG-....---.......APNGHA.........................PRRR.GP.KK....ALG.MV..I....N.G....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------.........................................
A0A0D2M2M1_GOSRA/1-310               ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A1B6QAK9_SORBI/128-245             .............................................................................................................................................psl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................--ER.GS.KK....TVG.MV..I....N.G....I.E...........LDL.AN.IPT.LVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARISGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHRTNKFVTIR.........................................
A0A445J846_GLYSO/1-317               ................................................................................................................................................MDDG..H..QHEnsrHKmefy..........................rgarsLWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILEIEL.E.T...............AIS.EKNEALA.ARD................................................................AAIQQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQSRNnsvnfpfggg................................iqcgskrmhhS........SNHLSN..M...T..E.-...A.....AY...STKD.M.....I....I...R.....D..A.SPVTV.IP..S--.....EAVN.S.HQA..-..K.....R..T.K...QNKVi.......nSKAS.KPPCKV..KKMGE....DLN......rQASSEG.........................TKIR.SE.WD....KQD.VG..L....N.L....V.A...........FDE.TI.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A0J8B270_BETVU/1-290               ...............................................................................................................................................m-DVG..G..HRGgarHKcdni...........................rescPWNM.VaYQHqa.....keQNA.LHMN.RK.LLN.IIA.....ER...D.D...--...............AIEEMNR.-.-...............ALH.EKRRALE.ERE................................................................TAISQRN.LA...IK.E....RD...............................---..-..-.-.-..-.-.--....................................D.A.V.MER......DN..V.L..N.A.LQNSM....................................................KqqplscgvQHGTNR..L...A..D.-...Q.....SY...VTHE.M.....H....F...L.....D..A.FCRTA.VA..S--.....----.-.---..-..G.....C..N.K...SPQP.........KKMK.ESKGCA..SKSRR....E--.......KQTSDH.........................LKVR.NN.LY....GES.LG..L....N.R....V.D...........YDD.SI.MPA.PGCSCTGIF....RQC.YKWGTGGWQSSCCTTTISVYPLPPAPNKRYARLGGRKMSGSVFSKLLSRLALEG.FDF.SI.PVDMKD..HWSKHGTNRYITIK.........................................
A0A2U1L8C2_ARTAN/1-308               ................................................................................................................................................MDDN..G..HHRe.nGRqkq.............................pqgQW-L.M.-QH.........QPS.M---.KQ.IMT.IMA.....ER...D.A...--...............AIQERNL.-.-...............AMS.EKKTALA.ERD................................................................IALLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnnsmsnsnn.................................ntssscppgcQ........ISRNVK..H...V..-.-...-.....HH...PQQY.L.....Q....E...D.....A..N.LTVSP.PA..P--.....EQAK.S.RKT..-..K.....R..P.K...ETKAit.....ttKKTS.R-SRKV..KLECD....DLNk.....vLYDDTHdwd..................sgdgGSNK.QE.WK....DQD.LG..L....N.Q....V.T...........YDD.TT.MPI.PVCSCTGVF....RPC.YKWGNGGWQSSCCTTTLSVYPLPSLPNKRHARVGGRKMSGSVFNKLINRLSGEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A5B6USA8_9ROSI/104-303             ......................................................................................................kpgfsslqrtgihhepglvvspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---PSI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
F2EFE4_HORVV/1-331                   ................................................................................................................................................MDNV..G..HREdgrQRqdsy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.N...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfnpg.....................slngaknfhhhdqqphA........QSLPLQ..L...A..D.A...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..V-S.....AAGK.A.KKP..K..K.....N..S.S...QGSP........lKRPS.GVLRKT..KKAAG...dWRDv.....gISG--Ggedp.................ahvaSVMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSLYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A2H3Z0M0_PHODC/1-272               ................................................................................................................................................MDDD..G..GLG...MR...................................NWA-.Y.YEQ.........PLK.GNLG.LQ.LMS.SVA.....DR...TaT...KP...............LLSNGGF.-.F...............-HR.DCSMPEP.PAP................................................................IEYVR-D.GW...IG.H....RE..............................nKMI..H..M.M.P..A.N.PS....................................Y.S.V.LPD......AH..G.A..H.A.LPMLQ....................................................P........------..-...P..E.-...-.....PL...KDDK.M.....I....-...-.....P..M.MDDPG.SR..K-E.....APLK.K.RAH..-..-.....-..A.K...ASKP.........KKPK.K-VAAP..RNETS....---.......--NGSL.........................PRGR.NV.RK....SMD.VV..I....N.G....I.D...........LDI.SG.IPT.PVCSCTGTP....QQC.YRWGVGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKT..YWAKHGTNKFVTIR.........................................
V4LNN2_EUTSA/1-346                   ................................................................................................................................................MDDG..G..HREngrHKaa...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmataaaavanmgacppgc............qisrgvkhmhhphmhhhqqqH........QHHMPQ..L...S..E.-...N.....AY...ETRE.M.....E....T...N.....D..G.LPTSP.PT..GSA....lESAK.P.KRG..-..K.....R..V.K...DPKAttk..tagnKRGP.KNQRKV..KKESE...dDLTk.....iMFVKTShdygee............easkhvlIGSK.SD.WK....NQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0K9NSA6_ZOSMR/1-347               ................................................................................................................................................MDDS..A..HREngrHKseyy..........................kglhgQW-V.M.PQH.........Q--.----.MK.LMS.IIV.....ER...D.N...--...............AVQERNV.-.-...............AMS.EKKAALA.ERD................................................................LAFLQRD.TA...IT.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DS..A.I..A.A.LQYARenlnvnndghvcqsgcs..................apkyttnhhhnhasshlN........SSLPPQ..L...S..D.V...P....yNN...TPRE.M.....H....I...T.....N..A.YPISS.IP..D--.....NGMK.P.KRC..G..R....pR..K.D...VNKSqs....vpsKKPK.RTPTSTmkKKKGE....DLNk....qvTI---Akspwrgqqvl....fsnsedqnkmvLSAE.HE.WR....VLD.LG..L....N.Q....V.T...........FDE.TT.MAV.PGCSCTGSL....KQC.YKWGNGGWQSACCTTTLSQHPLPVIPNRRHARVGGRKMSGSVFTKLLSRLAQEG.HDL.ST.PLDLKD..HWAKHGTNRYITIK.........................................
A0A078JDV9_BRANA/16-270              .....................................fhsndsrkikkklfregailplkqaiemdpylsrnhmkpatstskdtglptsnplwfhsyfpvprttgidlsqppqaepaelavvpqvhlfppptrgyihdvelkss----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.-TM..L..S.....P..S.K...ALKP.........KPQS.KKRSAP..KTPKK....TL-.......----SI.........................PEIK.RE.KK....NPD.IN..V....V.D....IsS...........FDV.SG.VPP.PVCSCTGVP....KVC.YKWGMGGWQSSCCTISISTFPLPMSTTRPGTRLAGRKMSNGAYVKLLMRHAGEG.YDL.TC.PVDLRN..HWARHGTNKFVTIK.........................................
A0A453IK27_AEGTS/22-154              ..................................................................................................................................catrpgctprsisi----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......----ST.........................TRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A251RRH8_HELAN/1-308               ................................................................................................................................................MDDA..G..HREngrHRidyy..........................kgvhpQWNM.M.PQYqm.....kdQNA.MMMN.RK.IMH.IVS.....ER...D.T...--...............AIEERDR.-.-...............ALL.EKKAALE.ERD................................................................MAIQQRD.TA...IA.D....RN...............................DAI..R..E.R.D..N.A.IA....................................A.L.R.FQE......TT..M.N..S.H.LQRKR....................................................-........GHHNHH..H...H..T.Q...P.....SY...MM-D.P.....H....V...T.....E..A.LPITA.VP..G-E.....PVHK.S.KIT..-..K.....E..I.K...P-RGgsg..ggggG-SS.SRSKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.FG.lM....D.Q....I.S...........FDE.ST.MPI.PICSCTGVA....RQC.YKWGSGGWQSSCCTTTLSVYPLPQMPNKRHSRMGGRKMSGTVFTRLISRLASQG.HDL.SA.PVDLKN..YWAKHGTNRYITIK.........................................
A0A5A7PA49_STRAF/32-122              ...................................................................................................................................herdeairlhhss----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..N.TE-AT.VV..DES.....PKPQ.Q.HRR..G..K.....R..A.K...RASS.........KRSN.SAASVC..NNWEE....DEQ.......GFG---.........................SDGS.ES.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PV-------....---.------------------------------------------------------.---.--.------..--------------qql......................................
A0A4V4HA68_MUSBA/1-305               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.-MA.....ER...E.K...--...............AFQERDI.-.-...............AIS.EKKAALA.ERD................................................................TAYLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DD..A.I..A.A.LEYARencmsnncapgcspa.....................pcgtknmynyqqqhlqH.......iQAAPQQ..L...H..D.A...P.....SN...QTRE.T.....P....R...S.....E..A.FPNSG.GP..ETL....gKLIK.T.KRS..R..K.....K..T.E...VEASs.......sKKMT.KFPRKG..KKGGG...nDWD......kQ-V--Tiaraagawrge...vgvgedlnkvsSLKH.HE.WK....SQD.LG..L....N.Q....V.T...........FDD.SS.MPA.PVCSCTGRY....QQC.YKWGNGGWQSACCTMTLSMYPLPVLPNKRHARVAGRKMSGSAFRKLLSRLAAEG.HDL.SL.PVDLKD..HWAKHGTNRYITIK.........................................
A0A445JV61_GLYSO/19-300              ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SLP.....E-...-.-...KP...............LIGGRNA.-.V...............VLA.GTDGAFH.HRDiggmp......................................................qatypIEYMR-D.TW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VV..KKA....nGTRK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RVPRAP..KDEN-....---.......APA--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SR.IPI.PVCSCTGAT....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A1U7XIZ5_NICSY/1-301               .......................................................................................................................................mmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................AAI..Q..E.R.D..D.A.IAalrlg.........................essindN.N.V.VPD......SP..G.N..D.T.ETGAK....................................................H........IYNQQQ..M...H..K.T...I.....AE...AAHG.S.....T....E...D.....P..T.AGYLK.GT..DTS.....EAKN.P.K-K..V..R.....R..P.K...ESRH.........NKQA.KIPRQG..KIGAE....SLN.......MQVISTssddwvnl........qeldsdkegDMQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQG.YDL.SV.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A2G3CQW4_CAPCH/1-324               ................................................................................................................................................MDES..G..NRDnsrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssmsggqivr................................gvkhmqhpqqH........VHHQQH..M...V..E.-...P.....TY...NPRD.V.....H....I...N.....E..A.IPVSP.PA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAap.....cpKKAP.KASKKV..KRETE....DLNq.....tTFSKSQewkgaqemag.....gasddlnrqlAVPK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
A0A2P5DBV2_PARAD/1-337               ................................................................................................................................................MDDG..G..HCEngrHKgdqy..........................kttqgQW--.M.MQH.........QPS.M---.KQ.IMG.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.I..A.T.LQYREnslsngnmsacppg.......................cqisrgvkhmhhpqpH........VHHLQH..M...N..E.-...A.....SY...SSRE.M.....N....T...S.....D..S.LPMPA.EA..P--.....DTAK.S.RRG..-..K.....R..A.K...EPKPis.....pnKRAS.KPPRKI..KRESE....DLNk.....iAFGKSQewksgqsmv......gggddlnkqsVVSK.SD.WK....GQD.LG..L....N.Q....V.T...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTMSMYPLPSVPNKRHARVGGRKMSGSAFNKLLNRLAADG.HDL.SN.PVDLKD..NWAKHGTNRYITIR.........................................
A0A2I4DVH5_JUGRE/1-336               ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqgQW-L.M.-QH.........QPS.M---.KQ.IMG.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.F.LER......DN..A.I..A.T.LQYREnsltsgnmscppgc........................qisrgvkhihhpqqH........THHLPH..M...G..E.-...A.....SY...NTRE.M.....H....T...T.....D..A.LAISQ.VA..S--.....EAAK.S.RRA..-..K.....R..T.K...ETKGmp.....sdKKAS.KSPKKI..KRESD....DLNk.....iMFGKTHewkggqdmg......gggddlnrqsGGSK.SD.WK....GPD.LG..L....N.Q....V.A...........FDD.ST.MPA.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHTRVGGRKMSGSAFAKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A444EGE8_ENSVE/1-280               ................................................................................................................................................MDDD..G..GLG...IR...................................NWG-.Y.YEP.........PSK.GNLG.LR.LMS.SVV.....ER...N.A...KP...............LLSNGGF.-.I...............-HR.HCSFPEP.SVS................................................................MDFMR-D.GW...TQ.Q....GNd............................ssKSF..H..T.F.P..V.S.HQhh................................psY.G.V.LPD......PP..T.V..H.N.IQMLQ....................................................-........------..H...P..D.-...-.....PQ...PKDD.K.....V....-...-.....-..L.MPEDT.TG..KNE.....PPLK.K.RPR..G..C.....L..Q.K...SSKP.........KRPK.K-VTAP..SDEV-....---.......-PNGSV.........................SRGK.AA.RK....STG.MI..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGKP....QPC.YRWGVGGWQSACCTTNMSMHPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKFVTIR.........................................
A0A2P5E133_PARAD/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FLPGRDP.T.T...............VMV.SANGAFH.PRDcvvs.......................................................dapvsMNYVR-D.GW...VN.Q....RD...............................KFL..N..M.L.P..A.T.PN....................................Y.S.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........------..-...-..-.-...P.....DT...QRDE.R.....V....-...-.....G..R.VEEPV.VN..KES.....GPSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----P..KENNN....S--.......----AV.........................PRLK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A4S4ER25_CAMSI/12-232              .............................................................................................sepnteasiphfswahsgnffsatkigsnpfqasqmdpkpgiaavpicsva----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-PMSE.PA..ENT....tNPTK.V.KKK..K..S.....T..A.K...SPNQfa....sdvLRPK.QPKKKP..SGSK-....--K.......SKKQFE.........................PGTK.VE.RK....NLN.VV..F....N.E....A.D...........LDF.SG.VPS.PYCSCTGVA....RGC.YKNGAGGWQSSCCTTNISEYPLPMSCMKPGARVAGRKMSSGAYGKLLCRLAAEG.RDL.SH.PLDLKD..HWARLGTNKFVTIK.........................................
A0A6D2IT74_9BRAS/1-291               ...............................................................................................................................................m-ENG..G..QYEngrYKpdyf..........................kgaqsVWNM.L.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVQERNQ.-.-...............AVS.AKKEAIA.ARD................................................................EALQQRD.KA...LT.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.F..A.A.LQHHE....................................................Nsln..falSGGKRY..E...G..D.A...D.....GF...NIGE.T.....H....K...L.....A..A.FPIST.IP..PEV.....KGTS.K.---..-..-.....-..-.-...----.........-RKK.QGQGKG..KKVGE....DLNr.....gVAA-PG.........................KKSR.KD.WD....SSD.VS..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGSA....HQC.YKWGSGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGSVFSRLLSRLAVEG.FDL.SC.PVDLKD..YWARHGTNRYITIK.........................................
A0A287PD37_HORVV/1-291               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVTg...gHR...D.T...KP...............LLPNGTF.L.Qh............htPPH.HPPHSHH.PRDygngepsgg..............................................mpaeppaihMDFVRNE.AW...MH.P....SQhqhqhqhqhqhqhqhqhqlqhqhqhqhsrelKVL..N..A.V.P..V.G.PAphighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PDEE.K.....I....T...P.....P..L.VEDHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...VPKP.........KKPK.K-DATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTY----------------------------------.---.--.------..--------------.........................................
A0A2P5FQ73_TREOI/1-312               ................................................................................................................................................MDEG..Q..HET...SRhkvdy........................yrgthsPWNM.M.AQHqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNV.-.-...............ALS.EKNEALA.QRD................................................................EAFRQRD.EA...FA.Q....KD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.L..A.A.LQIRNgsmniplsdg................................vqrgvkrmnhP........SNNLPN..M...A..E.-...A.....TY...DSKE.M.....Q....I...T.....D..A.FPITV.IS..S--.....EAIK.S.RQA..-..K.....R..P.K...ENKGi.......sSKES.KPPR--..KKVAE....DLNr.....rATSDG-.........................TKFR.TE.WE....SQD.LG..L....N.V....I.T...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGSGGWQSSCCTTHMSVYPLPQIPNKRHARMGGRKMSGSVFTRLLSRLAAQG.HDL.SM.PLDLRE..YWARHGTNRYITIK.........................................
A0A1S3CS99_CUCME/38-314              ...............................................................................................................................................m-DGD..-..ALN...MR...................................NWG-.Y.YEP.........SLK.AHLG.LQ.LVS.TIG.....ER...D.V...KH...............FMPGRDP.-.S...............AIV.NMNAAFH.PRDsvvs.......................................................eapvsTNWAR-D.GW...MN.Q....RD...............................KLF..N..V.L.S..P.N.TS....................................Y.S.L.LAE......TS..A.A..Q.P.LQMLQ....................................................P........------..-...-..-.-...L.....DT...SRDE.M.....V....-...-.....L..K.IEEPP.VK..KGT.....KQPK.K.RQN..G..G.....A..P.K...SPKP.........KKPR.K----P..KSNDP....---.......----SF.........................QQVK.AP.KK....KME.LV..I....N.G....F.D...........MDI.SS.IPI.PVCSCTGTP....HQC.YRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A2T7CF75_9POAL/1-361               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YET.........-VK.GNLG.LQ.LMS.SVP....pDR...D.T...KP...............LLPNGGN.F.Lqhhghh..naqhqhqH--.-------.--Qqhpqhshhprggggggg..............................gssgapggmpteppavhMDFVRNE.AW...LH.P....SQhhhqh....................qhsrqqKVL..H..H.L.P..V.G.PVghvghpghg.................ghavhhhpsgY.G.M.MAD......AH..G.V..H.T.LHMMQ....................................................Pqaq..pqpQPQPPQ..Q...P..Q.D...P.....PP...TKEE.S.....M....P...Q.....P..P.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A022PVV9_ERYGU/1-321               ............................................................................................................................................mdhn----..-..---...--...................................----.-.---.........---.HHLG.IKtFMA.ITA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...IA.E....RNsaiqerde..............aiaslrfreS--..-..-.-.P..M.N.HNstnt............................nipdS.L.V.SEL......SS..G.A..R.R.IQY-Qdqirav.......................................sepaaynN........--NNNN..N...N..N.S...N.....NS...QRGS.L.....R....G...S.....SdvS.ITEEE.AS..ETA.....ANNK.P.RRG..-..R.....Q..A.K...DRKA.........NKSQ.RVGKRM..AEEL-....--Sk....qiITN--Dwsnnnnnsn.......ehdfesdeeDKQQ.VS.WK....D-N.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCTCTGAP....QPC.YRWGNGGWQSACCTTAISMYPLPQVANKRYSRVGGRKMSGSAFSKLLNRLASEG.YDF.SA.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A4D8XS11_SALSN/1-312               ................................................................................................................................................MDGN..G..NMN...LR...................................SWA-.F.LEPp......asNWK.NHLG.LQ.LIP.SIT.....E-...-.-...KPlfgggcg.dgfrehqN------.-.Lhp..........spvMSS.INGGPFH.HHRvg...........................................................gisESHIPVE.YW...MN.Q....NK...............................EYL..N..M.Y.S..G.N.HQsay.............................yqssY.G.V.SPE......TS..S.A..Q.S.VQM--....................................................P........QQFNLQ..K...T..E.-...N.....VM...SKME.E.....V....C...E.....E..K.DDGGG.SS..GSA.....MVVK.K.RGG..S..K.....V..TgS...TLKE.........KKPRtRTPRAP..KDEHE....RT-.......---PSS.........................NRAR.TP.KK....RAE.IV..I....N.G....I.N...........MDV.SE.IPI.PICSCTGAP....QQC.YRWGSGGWQSACCTTHMSEYPLPLSEKRRGARIAGRKMSIGAFKKVLEKLTSEG.YNF.SN.PIDLRS..HWAKHGV-------pylvsl...................................
A0A4D8YID8_SALSN/1-302               ................................................................................................................................................MDDS..R..HPEngrHKap..............................qqgQW-L.M.-QH.........HPS.M---.KQ.IMA.IMT.....ER...D.A...--...............AIQEKNL.-.-...............AIS.EKKAAVA.ERD................................................................MAIMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.I..A.T.LQYREndinnngnispcppg.....................cqiprgvkhmhhpqhqH........VHHQAH..M...V..E.-...A.....PY...TSRE.I.....Q....I...P.....D..A.VPVSP.EP..A--.....KPSR.T.KRA..K..E.....A..K.Q...AAPA.........RKAP.KPTKKI..KQEED....DL-.......------.........................--TK.SE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGVL....RPC.YKWGNGGWQSPCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLGRLAAEG.IDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A2J6KCK3_LACSA/11-189              ................................................................................................................fsqfpcfsssnhsqvtyteavpircvapisvt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....---E.P.HTN..K..K.....N..K.L...SPKN.........KT--.KSCSIS..KKS--....---.......-KKKTI.........................LKPN.VE.RK....NLD.AS..F....D.D....S.K...........IDF.SK.VPP.PICSCTGVP....RQC.HKCGVNGWQSSCCNSKISVFPLPMSPWRPGARVGGRKMSHGAYRKLLCKLASEG.QDL.SH.PVDLKP..HWAKHGTNNFVTIK.........................................
A0A3N6S0L1_BRACR/1-277               ................................................................................................................................................MDED..G..-LS...NR...................................NWGY.Y.DQS.........QFR.PSLG.FQ.LIP.SIV.....DR...N.E...KQ...............FLCPQNP.N.F...............--I.TTNNSYC.GGGsss..........................................................snvMSFPR-D.YT...AS.D....AP...............................---..-..-.-.-..-.F.MS....................................Y.S.W.LNQ......HR..D.S..K.F.FNNLP....................................................N........PSNHHT..L...L..D.P...-.....RA...QPMQ.L.....L....-...-.....-..Q.IPKAE.AG..EVY.....ESLK.R.RQC..G..G....gQ..R.A...DPKA.........KKER.K----L..KDNI-....---.......-VPRM-.........................QRER.SPlRK....SIE.MV..I....N.G....V.T...........IDI.GC.LPV.PVCSCTGLS....QQC.YRWGCGGWQSSCCTTNVSMYPLPMNTKKRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SN.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A2H3YSX0_PHODC/92-445              ................................................................................................................................................MDNS..G..QREngrHKtdqy..........................kqvhtQW-M.M.PQY.........QLK.ENQT.IK.FMA.IMS.....ER...D.N...--...............AIQEHNI.-.-...............ALA.EKKAALA.ERD................................................................VAILQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARengmntngatacppgcaa...............prgskhihhhqqqhlqhihP........SPPQLS..D...A..PyN...H.....YN...HARE.M.....H....I...T.....E..A.FPIST.AS..E--.....SAAK.G.RMV..K..R.....P..R.K...ETKVqn....spyKKSS.KTPRKS..RKGGG...eDLNr....qvT--I-Akpasdwrgev....gggddlnervsLTKH.QE.WK....GQD.LG..L....N.Q....V.T...........FEE.AT.MPT.PVCSCTGKY....QQC.YKWENGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEG.HDL.SQ.SVDLKD..HWAKHGTNRYITIK.........................................
A0A0D2RM42_GOSRA/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPGRDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appirMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPE......TS..A.T..H.S.MPIWQ....................................................P........------..-...P..P.P...P.....DA...STRD.E.....S....V...I.....G..R.VEEPP.AS..KEG.....VQSK.K.RQV..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IT..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
K3XYG4_SETIT/1-304                   ............................................................................................................................................mmpq----..-..---...--...................................----.-.---.........-LK.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqvp....................plngtknihnhdqlshV........QTSPLQ..L...A..D.S...P.....YD...HTRE.M.....H....I...S.....E..A.YPIAT.AP..SSI.....GKGK.K.PRK..-..-.....N..S.S...QASP........lKRPS.GVLRKT..KKVAG...dWKNg.....gMSGGGEds....................araSVMK.NE.WK....DQD.LG..L....N.Q....V.P...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A2I0ACJ6_9ASPA/1-279               ................................................................................................................................................MDGK..G..RLN...TR...................................NWEF.M.DHR.........LSE.SMLK.PT.LGV.SIP.....EN...N.V...--...............-SGYQAS.F.Lk............igAYS.DRSTVIG.EHH...............................................................sEASSMNF.SW...VP.Q....RN...............................---..-..-.-.-..-.-.--....................................-.-.F.LQP......AK..A.I..N.H.LHATS....................................................A.......pLSSEMI..N...V..P.S...I.....PI...STEN.A.....V....Q...N.....G..P.IDAKP.IK..SRK.....QSSS.A.KKA..N..R....iA..T.K...VLRP.........KEPK.KPPSGA..TRKK-....---.......-VG-ST.........................SMGK.RE.KK....SQE.NS..F....D.G....I.M...........IDF.SG.VPV.PVCSCTGVP....RQC.YRWGTGGWQSSCCTTNISEYPLPMSLSRPGARLAGRKMSIGAYGKLLQRLAVEG.HDL.SY.AVDLKN..HWARHGTNKFVTIK.........................................
A0A2I0BCX1_9ASPA/1-300               ................................................................................................................................................MDDE..S..TPG...IQ...................................NWGG.Y.FRP........pPLK.GNLG.LQ.LMP.TVG.....EC...D.T...KP...............FFSGSGG.A.Vgr..........gyfH--.-RECSVA.EPSn.............................................................iqMDFSR-E.FW...YH.N....NRd............................aaKML..H..V.F.Q..G.N.HHqhs..............................hgyG.G.L.LPE......PS..A.V..S.A.AEAGT....................................................-........SAHAFQ..M...V..Q.Q...V.....EA...PREE.K.....E....-...-.....P..V.VEEID.AS..KQE....tMPSR.K.RSK..G..P.....S..K.A...SKKP.........KKMK.K-ASTP..RDEST....---.......---RPS.........................GRAR.SE.KK....SME.MV..I....N.G....I.D...........FDF.SG.MPA.PVCTCTGQP....QQC.YRWGVGGWQSACCTTSISVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.QDF.SS.PIDLKP..FWSKHGTNKFVTIR.........................................
A0A251L259_MANES/1-315               ................................................................................................................................................MDDG..G..QHQsgrYKidyy..........................kvansAWSL.M.PPPhl....keqNNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIQERNM.-.-...............ALA.EKKEALD.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREndvnfamnne................................sqrglkriphP........VYKSNA..V...V..-.-...E.....AL...NSGE.T.....H....I...T.....D..T.FPIAN.VS..A--.....ESLK.L.RQT..-..K.....R..S.K...ENKPa.......sSKAS.KAPRKG..NKVAE....DLN.......REGASD........................gKKFK.VE.WD....SQD.AG..L....N.L....V.N...........FDE.TT.IPV.PVCSCTGAP....HQC.YKWGNGGWQSSCCTTTMSSYPLPQMPNKRHARIGGRKMSGSVFRKLLGRLAAEG.HDL.ST.PLDLKE..YWARHGTNRYITIK.........................................
M4DJK8_BRARP/1-273                   ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.S-A.....DR...N.T...KP...............FLPGRDP.N.L...............M-I.GQNGSYH.HAE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.V.LPE......TS..S.A..P.S.MHHHH....................................................-........-HHQTE..E...N..P.-...-.....VK...CE--.-.....-....-...-.....-..-.-EEEE.IV..Q--.....-PNK.K.RKT..-..-.....N..S.K...ASAT.........AKGK.K-PRKP..KEEND....SKT.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGSWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
A0A0E0IP29_ORYNI/484-825             ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQQHVP.HHHhqphhprdcgangnan...............................ggamppppateappsmpMNFVRSD.MW...MH.P....QQqqqhh.....................hprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
B9HVQ7_POPTR/1-279                   ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SYK.EPLG.LQ.LMP.AMV.....DR...D.S...KH...............LLPRRDP.N.N...............IMV.GATGAYL.PREslvs.......................................................dasmhMNYMR-D.SW...IN.-....RE...............................KFL..N..M.L.P..P.N.PS....................................Y.V.V.HPE......TS..G.A..Q.S.MPMLQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....S..R.MEEPS.VS..KEG.....SQLK.K.RQV..G..G....tA..P.K...TPKP.........KKPR.K----P..KDGNN....N--.......----TV.........................QRAK.PA.KK....SVD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGIP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
V4UBU4_9ROSI/1-311                   ................................................................................................................................................MDDG..H..HEN...GRykmey........................ykgthaQWNM.M.PQHqm....kepNNA.LVMN.KK.IMA.ILA.....ER...D.A...--...............AIRERNI.-.-...............ALT.EKREALE.TRD................................................................QALEERD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................D.A.L.MAR......DS..A.L..A.A.LQYREaaanfssv...................................ggfqrggkrM........HHPAYQ..S...G..D.V...P....eAL...NSGD.M.....H....A...T.....D..A.KPITI.IP..S--.....-ETK.P.HQA..-..K.....R..A.K...ENKT........vTKPS.VSPRKV..KKVGE....DLN......kKVASDG.........................KKIK.SE.WD....SQD.-G..L....N.L....V.N...........FDE.TT.MPV.PVCTCTGTP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.HDL.SV.PLDLKN..FWAKHGTNRYITIK.........................................
A0A2I0B4R7_9ASPA/1-289               ................................................................................................................................................MDAD..G..KMG...SE...................................HWGG.F.CRP........aPLR.GNLG.LQ.LMS.DVV.....ER...G.S...KP...............FFFGGRG.E.C...............FFQ.RECGMPE.PSSm..............................................................pIDFVR-D.FW...YH.N....SRd............................sgRML..Y..G.F.H..G.S.HHhh...............................lnnY.G.A.ILS......GT..C.A..N.T.LQMLQ....................................................S........------..-...V..D.S...P.....RE...ENAA.V.....L....E...D.....P..V.TPQND.AL..P--.....-LKKmS.QAQ..S..R.....S..V.K...ASKQ.........KRNR.K-AAAV..SEES-....---.......APPL--.........................GRRK.SV.KK....SVG.MV..I....N.G....I.D...........LDL.SE.MPS.PVCTCTGNP....HQC.YRWGAGGWQSACCTTSISIYPLPMSMKRRGVRIAGRKMSHGAFKKVLEKLAGEG.QDF.SY.PIDLKP..FWAKHGTNKFVTIR.........................................
A0A2K1Y8K0_POPTR/27-302              ...................................................................................................................................lrdmqqmnkafvi----..-..-LD...IR...................................NWGY.Y.EPT.........SVK.GNVG.LQ.LMSpTMP.....E-...-.-...KP...............LLGSRSK.T.I...............-MK.SVKGGFD.HRDigvs.......................................................psmfpMEYMR-G.AW...IG.Q....RE...............................KFL..K..M.L.P..G.N.HN...................................yA.E.V.LPE......TS..A.A..R.H.MQMFQ....................................................P........------..-...-..-.-...P.....YS...ANDE.T.....L....-...-.....D..Q.VEDAG.VV..EKA....nGPEK.K.RQH..P..K.....A..L.K...SLKA.........KKGK.RGPQVP..KPDGS....---.......---PSA.........................QRGR.SA.KK....TAE.IM..I....N.G....I.S...........MDI.SV.FPI.PVCSCTGSP....QQC.YRWGCGGWQSVCCTTCISVHPLPISTKRRGTSIEGRKMS---------------.YVL.SN.RIDLRT..HWAKHGTDKFVTIR.........................................
A0A453IJT4_AEGTS/1-346               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.L.Qh............hnAPH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqhqhhhqnqh....qqqhqhqhqhsreqKVL..H..A.V.P..L.G.PPghighpgh....................avhhhptdF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PLVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A5N5K0B8_9ROSI/5-288               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........PVK.GNLG.LQ.LMSsTMP.....E-...-.-...KP...............ILGSRSA.A.I...............-MT.SVNGGFH.HRDigis.......................................................qpfmpMEYTR-D.VW...IG.Q....RE...............................KLL..N..V.L.P..G.N.HD...................................yA.A.V.LPE......TS..S.S..H.H.MEMFQ....................................................Q........------..-...-..-.-...P.....YS...AKDE.P.....L....-...-.....E..Q.VEEAG.VV..EKV....nGPSK.T.RQR..H..K.....G..P.K...SPRA.........KKCK.RDAQVP..KPEGS....---.......---PSI.........................QRAG.AA.KK....TAE.IM..I....N.G....I.N...........MDI.SV.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTCISVHPLPMSTKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A446QQ33_TRITD/1-348               ................................................................................................................................................MDDD..G..SLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMP.SVAg...gHR...D.T...KP...............LLPNGTF.-.Lqh...........hnALH.HPPHSHH.PRDygngepsgg..............................................mpteppaihMDFVRNE.AW...MH.P....SQhqhqqqhqhhhqnq..hqqqhqhqhqhsreqKVL..H..A.V.P..L.G.PAghighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PEEE.K.....I....A...P.....P..L.VEEHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A2J6LX66_LACSA/1-314               ................................................................................................................................................MDDG..G..HREkggHRvdyy..........................kgvhpQWNM.M.PQQyq....vkdQNA.LLMN.RK.IMH.IVS.....ER...D.T...--...............AIEERDR.-.-...............ALS.EKKSALE.ERD................................................................MAIQQRD.AA...IA.D....RN...............................DAI..R..E.R.D..N.A.IA....................................A.L.R.FQE......TT..M.N..N.H.LQRAS....................................................K........RTATTH..Hh.pP..P.S...S.....YR...HDQN.P.....N....I...T.....E..A.FPITI.VP..SEA.....TAAK.S.KSV..-..K.....E..R.K...SGGNggs...gggGGGS.-RLKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.LG.lM....D.Q....I.N...........FDE.ST.MPI.PICSCTGVG....RQC.YKWGSGGWQSSCCTTTISVYPLPQMPNKRHSRMGGRKMSGTVFTRLLSRLAAQG.HDL.SA.PVDLKN..YWAKHGTNRYITIK.........................................
M0T639_MUSAM/110-272                 ..........................................................................................................................................ltmean----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.GA..KDE.....SPLK.K.RSR..G..R.....P..Q.K...SPKP.........KKPK.K-AVAP..SDDV-....-LN.......G---SL.........................SHEK.GG.RK....STG.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGKP....QQC.YRWGIGGWQSACCTTSISMHPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLRT..FWAKHGTNKYVTIR.........................................
B9R849_RICCO/1-339                   ................................................................................................................................................MDDG..G..HREngrHKadqy..........................ktaqgQWL-.M.-QA.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREnsipsgnmpsscppg......................cqisrgvkhmhhpqqH........AHHMPH..S...S..E.-...A.....SY...STRE.M.....Q....T...S.....D..T.LPMSP.VG..S--.....EAAK.P.RRV..-..K.....R..S.K...DAKMap.....snKKTS.KSPRKI..KRESE....DLNk.....vMFGKSHewkngqdmgg.....gaddlnkqlvVASK.SD.WK....GHD.LG..L....N.Q....I.A...........FDE.ST.MPA.PVCSCTGVF....RQC.YKWGNGGWQSSCCTTTLSMHPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.YDL.SS.PVDLKE..HWAKHGTNRYITIK.........................................
V7C5Q6_PHAVU/1-283                   ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.GTNGAFH.HRDigms.......................................................qttypMEYMR-D.AW...MSsQ....RE...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.H.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....A....-...-.....-..-.VEEEP.VV..EKAs...gGTRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGGP....QQC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5N6RU51_9ROSI/1-284               ................................................................................................................................................MDGD..N..NLN...MR...................................NWG-.Y.YEPa.......pSLK.GHLG.LQ.LMS.SMP.....E-...-.-...KQ...............LIGGRNA.A.V...............-LA.GGNGAFH.HRDmgvs.......................................................hsafpMEYMRDA.CW...FN.Q....RE...............................KYI..N..V.L.S..G.N.PS....................................Y.G.V.LPE......TS..S.A..Q.H.VQMVQ....................................................P........------..-...-..-.-...P.....DL...SKDE.R.....I....-...-.....V..S.TEETG.IE..KEN.....GPIK.K.RQA..P..K.....A..P.K...SPKE.........KKAK.KAPRAR..KAESS....---.......-P-SVP.........................RARS.AA.KK....TTE.IV..I....N.G....V.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTNMSMYPLPLSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2I4GBW9_JUGRE/1-315               ................................................................................................................................................MDDG..R..KHEngrHKmdyy..........................reshsPWNM.V.PQHql.....kePNA.LVMN.KK.IMS.IIS.....ER...D.A...--...............AIHERNA.-.-...............AIS.EKNEALA.ARD................................................................EALHQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.F..A.A.LQV-Rdntmnfplgg................................giqrgtkrmhH.......lSNHPDN..L...A..E.-...A.....PY...NTKE.A.....Q....I...T.....N..A.FPITV.IA..S--.....EAVR.S.HQA..-..K.....R..T.K...DNKSv.......cSKQS.KSPRNG..KKLGE....DLN......rQAASVG.........................TKYR.SE.WD....GQD.VG..L....N.L....V.I...........FDE.ST.MPL.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTRMSMYPLPQMPNKRHARVGGRKMSGSVFTRLLSRVAAAG.HDL.SL.PLDLKD..SWARHGTNRYITIK.........................................
A0A5A7R7I6_STRAF/1-73                .............................................................................................................................................mrg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..K.....R..A.K...RASS.........KRSN.SSASVC..NNWEE....DEQ.......GFG---.........................SDGS.ES.WK....-DN.LG..M....N.R....I.N...........FDE.LA.MNV.PVCTCTGPP....QPC.YR----------------------------------------------------.---.--.------..--------------kk.......................................
H1ZN55_POPTR/1-284                   ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........TVK.GNLG.LQ.LMApTMP.....E-...-.-...KP...............FSGSRSA.A.I...............-MT.SMNGGFN.HRDigvs.......................................................qhmfpMEHMR-D.AS...ID.K....RE...............................KFH..N..V.F.T..G.N.HD....................................Y.DvV.FPE......TS..S.A..N.H.MQMFQ....................................................P........------..-...-..-.-...P.....NS...ANDE.T.....L....-...-.....D..Q.VEGAG.VV..EKE....nGPDK.K.KQR..P..K.....A..L.K...CLKA.........KKGK.RGPQVP..KPDGS....P--.......----SA.........................QQGK.SS.KK....TVE.IM..I....N.G....I.S...........MDI.SL.FPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTCISVHPLPMSMKRRGARIAGRKMSLGAFKKVLEKLAGEG.YDF.SN.AIDLRT..HWAKHGTNKFVTIK.........................................
A0A6A5MPS7_LUPAL/1-287               ................................................................................................................................................MDGD..N..GLN...MR...................................NWGY.Y.-EAt.......tPFK.NHLG.LQ.LMS.SMP.....EK...Q.-...-P...............LLGARNA.A.-...............---.---APFH.HRDigms.......................................................qsaypMEYMR-N.AW...IG.H....NHrdr.........................fmnMNI..N..M.I.P..T.N.HN....................................Y.S.L.APE......TS..S.A..H.Q.MQMVE....................................................-........--AQQQ..P...T..E.-...-.....-Q...SEEE.T.....P....-...-.....-..T.EEETP.VE..KVN.....GTGK.K.R--..G..K.....G..S.K...VPKA.........LKAK.KTKRGP..REPK-....DKD.......APS--V.........................QRAR.TV.RK....SAE.IV..I....N.G....I.D...........MDL.SS.IPI.PVCSCTGAL....QQC.YRWGSGGWQSACCTTGISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLKT..YWAKHGTNKFVTIR.........................................
S8E3W5_9LAMI/1-241                   ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.-MA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAILQRD.SA...IS.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DN..A.L..H.F.RST--....................................................-........--STIN..T...N..P.-...S.....ST...GAKH.V.....H....H...I.....H..Q.YDEGE.DD..A-A.....EPPK.S.HRA..-..K.....R..P.K...EPKP........pPPPP.PPSRKA..SKSSK....RAN.......KQQ-ED.........................ETTV.QD.WK....DQD.LG..L....N.Q....V.S...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMHPLPAVPNKRHARIGGRKMSGSAFNKLLNRLASAG.QDL.TN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A1U8KYJ5_GOSHI/47-257              ................................................................................................................................................MDGA..G..QLEngrYKldry..........................kgahpPWNM.M.PQHhv....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIQERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.IER......DN..A.L..A.V.LQCREsaknfpfg....................................sgiqrgrtC........MHPSYH..S...S..D.T...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..SAE.....--GK.S.CPV..-..K.....R..T.K...VNRA.........VSSK.-SPRKI..KKVAE....DLN.......RQ----.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------vdtefapaqefpdiatsgemvdg..................
H1ZN95_SOLTU/1-281                   ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SMV.....DR...D.A...KP...............YLTRREN.P.I...............-ML.GANGVFH.SRDsiipe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.S.PY....................................T.S.V.LPD......AS..A.S..T.P.MQMVQ....................................................-........------..Q...P..D.-...-.....--...TTKD.A.....G....-...-.....V..N.AEEPS.VK..KES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKSK.KVSSTP..KENGN....---.......----PS.........................QRAK.PA.KK....SMD.IV..L....N.G....I.D...........MDI.SV.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A397YEY1_BRACM/1-279               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPaa.....atSFK.GNLG.LQ.LMP.TI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.QTGSYHH.QHH...............................................................hPEPHMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.V.LPQ......TS..S.S..P.S.MHMN-....................................................-........LHHHHH..Q...T..D.E..hP.....VK...CE--.-.....-....-...P.....D..I.IET--.--..---.....---K.K.RKP..-..N.....S..K.A...GGAP.........TKAK.K-PRKP..KEENG....DSN.......NAN--I.........................SRVK.PA.KK....SFD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
A0A6A6LW61_HEVBR/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........TFK.GHLG.LQ.LMS.SMA.....DR...D.T...KH...............FLPGGDP.N.N...............IMV.GANGAFH.PRDcvvs.......................................................dapvpMNYVR-D.SW...IS.Q....RE...............................KFL..N..M.L.P..Q.N.PS....................................Y.A.V.LPE......TS..G.A..H.S.MQVLQ....................................................P........------..-...-..-.-...P.....NS...SRDE.K.....V....-...-.....G..R.IEEPS.VN..KEG.....SQLK.K.RQG..G..G.....A..P.K...TPKA.........KKPR.K----P..KDNSN....---.......---NAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHD--------ssdcfekfvvv..............................
A0A328DPD4_9ASTE/1-280               ......................................................................................................................................mmdqnnstir----..-..---...--...................................----.-.---.........---.----.-T.YMA.IMA.....ER...D.A...--...............AILERNL.-.-...............AID.ERKRALA.ERD................................................................MAMLQRD.AA...IS.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.QER......NE..A.I..A.A.LQFQD....................................................T........AQDESN..I...T..H.Y...P.....HH...NHQH.P.....H....Q...M.....V..A.TSVDP.VP..A-P.....ETSI.P.RKV..K..R.....Q..P.N...ESREf.......dEEPS.KLPMVL..KEESF....DWQ.......AVSAFNdwadgggn.........heefvdpgKEEE.EE.QE....GKP.LQ..D....S.W....D.P...........ADV.SG.MPA.AVCSCTGTP....RKC.YKWGNGGWQSACCTTTISMYPLPQASDKRYSRVGGRKMSGKAFSKLLGRLTAEG.YDM.SA.PLDLKD..HWAKHGTKK-----tsil.....................................
A0A1U8A5C2_NELNU/42-324              ................................................................................................................................................MDEK..G..GLG...IR...................................NWD-.F.SEQ.........SVG.VDAV.LK.PVS.GVP.....VP...S.G...--...............----TSG.H.Q...............AAF.LKMGAYA.NRN................................................................SMVPQAD.TG...AS.T....ME...............................--Y..G..G.H.C..W.V.HP....................................R.N.F.LPP......NK..A.N..P.S.LQA-T....................................................P........LNTETG..L...PvvP.T...G.....LG...VPTD.G.....H....N...N.....E..F.GSKST.KI..RKQ.....QPSA.K.KAN..R..V.....A..S.K...ALRP.........KQPK.KKPSVS..TTTKK....KN-.......---NSM.........................STAK.HE.KK....NLD.IV..I....G.G....A.T...........LDF.SR.IPA.PICSCTGVA....RQC.YRWGAGGWQSSCCTTNISEYPLPMSSKRPGARMAGRKMSNGAYAKLLQRLAAEG.HDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A059ANB0_EUCGR/1-314               ................................................................................................................................................MDDG..G..QHG..nHRhkveyp.......................yklmhtLWNM.A.PQHqm.....keKNA.LAMN.QK.IMN.ILR.....EK...E.Q...--...............AIQERKD.-.-...............AEA.QTKAAIG.ARD................................................................EAFRQRE.EA...LV.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.R..A.A.LQYWEnainftmv....................................ggnqhglkR.......vHHPPYS..P...A..D.I...A.....EA...LNAD.V.....R....I...T.....D..A.FPISS.IT..A--.....DAIK.P.RQG..-..K.....R..S.K...EGKGi.......aSKGS.STQRKG..KRVGE....DLN......vQVLSHA.........................KKVR.SK.WD....SAD.VC..L....N.L....V.V...........FNG.ST.MPV.PVCSCTGIP....RHC.YKWGNGGWQSSCCTTTLSMYPLPQIPHKRHARVSGRKMSGSVFTKLLSRLAAEG.HDL.SI.PLDLKD..YWAKHGTNRYITIK.........................................
A0A1S3XSA2_TOBAC/1-313               ................................................................................................................................................MDDG..G..RRE...SRrhrmdc.......................skgghaPWNV.V.PPYqm.....kdQEA.FIMN.TK.IRM.LFA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKNTVLT.ERD................................................................LAIQQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFQEstmngtlgc..................................rtrgtkrpnQ.......tKNHCDN..S...T..D.-...S.....VC...INRD.V.....P....L...T.....D..A.FPISA.IS..S--.....EVAK.A.LQV..-..K.....R..T.K...GNKGm.......sRKSA.KSPRKT..KKVSE....DLN.......RHLT-T.........................DGSK.AE.WD....AQD.LG.sI....N.Q....I.K...........FDE.SS.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVG.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
A0A540LSY3_MALBA/12-290              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.I...KP...............FAPGRDP.A.V...............-MV.SANGAYH.PRDcvvs.......................................................daqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN...................................yA.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....EA...SRDE.R.....V....-...-.....V..R.MEEPV.VP..KEG.....GTSK.K.RQG..G..G.....A..P.K...APKA.........KKPR.K----P..KDNAN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.T...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRS..HWAKHGTNKFVTLR.........................................
A0A328DQC8_9ASTE/1-287               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........THK.GHLG.LQ.LMS.SPV.....DL...D.T...KP...............FLSARDN.N.Nn.............pNMI.VSNGLFH.PRDsivsq......................................................vpishMDYIR-D.GW...IN.H....RD...............................KFL..L..M.F.P..G.N.HY....................................G.G.I.VAD......PS..G.T..QpP.VQMLQ....................................................Q........---QPQ..S...-..-.-...-.....--...AGKD.P.....N....T...S.....S..T.TAEDP.-S..--G.....DLSK.K.RS-..G..P.....D..V.L...PPKG.........KKAK.KG--GP..SASMK....DV-.......-SPPG-.........................KRSK.PA.KK....TID.VV..I....C.G....T.N...........MDI.SS.IPT.PVCTCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMNNKRRGARIAGRKMSQGAFKKVLEKLGIEG.YNF.DD.PIDLKT..HWAKHGTNKFVTIR.........................................
A0A2Z7CP44_9LAMI/1-280               ................................................................................................................................................MDDD..S..---...MR...................................NWG-.Y.YEP.........PLR.GHLG.LQ.IMS.SLV.....DR...D.T...KP...............FLSGCDN.S.L...............-MV.SPNGAFH.PRDcvvte......................................................ppvthMDYVR-D.SW...IN.H....RE...............................KFL..H..M.F.P..S.T.SH....................................G.S.I.LAE......TS..D.A..H.QsMPL--....................................................-........----PH..Q...P..N.-...-.....TD...VKSG.M.....E....E...L.....N..I.LKKEA.--..--S.....PPLK.K.RAA..P..A.....N..P.K...NPKG.........KKPR.K-GPVP..KDNGD....-C-.......----SV.........................RRAK.VA.KR....NVD.VV..I....N.G....V.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLATEG.YNF.AD.PIDLRP..YWAKHGTNKFVIIR.........................................
A0A2G2XNH6_CAPBA/1-313               ................................................................................................................................................MDDG..G..QRE...NKrhrmny.......................skggyaPWNV.V.PPYqm.....rdQEA.FIMN.TK.IRM.VFA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKKEALA.ERE................................................................FAIQQRD.TA...FA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFLEstmngtlsc.................................rkrgtkrpnqP........KNHCNN..S...S..D.-...S.....VC...INRD.V.....P....V...A.....D..A.FPISA.IS..S--.....DAGK.A.LQG..-..K.....R..S.K...VNKTm.......sMKSA.KFPRKT..KKVKE....DLN.......RQF-ST.........................DGSK.AE.WD....AQD.LG.sV....N.Q....I.Q...........FDE.ST.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHGRLGGRKMSGSVFSRLLTRLALAD.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
A0A4Y7JQ18_PAPSO/1-301               ..............................................................................................................................................md----..-..--N...LR...................................NWHG.Y.YEP.........PHR.GHSG.LN.LSS.P-T.....ER...D.T...KP...............LFNNQHG.G.G...............-IG.RNHQVMV.NNNmnnggvyhphrv........................................vdmgmpethlphLNTSSVD.FW...LN.Q....RQdvkv.......................nmngNHL..N..H.M.N..H.I.NS....................................Y.G.G.LSE......AS..G.S..H.G.LQIIP....................................................-........-----Q..Q...P..E.-...-.....-A...LKVE.R.....M....-...-.....V..T.MEEPP.IN..V-N.....GPLK.K.RPG..G..R.....A..Q.K...SPKP.........KKPK.R--VVP..KDED-....G--.......IPT--Q.........................RASR.PA.RK....SMG.VN..I....N.G....I.D...........IDL.SV.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSNKRRGARIAGRKMSQGAFKKVLEKLATEG.YNL.SS.PIDLRT..HWAKHGTNKFVTIR.........................................
C5X4B5_SORBI/1-349                   ..............................................................................................................................................md-DDD..G..SLG...IR...................................NWG-.F.YDT.........-VK.GNLG.LQ.LMS.SAP....pDR...D.T...KS...............LLPNGAF.-.Lqhhg......hhnapHQL.HMQHSLH.SRGpaggrasgg..............................................mptesqpihMDFSRNE.AW...LH.Q....PHhhqr.......................preqRVL..H..S.R.P..I.G.PDghvghpgygghp...........ahgghivhhhptgY.E.M.ISD......--..A.Q..H.T.LQMMQ....................................................P.......qLETQLQ..E...P..P.-...-.....-P...CKEE.E.....A....P...P.....P..L.IEDHT.AV..STG.....PPVK.K.RQR..G..Rqq.nrQ..P.K...SPKP.........KKPK.K-AAVP..VEDG-....---.......APNGHA.........................PRRR.GP.KK....TVG.MV..I....N.G....I.E...........LDL.AN.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTSISMYPLPMSTKRRGARISGRKMSHGAFKKVLEKLAGEG.YNL.AN.PINLKT..FWAKHGTNKFVTIR.........................................
A0A565ARR8_9BRAS/1-267               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.NI-.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.S-YHPDP.PMH................................................................MSY----.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.NTp.................................nyG.N.V.LPE......TS..S.A..P.S.MQM--....................................................N........LHHQTE..D...N..P.-...-.....VK...CEEE.-.....-....-...-.....-..-.----I.VQ..T--.....--KK.R.KPN..S..K.....A..G.S...TPKA.........KKPR.K----P..KDENS....NNN.......T---NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.AG.IPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
R0FWU3_9BRAS/1-294                   ...............................................................................................................................................m-ENG..G..QYDngrFKpdyl..........................kgaqsMWNM.M.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKKEAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.Y..A.A.LQHHE....................................................Nsl....nfALSGGK..R...A..D.G...D.....DC...FGTE.T.....H....K...L.....A..V.FPLST.IP..P--.....EVTN.T.KVN..-..K.....R..K.K...ENKQ.........G---.--QVKL..KKVGE....DLN......rRVAAPG.........................KKSR.TD.WD....SQD.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGSA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEG.YDL.SC.PVDLKD..YWARHGTNRYITIK.........................................
M5W6Q0_PRUPE/1-311                   ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A397YEP1_BRACM/26-298              ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.S-A.....DR...N.T...KP...............FLPGRDP.N.L...............MIG.-QNGSYH.HPE................................................................PPIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.V.LPE......AS..S.A..P.S.MHHHH....................................................-........-HHQTE..D...N..P.-...-.....VK...CEE-.-.....-....-...-.....-..-.--EEE.IV..Q--.....-PNK.K.RKT..-..-.....N..S.K...ASAT.........AKGK.K-PRKP..KEEND....SKT.......----NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG.FNF.GS.PIDLKS..HWARHGTNKFVTIR.........................................
A0A3S4NSM7_9MAGN/1-280               ................................................................................................................................................MDEK..G..VSG...IR...................................NWD-.F.SDQ........gANV.SSVF.KP.ISN.AGV.....HG...G.-...--...............AIFDGSS.-.-...............GVS.EYQSTFL.K-M................................................................NAFSDRN.SM...TS.E....AA...............................ELT..N..W.-.-..V.N.QK....................................N.Y.L.SET......KA..S.P..N.Q.MQAIE....................................................A........DLADIH..M...V..L.-...-.....-G...ASVD.A.....T....Q...N.....G..K.FEAKP.AElkKQQ.....PSAK.K.SNQ..Q..F.....A..S.K...VLRP.........KQSK.KNPSPL..TKRQG....---.......---SSV.........................ASAK.CE.KK....NTD.AV..V....N.G....T.T...........LDI.SR.VPP.PICSCTGVP....RRC.YRWGSGGWQSSCCTLSISEYPLPMSPSRPTARMAGRKMSSGAYSKLLERLATEG.FSL.SN.PVDLKD..HWARHGTNKYATIK.........................................
A0A498I8A5_MALDO/35-313              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.T...KP...............FVPGRDP.T.V...............-MV.SANGAYH.PRDcvvs.......................................................daqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................YgA.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...P..-.-...-.....EP...SRDE.R.....V....-...-.....G..R.IEEPV.VP..KEV.....GTSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----A..KDST-....---.......--NPSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PICSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRF..HWAKHGTNKFVTLR.........................................
A0A251R859_PRUPE/1-278               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FVPGRDP.A.V...............-MV.SSNGAFH.PRDcvvs.......................................................dapvpLNYMR-D.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....A..R.IEEPV.AN..KEG.....GPSK.K.RGG..G..G.....A..P.K...TPKV.........KKPR.K----P..KDNNN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAS....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRG..HWARHGTNKFVTIR.........................................
M0U0N5_MUSAM/1-101                   ................................................................................................................................................MDDD..G..GMG...MR...................................NWAY.F.-DQ.........TLK.GDSG.RH.LMP.SMA....aEC...G.A...--...............---PKPP.F.L...............---.-SNGAFH.RREcfip.......................................................eqpdrMDITR-N.EW...IN.L....RE..............................nNML..H..M.L.P..L.N.NC....................................S.S.A.MGD......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------agkvavskd................................
A0A164SP12_DAUCS/129-356             ..................................................................................................................................qeggspvkkkkrtd----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.-VN................................................................MEPVS-D.SW...VH.R....DR...............................FVQ..Q..M.V.S..A.N.PS....................................F.A.G.FHE......HP..P.A..H.S.MHMLQ....................................................-........--HQ-Q..Q...S..E.S...P.....KI...GMED.V.....D....-...-.....-..-.--VKK.EI..--G.....EPVK.K.RQS..-..-.....-..A.A...ASKP.........RKPR.KSPSIP..KENGS....ST-.......-----G.........................HRVK.PA.KK....SMN.VV..I....N.G....M.D...........LDF.SS.IPI.PVCTCTGTP....QQC.YRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAADN.YSF.AN.AIDLRY..HWARHGTNKFVTIR.........................................
A0A3B6RBY6_WHEAT/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LMS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnsgngfnpg.....................slngaknfhhhdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..VT-.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.RK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRYITIR.........................................
A0A5J4ZU74_9ASTE/21-224              ................................................................................................................fsatkiglnafqatkmdpkpalaavpicsvap----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...-MTE.P.....T....K...N.....S..E.FDTKP.TK..VKK....rKPSA.K.SSS..Q..I.....A..P.K...VLRP.........KQPK.KKPSGS..KKAR-....---.......--GQIK.........................PGTN.VE.KK....NLN.IV..F....D.K....P.K...........LDF.SA.VPS.PYCSCTGVS....RGC.YKAGSGGWQSSCCNTSLSEYPLPMSSTRPGVRVGGRKMSNGAYGKLLHRLAVKG.HDL.CQ.PVDLKD..HWAKHGTNKFVTIK.........................................
A0A5D2ZVP4_GOSMU/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPARDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appipMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPD......TS..T.T..H.S.MPIWQ....................................................P........------..-...P..L.P...P.....DA...STRD.E.....R....V...V.....G..R.VEEPP.AS..KEG.....VQSK.K.RQG..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IA..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
A0A2P5VQV3_GOSBA/42-234              .............................................................................................................qrtgihhepglivspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---ASI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SN.PVDLKD..HWARHGTNKFVTIK.........................................
A0A5J5B491_9ASTE/1-139               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.M.....H....I...S.....D..A.LPMSP.VA..S--.....EPPK.S.RRT..-..K.....R..T.K...EAKAva.....stKKDS.KSSKKV..KREGE....DLNk.....mMFGKSHewkdgqdan......gggddlnkqlGVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDD.ST.MPV.PVCSCTGVL....RPC.YKWGNGA-----------------------------------------------.---.--.------..--------------ltadsgqlaittgls..........................
A0A3Q7HUZ5_SOLLC/1-292               ................................................................................................................................................MDGN..G..GMH...IR...................................NWSY.F.-EPt......ptVPK.GHLG.LQ.FVS.SMN.....EK...P.P...HFr.............nIHDNHQQ.-.Qqqshq....pdhpsvMAS.TNGGAFH.HHRvcgls......................................................espmpMEYMR-D.SW...VN.Q....KD...............................---..-..-.-.-..-.-.YR....................................E.K.Y.---......LN..V.L..S.S.MQMHQ....................................................-........------..-...-..-.Q...P.....NL...VKVE.T.....A....-...-.....P..L.VEEVC.QE..GDNi...gGLAK.K.RGA..G..Qs...qE..L.K...SPKP.........KKAK.KATRAP..KDEST....---.......---SSP.........................PRAR.AP.RK....SAE.VV..I....N.G....I.N...........MDI.SV.IPI.PICSCTGAA....QQC.YRWGCGGWQSACCTTNLSSYPLPMNVKRRGSRIAGRKMSLGAFKKVLEKLASEG.YNF.SN.PIDLKP..HWARHGTNKFVIIR.........................................
A0A3N7GMY9_POPTR/31-285              ..............................................................................................................................................pn----..H..SLD...IR...................................NWGY.Y.EPT.........SVK.GNVG.LQ.LMSpTMP.....E-...-.-...KP...............LLGSRSK.T.I...............-MK.SVKGGFH.HRDigvs.......................................................psmfpMEYMR-G.AW...IG.Q....SE...............................KFL..K..M.F.P..G.N.HN...................................yA.E.V.LPE......TS..A.A..R.H.MQMFQ....................................................P........------..-...-..-.-...P.....YS...ANDE.T.....L....-...-.....D..Q.VEAAG.VV..EKA....nGPEK.K.RQH..P..K.....A..L.K...SLKA.........KKGK.RGPQVP..KPDGS....---.......---PSA.........................QRGR.SA.KK....TAE.IL..I....N.G....I.S...........MDI.SV.FPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTCISGHPLPISTKRRGTRIEGRKMSLGALRKF--------.---.--.------..--------------srnflv...................................
A0A2K3P0I5_TRIPR/1-312               ................................................................................................................................................MDDD..H..QYEngrHKvefy..........................rgahsPWNT.D.PQHqi.....keQNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............ALLELEL.E.A...............AIS.EKNEALA.ARD................................................................AALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.L..A.A.LQS-Rsgasnfpfng...............................giqrgskrmhhS........SNHISN..I...S..E.-...P.....AY...STAD.I.....I....I...R.....D..A.SPVTV.IT..S--.....EAVK.S.HLT..-..K.....R..T.K...ENKA.........---S.KSPTKI..KKLGE....DLNr.....kAYS-EG.........................TKIK.SE.WD....RQD.VG..L....N.L....I.A...........FDE.TV.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFIRLLSRFASQG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A1R3HYE9_9ROSI/1-311               ...........................................................................................................................................mhqps----..-..---...--...................................----.-.---.........---.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.V.AER......DN..A.I..A.N.LQYREnslangnmsscppg.......................fqmsrgmkhvphqqqN........VHHMPH..I...S..E.-...A.....PY...NSRE.M.....H....S...S.....D..A.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..G.K...EAKAva.....sdKKAS.KPPKKV..KRENE....DLNk.....iMLGKSDewkggqdvg......gggddhkkqnVATK.SD.WK....GQD.LG..L....N.Q....V.V...........FDD.ST.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEG.HDL.SI.PVDLKD..NWAKHGTNRYITIK.........................................
A0A0D2TAR1_GOSRA/40-234              ...........................................................................................................slqrtgihhepglvvspirtiaattesgnnndlgtkt----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---TK.VG..KQK.....SSVK.G.SNQ..-..I.....A..P.K...VLGP.........KQPM.KKPSLP..KKGKG....---.......---PSI.........................PETK.RE.KK....NPN.IN..L....D.G....T.K...........FDF.SG.VPS.PICSCTGVA....RVC.YKWGASGWQSSCCTINISECPLPMSPTRPGARVAGRKMSNGAYFKLLLRLAAEG.YDL.SH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A2G3D805_CAPCH/2-91                ....................................................................................................................................dnkegdtqltsl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....KDN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTT....QPR.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGRRKMGSGA------------.---.--.------..--------------qgydls...................................
A0A151RRJ6_CAJCA/1-115               ................................................................................................................................................MDDG..R..QHEnsrHKmdyy..........................rgahsLWNT.D.SQHqv.....kePNA.LVMN.KK.IRS.IMA.....ER...Q.A...--...............AILELEL.E.A...............AIS.EKNEALA.ARD................................................................AAIRQRD.EA...IA.Q....RD...............................---..-..-.-.-..-.-.--....................................H.A.L.LER......DN..A.L..A.A.LQTVK....................................................S........--HQTK..K...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------tkd......................................
H1ZN84_TOBAC/1-301                   .......................................................................................................................................mmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................AAI..Q..E.R.D..D.A.IAalrlg.........................essindN.N.V.VPD......SP..G.N..D.T.ETGAK....................................................H........IYNQQQ..M...H..K.T...I.....AE...AAHG.S.....T....E...D.....P..T.AGYLK.GT..DTS.....EAKN.P.K-K..V..R.....R..P.K...ESRH.........NKQA.KIPRQG..KIGAE....SLN.......MQVISTssddwvnl........qeldsdkegDMQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQG.YDL.SV.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A0L9TJ38_PHAAN/1-312               ....................................................................................................................................medgrqnendrh----..-..---...-Kmeyy..........................rgphsMWNT.G.SQHqv.....kePNA.LVMN.KK.IRS.ILA.....ER...Q.A...--...............TILELEL.E.A...............AIS.EKNEALA.ARD................................................................EAIRQRD.EA...LV.Q....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DN..A.L..A.A.LQSRNssvtfpfg....................................sgiqcgskR........IHHSSN..-...-..H.L...C.....IM...SEAA.Y.....K....T...K.....D..A.SPITV.IP..S--.....EVVK.S.HQA..-..K.....R..T.K...ENKVi.......gSKAS.NPPYKV..KKMGE....DLN......rKASFEG.........................TKIR.SE.WH....RQD.VG..L....N.L....V.T...........FDE.TT.MPV.PVCTCTGIP....RQC.YKWGNGGWQSSCCTTTLSMHPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVLEG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A0E0L7C1_ORYPU/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MS.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.TA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gISG--Cgdd..................sahaSVMK.NE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A078HTT9_BRANA/266-534             ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.HPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TSn.................................nyG.N.I.LPE......TS..S.A..Q.S.MRHHQ....................................................T........----ID..E...Y..P.-...-.....--...VKHE.Q.....-....-...-.....-..-.VEEIV.--..Q--.....-TNK.K.RKP.nT..K.....P..G.A...SAKA.........KK--.--PRKP..KEESD....K--.......-----S.........................IKVK.PA.KK....SVD.FV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A166IUT0_DAUCS/1-286               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMS.PIGg...dHR...D.T...KP...............FLSSRDP.-.-...............VML.NANGAYH.PRNcvvs.......................................................eapvpMNYMMRD.SW...IQ.-....RD...............................RLM..H..V.L.P..G.N.SS....................................F.G.V.NPE......AH..S.S..H.T.MQIMQ....................................................P........------..-...-..-.M...D.....SL...SKDQ.V.....L....T...E.....D..V.KPDIR.KG..GSS.....GHTK.K.RQG..P..V.....T..P.K...APRV.........KKPK.KGPAVS..NDNR-....---.......--KSST.........................QRPK.AV.KK....SVE.VV..I....N.G....I.D...........MDI.SG.IPT.PVCSCTGTP....QQC.YKWGCGGWQSACCTTTISTYPLPMSTKRRGSRIAGRKMSQGAFKKVLEKLASEG.YNF.GN.AIDLKS..HWAKHGTNKFVTIR.........................................
A0A4S4DVD1_CAMSI/51-378              ................................................................................................................................................MEGT..N..HLR...VRy................................wqQW--.L.MQH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKTALA.ERD................................................................MAMLQRD.TA...IA.D....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnamnsgnmspcppg.......................cqisrgvkhmhhpqqH........VHHQPH..M...G..D.-...A.....SY...NSRD.M.....Q....I...T.....D..A.PPMSP.VA..S--.....EPAK.P.RRT..-..K.....R..A.K...EAKGmt.....snKKPS.KSSKKV..KREGE....DLNk.....mMFGKSHdwkseqdmg......sgaddlnkqmGVSK.PD.WK....DQD.MG..L....N.Q....V.A...........FDD.SS.MPV.PICSCTGML....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.TN.PVDLKD..HWAKHGTNRYITIK.........................................
D8TCJ2_SELML/125-266                 ...............................................................................................hqqqqqqceqeqiaggvasnnaaaspaaatatkaeksgknsggakaess----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........TTR.KY.YPA.PFCSCTGTN....QQC.YRWGNGGWQSACCTTKISMYPLPMNPKKKGSRVAGRKMSAGAFMKLLDRLTAEG.VDV.NS.SVDLRP..HWAKHGTN------.........................................
A0A2G2X187_CAPBA/1-324               ................................................................................................................................................MDDS..G..NRDnsrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssmsggqivr................................gvkhmhhpqqH........VHHQQH..M...V..E.-...P.....TY...NPRD.V.....H....I...N.....E..A.IPVSP.PA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAap.....cpKKAP.KASKKV..KRETE....DLNq.....tTFSKSQewkgaqemag.....gasddlnrqlAVPK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
A0A059C3N5_EUCGR/6-234               ...................................................................................nrghimpdanggpslshiawfygsgffptpkvssgpssqtqlnpedglpvppirsvastte----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....P..A.KSNSP.GT..---.....KSAK.P.KKR..K..S.....S..S.K...EPDQi.......tSKAL.K-QKQP..RKKSS....SGK.......GKGQSF.........................PEAK.RE.KK....DLN.MN..I....D.L....T.N...........IDF.SG.VPS.PYCSCTGIA....RVC.YKWGAGGWQSSCCTISVSEYPLPMSSSRPGVRLAGRKMSNGAYVKLLVRLASEG.YDL.TH.PVDLKD..HWARHGTNKFVTIK.........................................
A0A4Y7JAX7_PAPSO/1-300               ..............................................................................................................................................md----..-..--N...LR...................................NWHG.Y.YEP.........PHR.GHSG.LN.LSS.P-T.....ER...D.T...KP...............LFNNQHG.G.G...............-IG.RNHQVMV.NNNmnnggvyhphrv........................................vdigmpethlphLNTSSVD.FW...LN.Q....RQ...............................DVK..V..N.M.N..G.N.H-....................................L.N.H.MNH......IN..S.Y..G.G.LSEAS....................................................-........GSHGLQ..N...I..P.Q...-.....--...QAEA.M.....K....V...E.....R..M.VPMEP.PI..NGN.....GPLK.K.RPG..G..R.....A..Q.K...SPKP.........KKPK.R--VVP..KDED-....G--.......IPT--Q.........................RASR.PA.RK....SMG.VN..I....N.G....I.D...........IDL.SV.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSNKRRGARIAGRKMSQGAFKKVLEKLATEG.YSL.SS.PIDLRT..HWAKHGTNKFVTIR.........................................
F6HFA4_VITVI/15-307                  ................................................................................................................................................MDDD..G..GLN...MR...................................NWG-.Y.YEP.........AFK.GHLN.LQ.LMS.SVA.....ER...D.T...KP...............FLPGRDS.P.L...............-MV.SANGAFH.PRDcmvs.......................................................eapvhMDYVR-D.SW...IN.Q....RD...............................KFL..N..I.L.P..G.N.SN....................................F.Q.V.LPE......AP..L.G..K.E.KFYHS....................................................T........EAHPMQ..I...I..Q.Q...P.....EP...SKDE.R.....V....-...-.....G..R.MEDSD.LK..KEG.....GPLK.K.RTG..G..G.....A..P.K...TPKI.........RKTK.KGPSVP..KDGTN....S--.......----SV.........................QRVK.PA.KK....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGNP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRR..HWAKHGTNKFVTIR.........................................
H1ZN48_POPTR/26-224                  ..............................................................................................................fsslktnsgfdrtqidpqpglpvapihsissadl----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.---AK.SN..SGT.....KPTK.A.RKH..K..S.....A..A.K...DSNQi.......pPKVL.G-PKQP..KKISS....KK-.......TKGQIT.........................LEAK.HE.KK....NLD.ID..I....G.K....I.N...........FDP.SG.VPS.PFCSCTGMP....RVC.YKWGAGGWQSSCCTDSISEHPLPMSSTRPGVRMAGRKMSNGAYVKLLLKLSAES.YNL.SH.PLDMKN..HWARHGTNKFVTIK.........................................
A0A2G9HQ94_9LAMI/1-308               ................................................................................................................................................MDGN..G..NMN...LR...................................NWGF.-.FEPp......ttTLK.SHLG.LQ.LMS.SMS.....EK...P.L...FG..............gAVRDNQH.T.Qps...........pmMAS.TNGGPFH.HHRvg...........................................................gisESHISMD.YW...MS.Q...nRE...............................KYL..N..V.L.S..G.N.HHhay.............................yqsnF.G.V.SPE......TS..S.A..H.S.IQLPQ....................................................-........-QVNLS..K...N..E.-...N.....VI...SEVE.E.....M....C...E.....E..R.DNGGG.GS..SGA.....VAVK.K.RGA..G..K.....V..P.N..cAPKE.........KKPR.T--KAP..RATRD....---.......EPTPSV.........................PRAR.AP.KK....RAE.VV..I....N.G....I.N...........MDI.SD.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGLSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLATDG.YDF.SN.PIDLRS..YWAKHGTNKFVTIR.........................................
A0A1S4DPI3_TOBAC/1-301               .......................................................................................................................................mmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................AAI..Q..E.R.D..D.A.IAalrlg.........................essindN.N.V.VPD......SP..G.N..D.T.ESGAK....................................................H........IYNQQQ..M...H..K.T...I.....AE...AAHG.S.....T....E...D.....P..T.AGYLK.GT..DTS.....EAKN.P.K-K..V..R.....R..P.K...ESRH.........NKQA.KIPRQG..KIGAE....SLN.......MQVISTssddwvnl........qeldsdkegDMQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLADQG.YDL.SV.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A251T2N6_HELAN/129-284             ...............................................................................................................................cgginggndggpvkkrg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.STTATP..KSSRS....KKQk.....kNPSTPK.........................DRAK.TI.KR....GVD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCTCTGSP....QQC.YRWGFGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.AN.AIDLRT..YWAKHGTNKFVTIR.........................................
A0A0L9T8A0_PHAAN/1-279               ................................................................................................................................................MDDD..V..-LN...MP...................................NWG-.Y.YEP.........FRG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............YLPARDP.A.V...............-LM.GANGTFH.PRDcvvs.......................................................eapmpLNYVR-D.NW...TS.Q....RE...............................RYF..S..MqQ.P..T.N.PN....................................Y.A.V.LPE......TS..V.A..P.N.LQIIQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....V....-...-.....D..R.IEELV.VK..KEG.....GQSK.K.RQT..K..G.....A..L.T...TPKA.........KKPR.K----P..KDNG-....--N.......VPV---.........................QRVK.PP.KK....TME.LV..I....N.G....I.D...........MDI.SG.LPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLKT..HWARHGTNKFVTIR.........................................
A0A6A5NV11_LUPAL/1-281               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LLGARNA.A.V...............-LS.GNHGGFH.HRDigmp.......................................................hatypMDNMR-D.AW...ISsQ....RE...............................KFM..N..M.I.P..T.N.PT....................................Y.G.D.IPE......TS..S.A..Y.H.MQMIQ....................................................-........------..-...-..-.P...P.....EV...PKEE.R.....A....-...-.....-..-.IEEEP.VV..DKV.....NSTS.K.KRQ..G..K.....V..P.R...SPKV.........KKSK.RGPHML..KDEN-....---.......APS--V.........................QRAR.IP.KK....TAE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGIP....QQC.YRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5D3ADP4_GOSMU/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LTS.SMA.....ER...D.T...KS...............FIPMRDP.N.L...............-MV.TPNAAFH.PRDcivs.......................................................eapipMNYVR-D.SW...IS.Q....RE...............................KFF..N..M.L.P.gI.S.PN....................................Y.G.I.LPE......TS..A.A..H.S.PPILQ....................................................P........------..-...-..-.S...P.....NS...STRD.E.....R....V...V.....G..R.VEESP.AT..KES.....VELK.K.RQS..E..S.....A..P.K...TPKT.........KKPR.K----P..KDNTN....---.......---SSV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.NN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A6G1CQG6_9ORYZ/1-331               ....................................................................................................................................menlghrengrq----..-..---...-Rpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..V--.....SVGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gISGCGEds....................chaSVMK.NE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....HQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A061E9H4_THECC/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KS...............FIPGRDP.N.L...............-MV.TPNAAFH.PRDcvvs.......................................................eapipMNYVR-D.SW...IS.Q....RE...............................KFF..N..M.L.P..A.TaPN....................................Y.G.I.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...P..-.-...P.....DP...SSRN.E.....R....V...V.....G..R.VEEQS.VN..KEG.....VPLK.K.RQG..G..A.....A..P.K...TPKA.........KKPR.K----P..KDNTN....S--.......----TV.........................QRVK.PA.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YNF.NN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A4D8YE58_SALSN/1-300               ................................................................................................................................................MDES..G..REN...TRlrmdgy.......................hkvpvpQWNP.M.PQYqi.....kePIA.FQLN.AK.LMM.LCN.....ER...D.D...--...............TTRERDR.-.-...............ALT.EKKSALD.ERD................................................................AAIKQLD.AA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................E.A.L.RER......DN..A.I..A.A.LQFHE....................................................Stm...sdlVNSSAR..G...A..K.R...T.....HH...PMKE.D.....C....I...R.....D..A.FPVSQ.VP..HES.....PVSK.K.GTR..A..K.....A..N.K...DAQA.........RSA-.RSPKKV..KKMGE....DLN.......KQVKT-.........................EGYK.TE.WD....AQD.LG.sM....N.Q....I.M...........FDE.SS.MPG.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTSLSMYPLPQMPNKRHARMGGRKMSGSVFSRLLTRLAEAG.QDL.SV.SVDLKE..YWAKHGTNRYITIK.........................................
A0A2J6JTR1_LACSA/1-300               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMS.PLT....dHR...D.T...KS...............FLSSRDN.P.Lmm..........nqnGAS.SMAAAYH.HRPqncvv.....................................................seapipLHYMR-D.SW...IQ.-....RE...............................RLL..H..M.L.P..G.N.PN....................................F.S.L.LPD......AS..A.S..N.S.MHMMQ....................................................Q........QQQQQQ..P...I..D.L...P.....KD...TLDD.N.....G....-...-.....G..G.VGTGG.DT..GGS.....GPVK.K.RST..-..T.....N..P.K...TPRA.........KKPR.KPPGVP..KENGG....NH-.......----HG.........................QRSK.VV.KR....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSNGAFKKVLEKLASEG.YNF.AN.AIDLRL..HWAKHGTNKFVTIR.........................................
A0A5N6LS88_9ASTR/1-304               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.EHLG.LQ.LMS.PMG....dHR...D.P...KP...............FQSLRDS.P.V...............MVN.PNVSTYH.HPHtrvvs......................................................nppapMNYMR-D.AW...IQ.-....RE...............................RLL..H..M.L.P..G.N.TS....................................F.S.V.LPS......SS..T.S..H.S.IHMVP....................................................Pldl..skdPVMNMA..V...E..D.N...V.....AV...SKDS.G.....S....V...G.....G..G.SGTGN.SG..GDG.....GSIK.K.RGS..T..T.....A..P.K...ASGS.........RKPK.KTRKTP..STPKE....TGN.......SSG---.........................-HRA.KT.IK....NVD.VV..I....N.G....I.D...........MDM.SG.IPI.PVCTCTGAP....QQC.YRWGLGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YNF.AN.AIDLRT..YWAKHGTNKFVTIR.........................................
A0A1J6ICM6_NICAT/1-313               ...............................................................................................................................................m-DG-..N..GMN...IR...................................NWG-.F.FEPa......atVLK.GHLG.LQ.LMS.SMD.....EK...P.L...FG...............NIRDHHH.H.H...............HHH.HNHQTH-.--Qphhptvmestngga...................................fhhhrvcgisetpmpIEYMR-D.SW...VN.H....KDy............................rdKYL..N..V.L.S..G.N.HHyl................................tgY.G.F.LPE......TS..S.A..Q.S.MQIHE....................................................Q........--P---..-...-..-.-...-.....NL...VKVE.P.....D....-...-.....S..Q.LEEVC.LE..RDI....gGLAK.K.RGA..G..K.....SqlL.K...SPKS.........KKAK.KATRVP..KVEPT....---.......---PSV.........................PRAR.AP.RK....SAE.VV..I....N.G....I.T...........MDI.SV.IPI.PVCSCTGAA....QQC.YRWGCGGWQSACCTTNLSSYPLPMNTKRRGSRIAGRKMSLGAFTKVLEKLASEG.YNF.SN.AIDLKP..YWAKHGTNKFVTIR.........................................
A0A2K1Y8K5_POPTR/7-290               ................................................................................................................................................MDED..N..SLN...IR...................................NWGY.Y.EPT.........SVK.GNLG.LQ.LLSpTMA.....E-...-.-...KP...............FLGARSN.A.I...............-MT.NVNGGFH.HRDigvs.......................................................qpmfpMEYMR-D.VW...IG.H....RE...............................KLL..S..M.L.P..E.N.HN...................................yE.A.L.LPE......TA..S.T..H.H.VQVFQ....................................................P........------..-...-..-.-...P.....DS...ENDE.M.....L....-...-.....D..Q.VEESG.FV..EKE....nGPNK.K.RQR..A..N.....A..P.K...SPKA.........KKGT.RAPRVP..KPEGS....---.......---PSV.........................QRVR.TA.KK....TAE.IM..I....N.G....I.N...........MDM.SV.IPI.PVCSCTGNP....QQS.YRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAGRKMSSGAFKKVLEKLADEG.YDF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
V4MAM5_EUTSA/8-231                   ................................................................................rnhiqsatsaskdtglptsnahwfhsyfpvprttgidlsqlsqenpsevvmvpqarlfppptrd----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.SR..SDM.....ETVK.H.KSS..K..L.....S..P.S...EALK.........PKPQ.KKKRSA..SKNPK....-K-.......-TAPSV.........................PETK.RE.KK....NPD.IN..I....D.I....S.S...........FDV.SG.VPP.PVCSCTGVP....RVC.YKWGMGGWQSSCCTISISTYPLPMSTTRPGVRLAGRKMSNGAYVKLLMRLAGEG.YDL.TL.PVDLRN..HWARHGTNKFVTIK.........................................
A0A2P5YSL2_GOSBA/15-264              ..............................................................................................................drykgahppsnindqecvvkankrtntyvlekqn----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.K..N.I.LSVLQcrenaknfp.................................fgsgiqrgrtC........MHLSYH..S...S..D.M...D.....ET...LNHE.M.....H....V...T.....N..A.LPVST.IP..S--.....AEGK.S.CPV..-..K.....R..T.K...VNKA.........VSSK.-SPRKI..KKVAE....DLN......rQVDTEV.........................RKCK.SE.WN....SEH.IG..L....S.L....I.N...........FDE.TK.ISV.PVCSCTGVP....RHC.YKWGNGGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.YDV.SK.PLDLKT..YWARHGTNRYITIK.........................................
A0A2G9G7G5_9LAMI/1-94                ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.AVDLKE..HWAKHGTNRYITIK.........................................
A0A5P1F4G2_ASPOF/35-171              ..................................................................................................yqpsflkmsaytnrssivnepdneassmefpwfpqrsffsptrdps----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....PEHT.K.KNK..E..I.....E..A.K...PAKV.........RIAT.K-ALRP..KEPKK...pPAK.......KKGTSI.........................STGK.RE.KR....NQD.AT..I....E.G....T.T...........QDF.SG.VPA.PVCTCTGVS....RQC.YRWGSGGWQS--------------------------------------------.---.--.------..--------------ym.......................................
A0A5N5IAA1_9ROSA/1-311               ................................................................................................................................................MDDG..R..QHEngrHKmdyyr.........................ggtapPWNM.M.AQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALHQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.M.MER......DN..A.Y..A.A.LHS-Rdnavnfplgg...............................gaprgakrmhrT........SNHSVT..L...A..D.-...S.....HY...STKD.M.....H....I...T.....E..A.YPVSV.IS..T--.....EDVK.S.RQT..-..K.....R..A.K...ENKA.........SRAR.QSRKKV..GE---....DLNr.....qASSD-G.........................IKYR.SE.WD....THD.LG..L....N.L....V.T...........FDE.SA.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGNVFTRLLSRLAADG.HDL.SI.PLDLKE..YWSRHGTNRYITIK.........................................
A8D193_POPTR/1-317                   ................................................................................................................................................MEDG..G..QHQngrYKidyyk........................tahphpPWNM.M.PRNqv....keqTNA.LVMN.KK.IMT.ILI.....ER...D.D...--...............AIRERNL.-.-...............AFA.EKKEALA.ARD................................................................EAIQQRE.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.MER......DN..A.L..A.A.IQYREnamnyplsgg................................sqrgskriphP........VYHSSD..M...S..E.-...-.....AL...DSGE.M.....H....V...T.....N..A.LPISS.VP..A--.....ENAK.S.RQT..-..K.....R..S.K...ENKAv.......gLKAA.KSPWKG..NRVSE....DLN.......KQGASD........................gKKIK.VE.WD....SQD.VG..L....N.L....I.N...........FDE.TT.MTA.PVCSCTGVP....RQC.YKWGSGGWQSACCTTTMSSYPLPQLPNKRRARVGGRKMSGNVFTRLLSRLAAEG.HDL.SI.PLDLKD..YWARHGTNRYITIK.........................................
A0A6A6LN48_HEVBR/17-268              .........................................................................................................................................dacigsi----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................---AARD.EA...LH.E....RE...............................KAL..A..-.-.-..-.E.RD....................................K.A.L.MER......DN..A.L..A.A.IQYREngvnfpvgng................................nqrgskriphP........VYNSNA..V...A..E.-...-.....AL...NSGE.M.....H....I...T.....D..A.FPITT.VS..A--.....ESLK.P.RQT..-..K.....R..T.K...ESKPa.......sSKAT.KSPRKG..NKVGE....DLN.......RQGASD........................gKKIK.AE.WD....SQD.AG..L....N.L....V.S...........FDE.TT.MPV.PVCSCTGVP....HQC.YKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.HDL.SV.PLDLKD..YWARHGTNRYITIK.........................................
A0A059BEL2_EUCGR/1-280               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SCK.GHLN.LQ.LMS.TMA.....ER...D.T...KP...............FLPGRDP.T.I...............-LV.APNGAYH.PRDsvvp.......................................................dtplqYNYAR-D.SW...MN.Q....RE...............................KFF..N..M.L.P..P.N.HN....................................Y.A.M.LPE......SS..G.A..H.N.MQMLQ....................................................-........------..M...P..E.-...-.....-S...LRDD.R.....I....G...R.....I..E.EPSPG.VK..KEN.....PQPK.K.RQS..N..G.....I..P.K...TPKA.........KKSK.K----P..KDNT-....--N.......---PPI.........................QRAK.PP.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTQVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A6D2K0I7_9BRAS/1-346               ................................................................................................................................................MDDG..S..HREngrHKaa...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtaaavanmsasscppg............cqisrgvkhmhhphmhhqhqH........QHLMPQ..M...S..E.-...N.....AY...ETRD.I.....E....P...N.....D..A.LPTSP.AL..EPA.....KPKR.G.RRA..-..K.....D..P.N...ATKTtqt...apnKRGP.KNQRKV..KKESE...dELTk.....lMFVKTAsshdyge..........eetskhvlIGSK.SD.WK....NQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGIL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2G9HRG8_9LAMI/195-239             ...............................................................................................................................................l----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-----------------------------------RRLCRGPYRKLLYTLAIGV.HDL.SQ.PVDLKN..HWAKHGTNMFVTIK.........................................
A0A1D6NW48_MAIZE/44-373              ................................................................................................................................................MDNL..G..HREngrQRpeqy..........................kalhtQW-M.I.PQR.........QLK.DHQS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnsgngfhqgp....................plngtknihhhdhlshV........QTSPLQ..L...A..N.S...P.....YD...HVRE.M.....H....I...S.....E..A.YPIAT.AP..ASV....gKAKK.P.RKS..N..S.....Q..A.S...PSKRps....gvlRKTK.KATSDW..KNAGT....TG-.......-----Gagd..................saraSVMK.NE.WK....DQD.LG..L....N.Q....V.V...........FDE.ST.MPA.PACSCTGEL....HQC.YKWGSGGWQSSCCTMNMSMHPLPVMPNRRHARMGGRKMSGGAFAKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A199UBE4_MANES/26-232              ....................................................................................................fysgnfysppktssvhsqgtqidsepglpvdpirsvapttepak----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..KNNs..gtKPAK.A.RKQ..K..P.....S..V.K...GSNQi.......sSKIS.K-PKQP..KKASS....KKN.......G--QNM.........................PEAK.RE.KR....NLN.VD..V....D.R....M.N...........FDL.SG.VPS.PFCSCTGMP....RVC.YKWGAGGWQSSCCTITISEYPLPMSSARPGARMAGRKMSSGAYVKLLLKLAAEG.HDL.SH.PVDLKD..HWARHGTNKFVIIK.........................................
F6GSS6_VITVI/1-180                   .............................................................................................................................................mqm----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...L..Q.Q...P.....DS...TKDE.M.....V....-...A.....Q..V.EEEAG.VE..KDN.....GPLK.K.RAG..G..K.....T..Q.K...SPKA.........KKPK.RAPKVP..KDESS....---.......---PSV.........................QRAK.PG.KK....NTE.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLAAEG.YNF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A5E4EI40_PRUDU/1-278               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FVPGRDP.A.V...............-MV.SSNGAFH.PRDcvvs.......................................................dapvpLNYMR-D.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....A..R.IEEPV.AN..KEG.....GPSK.K.RGG..G..G.....A..P.K...TPKV.........KKPR.K----P..KDNNN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRG..HWARHGTNKFVTIR.........................................
A0A176WT74_MARPO/171-258             .............................................................................................................................................hei----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.------GVK....QQC.YRWGNGGWQSSCCTTMISMYPLPMNPTKRGSRLAGRKMSAGAFEKLLEKLALEG.VNV.NY.PVDLKD..HWAKHGTNRYVTLR.........................................
BPC6_ARATH/1-342                     ................................................................................................................................................MDDG..G..HREngrHKaa..............................vqgQW-L.M.-QH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtapaanmsacppgc................qisrgvkhlhhphmhhhhQ........QHHIPQ..L...T..E.-...N.....AY...ETRE.M.....E....P...N.....D..G.LPTSP.PA..GST....lESAK.P.KRG..K..R....vN..P.K...ATTQta.....anKRGP.KNQRKV..KKESE...dDLNk.....iMFVKTThdytde............dsskhilIGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A078JYI4_BRANA/1-339               ................................................................................................................................................MDDG..G..HRDngrHKtp...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..S.A.LQYREnsmatpsavsnmaaacp.................pgcqmprgvkhihhpqmhH........QHHMLQ..L...S..D.-...-.....-H...AYDE.S.....R....E...M.....D..G.LPTSP.PP..ETA....lDSAK.P.KRG..G..K.....R..V.K...DPKAttk..ttanKRGP.KNPRKV..KKENE...dDLTk.....iMFVKTLdygeee.............tsklvlTGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGDL....RQC.YKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2G2ZYT1_CAPAN/128-216             .........................................................................................................................................skakvpk----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....KPC.YKWGHGGWQSACCITTISMHRLPQISSKYYSRVGGRKMSGRAFSKLLNCLVAQD.YEL.SI.PLDLKD..HWDKNGTNLYSIL-k........................................
A0A1J6IMN7_NICAT/1-282               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SLK.GHLG.LQ.LMS.SVV.....DR...D.T...KP...............FLTRREN.P.I...............-ML.GANGMYH.SRDsivpe......................................................aplshIDYVR-D.SW...IN.H....RD...............................KFL..H..M.F.P..G.N.PY....................................T.T.V.LPE......TS..A.S..H.S.MQMVQ....................................................-........------..Q...P..D.-...-.....--...VTED.V.....R....-...-.....V..N.AEEPS.VK..NES.....GPSK.R.KTG..G..A.....T..P.K...APKA.........KKLK.KGSSGP..KENGT....---.......-PR--V.........................QRAK.PA.KK....SMD.IV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YSF.AN.PIDLRT..HWAKHGTNKFVTIR.........................................
M1CK92_SOLTU/1-311                   ................................................................................................................................................MDGN..G..GMN...IR...................................NWSY.F.-EPt......ptVPK.GHLG.LQ.LMS.SMN.....EK...P.P...-Hfrnih.....dnhhqQ------.-.Qqthqp.....dhptvMAS.TNGGAFH.HHRvcgls......................................................espmpMEYMR-D.SW...VN.Q....KDy............................reKYL..N..V.L.S..A.N.HPyl................................pgY.G.F.LPE......TS..S.A..Q.S.MQMHQ....................................................-........------..-...-..-.Q...P.....NL...VKVE.T.....A....-...-.....P..L.VEEVC.QE..RDNi...gGLAK.K.REA..G..Q.....SqvL.K...SPKP.........KKAK.KATRAP..KDEST....---.......-P--SL.........................PRAR.AP.RK....SAE.VI..I....N.G....I.N...........MDI.SV.IPI.PICSCTGAA....QQC.YRWGCGGWQSACCTTNLSSYPLPMNVKRRGSRIAGRKMSLGAFKKVLEKLASEG.YNF.SN.PIDLKP..HWARHGTNKFVIIR.........................................
A0A1Q3BZ77_CEPFO/1-315               ................................................................................................................................................MDDG..G..HHEngrFKmdyy..........................kgahsPWNM.M.PQHqv....kepNNA.LVMN.KK.IMG.ILV.....ER...D.A...--...............AIRERNM.-.-...............AME.EKKEALL.ARD................................................................QALEQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.M.MER......DN..A.I..A.M.SQYREnainfplggg................................aqrggkrihhA........TYHP-I..D...M..D.-...K.....TR...NTGE.I.....H....V...T.....G..A.FPIST.IP..P--.....EGVK.S.RQA..-..K.....R..T.K...DNKAv.......pSKTL.KSPRKT..KKVGE....DLN......rQVPSDG.........................KKCK.SE.WD....SQD.VG..L....N.L....V.N...........FDD.TT.MPV.PVCTCTGVA....RPC.YKWGKGGWQSSCCTTTVSSYPLPQMPNKRHARVGGRKMSGSVFTRLLSRLAAEG.NDL.SQ.PLDLKD..FWARHGTNRYITIK.........................................
A0A5N6NKY1_9ASTR/1-312               ................................................................................................................................................MDDS..G..HREngrHRidyy..........................kgahpQWNV.M.RQYqv.....kdQSA.MMMN.RK.IMH.IIT.....ER...D.T...--...............AIEERDR.-.-...............ALS.EKKTALE.ERD................................................................MAIQQRD.AA...IA.D....RN...............................---..-..-.-.-..-.-.--....................................D.A.I.RER......DN..A.I..A.A.LRFQEttmythlq....................................rgsgskrgH........HNHHHH..H...H..P.A...Q.....LS...YVVD.P.....R....V...T.....E..A.LPITT.VP..G--.....EPVH.K.SKI..I..R.....E..T.K...SRGSs......gvGSGS.R-SKKQ..KKVGE....DLN.......RNV-TT.........................DGSK.AE.WD....AQE.LG.lM....D.Q....I.S...........FDE.ST.MPI.PVCSCTGVA....RQC.YKWGSGGWQSSCCTTTISVYPLPQMPNKRHSRMGGRKMSGTVFTRLISRLASQG.HDL.SA.PVDLRN..YWAKHGTNRYITIK.........................................
A0A0D3B503_BRAOL/22-229              .......................................................................................lptsnphwfhsyfpvprttgidlsqppqaepaelamlpqqvrlfppptreyihdveq----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....---K.S.STM..L..S.....P..S.K...ALKP.........KPQS.KKRSAP..KTPKK....TL-.......----SI.........................PEIK.RE.KK....NPD.IN..V....V.D....IsS...........FDV.SG.VPP.PVCSCTGVP....KVC.YKWGMGGWQSSCCTISISTFPLPMSTTRPGTRLAGRKMSNGAYVKLLMRLAGEG.YDL.TF.PVDLRN..HWARHGTNKFVTIK.........................................
A0A078I0R5_BRANA/1-320               ................................................................................................................................................MDDG..G..HRDngrHKap...............................qgQWMM.Q.QQQ.........QQQ.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQY-Rdnsmatsrq.................................hqphmhhqhqH........QHHMLQ..L...T..E.-...N.....AY...ETRE.-.....-....-...-.....-..-.TETSP.PT..TGSa...lESAK.P.KRG..-..R.....K..L.K...DPKAaa.....anKRGP.KTQRKV..KKENE...dDLSk.....iMFVKTTtldys..............eeeeeaTGSK.SD.WK....SRE.MVvgL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFNKYLSRLAAEGhHDL.SS.HVDLKD..HWAKHGTNRYITIK.........................................
A0A314L3B5_NICAT/1-302               .......................................................................................................................................mmdhnnfti----..-..---...--...................................----.-.---.........---.----.KT.YMA.IMA.....ER...D.A...--...............AIRERNM.-.-...............ALE.ERKRAFA.ERD................................................................MAMLQRD.AA...LA.E....RN...............................AAI..Q..E.R.D..D.A.IAalrlg.........................essindN.N.V.VPD......SP..G.N..D.T.ESGAK....................................................H........IYNQQQ..M...H..K.T...I.....VE...AAHG.S.....M....E...D.....P..T.AGYLK.GT..DT-.....SEGK.N.PKK..V..R.....R..P.K...ESRH.........NKQA.KIPRQA..KIGAE....SLN.......MQVISTssddwvnlq.......eldsdkeggDMQL.TS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGTP....QPC.YKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQG.YDL.SV.PLDLKD..HWAKHGTNRYSTLK.........................................
M0RWT5_MUSAM/101-260                 ..................................................................................................................................msgncatgkqtret----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....P..T.N...EASP.........DSGG.SAPRRS..KKVGE....DLN.......KQV--S.........................LTKH.HE.WK....SQD.LG..L....N.Q....V.S...........FDD.TT.MPV.PVCSCTGKY....QQC.YKWGNGGWQSACCTTTLSMYPLPVIPSKRHARVAGRKMSGSAFRKLLSRLAAEG.YDL.SL.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0B2SA82_GLYSO/1-282               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LA.GTNGAFH.HRDiggmp......................................................qatypMEYMR-D.AW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VI..EKE....nGTRK.K.RQS..S..K.....V..P.K...SPKA.........KKPK.RGPRAP..KDES-....---.......AP--AV.........................QRAR.IP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAP....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A1U8B5I0_NELNU/1-321               ...........................................................................................................................................mqevp----..-..---...--...................................KW-M.I.PQHqm.....keHHA.LTVK.QQ.IMA.IAA.....ER...D.A...--...............AIQERNM.-.-...............AFS.EKKVALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.IER......DN..A.I..A.A.LEYREsamngsgtptcppg........................cevprgmkhihhpkH........---GYH..P...P..H.L...G.....EA...PHHS.R.....N....I...S.....E..A.FPISA.AA..AAPv..eaFNFN.P.HRV..K..A.....P..T.K...ESKAvlf..kkssKWTT.KSSKKG..KKGGE....DLNkh...asV----Avaks.................hdwkSGPE.SE.WK....GQE.LG..L....N.Q....V.S...........FDE.ST.MPP.PVCSCTGVQ....KQC.YKWGNGGWQSACCTTTLSMYPLPVMPNKRHVRVGGRKMSGSAFNKLLSRLAAQG.HDL.ST.PIDLKD..HWAKHGTNQYITIK.........................................
A0A314UEJ3_PRUYE/400-710             ................................................................................................................................................MDDG..R..QHEngrHKmdyy..........................rgaasPWNM.A.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNA.-.-...............ALT.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................T.A.M.MER......DN..A.F..A.A.LHM-Rdnavnfplgg...............................gvqrgakrlhhP........SNHSVT..L...A..E.-...A.....HY...STKD.M.....H....I...T.....D..A.FPISV.IS..A--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAS.KPSR--..KKVGE....DLN......rQASSDG.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A4D8ZWH3_SALSN/35-355              .............................................................................................................................ektlrgwtsklvlllkmdh----..-..---...--...................................----.-.---.........---.NHLTiKT.FMA.ITA.....DR...D.A...--...............AIREKNM.-.-...............ALE.ERKRAFQ.ERD................................................................MAMLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.QER......DE..A.I..A.S.LRYREssmndntdipdsy.........................gselasggkhiiqyQ........QQQQMR..V...S..E.A...A.....GY...SPKG.N.....L....R...-.....-..-.GNEIV.IA..ETA.....ETPK.P.RRG..R..Q....tK..D.K...EGKA.........TKSA.KPPRAG..KRTAE....AVVk.....eEV---Nsdayngwsn......eqgldseeeyLDKQ.VS.WK....-DN.LG..L....N.Q....I.N...........FDE.SA.MPV.PVCSCTGAP....QPC.YRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFNKLLNRLAGEG.YDF.SS.PLDLKD..HWAKHGTNRYSTLK.........................................
A0A328DRU1_9ASTE/1-305               ................................................................................................................................................MDDG..G..HREngrHKlp...............................qgQWGL.I.QHH.........HPT.M---.KQ.IMA.IMA.....ER...D.G...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................TAILQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LHYHEns................................................mkH........AHHHPH..M...V..E.AaaaA.....YN...NSRD.I.....M....MqhmN.....E..V.MPMSP.AA..PEPp..ppPPPK.M.VRQ..N..K.....R..A.K...EPKPaaat.ssgsKKPS.KPSKRA..KKEGG....EMN.......RQQLVV.........................VSKP.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.SI.MPV.PVCSCTGDL....RPC.YKWGNGGWQSSCCTTNLSMYPLPTVPNKRHARIGGRKMSGSAFNKLISRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A1U8JS95_GOSHI/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.LM-.--A.....ER...D.K...KP...............FIPGRDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appirMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPE......TS..A.T..H.S.MPIWQ....................................................P........------..-...P..P.P...P.....DA...STRD.E.....S....V...I.....G..R.VEEPP.AS..KEG.....VQSK.K.RQV..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IT..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRSARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
A0A3S3N0D9_9MAGN/1-343               ................................................................................................................................................MDDS..G..QREngrHRpdqy..........................kgihaQWTP.L.AHHqm.....kdHHN.HHNT.MK.LMA.IIA.....ER...D.A...--...............AYQERNL.-.-...............ALA.EKKAALA.ERE................................................................MAILQRD.AA...IH.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.VER......DS..A.I..A.A.LEYSReksmngsrtpylp..........................gvpcgtkhghhpqL........VPNPPH..I...V..D.A...A.....PR...HTRE.V.....H....I...S.....D..A.FPISS.IP..D--.....AAAK.P.RQA..K..R.....K..E.T...KAQLs......spMKAS.KPRRKD..KKGAE....DLNk.....qVLG--Vkqlewkgqel.....tggedldkqlSVMK.HG.WK....GQD.LG..L....N.Q....V.S...........FDE.ST.MPV.PVCSCTGIT....RQC.YKWGNGGWQSACCTTTLSLYPLPVMPDKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SL.PVDLKD..RWAKHGTNRYITIK.........................................
W1PSM8_AMBTC/70-360                  ................................................................................................................................................MDSD..A..GLG...FR...................................NWGY.I.DQP.........-LK.QTLG.LQ.LMS.SVA.....DR...D.I...--...............-LAKKSV.-.I...............---.-QTSNYP.TRNpsipec...................................................gvpisssMEFPR-D.NW...MN.Q....RDlp..........................htaKHF..E..M.F.S..G.N.PN....................................F.E.S.KDY......SS..V.L..P.N.PQTN-....................................................-........NNHVLP..I...M..P.-...P.....EM...PQPN.Q.....V....-...-.....M..P.LENPP.PV..KTE.....TQSK.K.KQG..N..R.....T..L.K...VQKP.........KKPK.V--KAP..KEDQN....GA-.......----RT.........................STNK.SG.KK....NWN.AV..I....K.G....I.P...........VDI.AG.IPI.PVCSCTGVA....QQC.YRWGCGGWQSACCTTQMSMYPLPMSQKRRGARIAGRKMSGGAFIKVLEKVAADG.HDL.SK.QIDLKT..HWAKHGTNKFVTIK.........................................
A0A444EYT3_ENSVE/1-271               ................................................................................................................................................MDDDgdG..SLD...IR...................................NWG-.Y.YEQ.........TLK.GNLG.LH.LMS.SVV.....ER...D.T...KP...............LLSNGEF.-.L...............H-R.QCGVSEP.LVA................................................................MDVMG-D.GW...IH.QfsddHN...............................KIL..H..M.L.P..V.N.HHhhh.............................ndsyY.G.A.LPD......PL..N.P..E.T.LQMWQ....................................................-........------..L...P..E.-...-.....TP...PKDD.N.....F....-...-.....P..-.VIDRP.VG..KNE.....TPLK.K.RSK..G..R.....P..Q.K...FPKP.........KKSK.KVA-AS..SNDTT....S--.......--G-SV.........................SLGK.SC.RK....SAE.MV..I....N.G....I.S...........LNI.SG.IPT.PVCSCTGKP....QPC.YRWGAGGWQSVCCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLTEEG.YSL.SN.PIDL--..--------------s........................................
A0A103XB59_CYNCS/170-253             .............................................................................................................................................tsr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....-AS.RKWGNGGWQSSCCTTTMSMYPLPSLPNKRHARVGGRKMSGNVFNKLINRLAAEG.HDL.SN.PVDLKE..HWAKHGTNRYITIK.........................................
A0A164YBE3_DAUCS/1-324               ................................................................................................................................................MDNS..G..HREngrHKpp...............................qgQW-L.M.-QN.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNM.-.-...............ALS.EKKSAMA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.VER......DN..A.I..A.T.LQYREnsmsngnmstcppg.......................chisrgvkhmhhpqqH........VHDQSH..L...S..E.A...A.....SF...GTRD.M.....H....T...T.....E..A.IPTSP.LV..P--.....EPAK.S.KQT..K..R.....T..K.K...ATPN.........KKTP.RPSKKV..KKESE....DVN.......ITKWKGghemsgg..........vndlnrelVVSK.LD.WK....DQD.LG..L....N.Q....V.P...........FDE.TT.MPV.PICSCTGVL....RPC.YKWGNGGWQSSCCTTTLSMYPLPCVPNKRHARIGGRKMSGGAFNKLLTRLAAEG.HDL.SN.PVDLRD..HWAKHGTNRYITIK.........................................
A0A0D2V6T4_GOSRA/1-282               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....ER...D.A...KS...............FIPGRDP.N.L...............M-I.TTNTTFH.QRDpvvs.......................................................eahipMNYVR-D.SW...IA.D....RE...............................KLF..N..M.F.P..A.TtPN....................................Y.A.V.LPE......TS..A.A..H.S.LPILQ....................................................P........------..-...-..-.P...P.....DS...STRD.E.....R....V...A.....S..S.VEELP.AN..KDS.....VEPK.K.RQG..G..A.....V..P.K...MPKA.........KKPK.K----P..KENAN....---.......---SAV.........................QRVK.PA.KK....SII.FK..I....N.G....Y.E...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAVEN.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
J3N0K5_ORYBR/1-319                   ................................................................................................................................................MDDD..A..NMG...MR...................................GWGS.F.FDS.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSATPF.-.L...............-QH.HHHHHHH.PRDsvpnaa...................................................vpadpppINFVRGE.MW...MH.P....QHhp..........................repKVL..H..T.L.A..V.G.HGghvph..........................hdpvaY.G.M.IPG......TH..A.A..H.T.LQMMQ....................................................Q........PDPQPQ..Q...P..P.P...P.....PV...PKEE.C.....I....S...S.....P..M.IEENV.PV..VNEq...pPPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDGA....PN-.......-PP-PA.........................PRRR.GP.KK....AIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A4P1QWB7_LUPAN/1-337               ................................................................................................................................................MDDP..G..HREngrQKpdqy..........................kaaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AVQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYREssltsgsmsscppg........................cqisrgvkhvhhpqQ........QLHHLH..N...M..D.D...A.....SY...GTRD.M.....H....T...T.....D..A.LPEAH.IP..L--.....EAGK.S.RRA..-..K.....R..P.K...EAKSis.....pnKKTS.KTTRKN..KMESE....DLNd.....mMFGKTHewksgqemv......nrgddldkqpLVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A1S3VA46_VIGRR/1-283               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.ATNGAFH.HRDigms.......................................................hatypMEYTR-D.AW...IS.S...yRD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIP....................................................-........------..-...-..-.P...P.....EL...PKEE.R.....A....-...-.....-..-.VEEEP.VV..EKAt...gGSRK.K.RQS..P..K.....V..P.K...SPKA.........KKSK.RGPRVP..KNEN-....---.......APT--V.........................HRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGAA....QXC.YRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGXKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A5A7RCU1_STRAF/39-254              .............................................................................pvddhlhpnpppvmaptnngleylnlfsanlfpanhynsyhhqpsfgispetssarslpiphpinlp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.KND..K..N.....A..P.E...Q---.........RESG.KGPTAK..KKQKK....AR-.......TKAPLA.........................HRAK.AP.KK....RAE.IE..I....N.G....L.H...........LDI.SD.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGLSLYPLPMNTKRRGARIAGRKMSIGAFKKVLEKLTGEG.YDF.SN.PIDLRS..YWAKHGTNKFVTIR.........................................
A0A1U8HWS7_GOSHI/1-280               ................................................................................................................................................MDED..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LH.L--.-LA.....ER...D.K...KP...............FIPARDP.-.N...............NLM.VTTNAFH.PRDcivse......................................................appipMQYVR-D.TW...IS.Q....RE...............................KLF..N..M.L.PpvT.A.PN....................................Y.D.I.LPD......TS..A.T..H.S.MPIWQ....................................................P........------..-...P..L.P...P.....DA...STRD.E.....R....V...V.....G..R.VEEPP.AS..KEG.....VQSK.K.RQG..G..G.....D..P.K...TPKA.........KKPR.K----P..KDNT-....---.......-----N.........................SSVK.PA.KK....SMD.IA..I....N.G....Y.D...........MDI.SS.ISI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEN.YDF.SN.PIDLRT..HWARHGTNKFVIIR.........................................
A0A445K3R1_GLYSO/147-483             ................................................................................................................................................MDDA..G..HREngrHKaadqy.........................ksaqgQW-L.M.-QH.........QPS.M---.KQ.IMA.MIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAYA.ERD................................................................MAYMQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.M.LER......DN..A.I..A.T.LQYREtslssgsmpscppg.......................cqisrgvkhvhhpqqQ........VHHIPN..M...G..D.-...A.....SY...NTRE.M.....H....T...T.....E..V.LPAAP.IP..S--.....ETGK.S.RRA..-..K.....R..P.K...EPKSap.....pnKKTS.KPSKKV..KKESE....DLN......nMFGKAHewksgqemv......nggddlnkqlAVSK.AD.WK....GQD.LG..L....N.Q....V.A...........YDE.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAES.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A151REV5_CAJCA/1-280               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEP.........AIK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LS.GTNGAFH.HRDigmh.......................................................qatypMEYMR-D.AW...ISsQ....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EM...PKEE.K.....P....-...-.....-..-.VEEAP.VV..EKP....nGTRK.K.RQG..P..K.....V..P.K...SPKA.........KKPK.RGPRTP..KDENT....---.......-PS--V.........................QRAR.AP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A6A2ZHN1_HIBSY/1-309               ................................................................................................................................................MDGA..G..KQEngrYKldqy..........................kgappPWNM.M.PQHhm....keqSNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AIS.ERKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.Y.IER......DN..A.L..A.V.LQYQEnamsfpig....................................sgiqrggtR........MHPSCH..S...T..E.M...G.....ET...LHCE.K.....H....V...T.....D..A.IPLST.VT..SEG.....KSCP.V.---..-..K.....R..T.K...VNKA.........ASQ-.KPPRKI..KKVAE....GLN......rQAGTEV.........................RKCK.SE.WN....AQD.IG..L....N.M....V.N...........FDE.TT.VPV.PVCTCTGVP....RHC.YKWGSGGWQSSCCTTTMSSYPLPQLPNKRHARVGGRKMSGSVFTKLLSRLAAEG.QDL.SI.PVDLKT..YWARHGTNRYITIK.........................................
V4KPA5_EUTSA/160-212                 ...........................................................................................................................................pvkkr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.-------------------------------VISGRKMSQGAFKKVLKKLASKG.YSF.GN.SIDLKS..PWARHGTNKFVTIR.........................................
A0A0D2MA32_GOSRA/1-326               ................................................................................................................................................MDDG..G..HRE...NG...................................RLK-.A.DQY.........---.RTAQ.GQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREnslasgnisscppg.......................fhisrgvkhmqhpqqH........VHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....A...S.....D..V.LPVTP.GT..S--.....EAAK.S.RQG..-..K.....R..A.K...EAKVia.....snKKAT.KPPKKV..KQENE....DSDk.....lMSGKSHewkggqdvg......gagddlnkqlVTTK.SD.WK....GKD.LG..L....N.Q....V.V...........FDD.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A2I4DLJ5_JUGRE/1-280               ................................................................................................................................................MDGD..N..SLR...MR...................................HWG-.Y.YEP.........-AR.SHLG.LQ.LMS.SIP.....E-...-.-...KP...............LIGGRNA.-.V...............AMA.SGNGAFQ.HRDlgvs.......................................................hsgfpMEFVR-D.AW...IN.Q....RE...............................RYI..N..V.L.P..G.Y.PG....................................Y.G.G.LPE......TS..S.A..H.H.VDMVL....................................................-........------..-...-..-.P...P.....DL...PKEE.K.....T....-...-.....V..S.AEETG.IE..KEN.....GPIK.K.RRA..V..K.....A..P.K...SPKE.........KKTK.RAPRPP..KTGSG....TS-.......----AP.........................RART.AT.KK....TTE.IA..I....N.G....V.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGSGGWQSACCTTAMSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAGEG.YNF.TN.PINLRT..YWAKHGTNKFVTIR.........................................
A0A076L2D6_TOBAC/1-327               ................................................................................................................................................MDDS..G..HRDngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssisgggqiarg............................vvkhmhhpqqhvH........VHHQPH..M...G..E.-...P.....TY...NPRD.M.....H....V...N.....E..S.MPVSP.VA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAmt.....gsKKTP.KASKKV..KRETE....DLNq.....tTFGKSQewkgaqemg......dasddlnrqlAVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
A0A5E4EI63_PRUDU/1-278               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMA.....ER...D.T...KA...............FVPGRDP.A.V...............-MV.SSNGAFH.PRDcvvs.......................................................dapvpLNYMR-D.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................Y.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....DS...SRDE.R.....V....-...-.....A..R.IEEPV.AN..KEG.....GPSK.K.RGG..G..G.....A..P.K...TPKV.........KKPR.K----P..KDNNN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRG..HWARHGTNKFVTIR.........................................
A0A5N6R8F3_9ROSI/1-337               ................................................................................................................................................MDDG..A..HREngrHKadqy..........................kaaqsQWL-.M.-QN.........QPT.M---.KH.IMN.IMA.....EK...D.A...--...............AIQERNL.-.-...............ALS.EKKMAIT.ERD................................................................MAFLQRD.TA...IE.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnslnngnmspcppg.......................cqisrgvkhmhhpqqH........IHHLPH..K...G..E.-...A.....SY...NARE.M.....H....T...S.....D..V.LGISQ.VA..S--.....EAAK.S.RRA..-..K.....R..T.K...ETKGts.....sdKKAS.KPQRKF..KRESD....DLNk.....mMFGKTHewkggqdmg......gggddlnrqtSGSK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PVCSCTGML....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2H5PHJ0_CITUN/132-423             ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TMPm...vDR...D.T...KP...............FLPGRDP.N.I...............-MI.GANGAFH.PRDcvvs.......................................................easipMNYMR-D.SW...IS.Q....RD...............................KFL..N..M.L.P..S.N.PT....................................F.G.V.LPE......TS..G.A..H.S.LQMLQ....................................................P........PPNMSR..D...D..R.L...A.....PD...RVAP.D.....R....I...V.....P..K.VEEPV.VK..TEG.....APLK.K.RQG..G..G.....A..S.K...TPKA.........KKPK.K----P..KDNNG....---.......---TAV.........................QRVK.PA.KK....SMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
BPC1_ARATH/1-283                     ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPaa.....asSFK.GNLG.LQ.LMS.TI-.....DR...N.T...KP...............FLPGRES.N.L...............M-I.GSNGSYH.SRE................................................................QDMNY--.SW...IN.Qp..kDN...............................KFF..N..M.L.P..I.S.TPs..................................yS.N.V.LSE......TS..G.S..N.S.IQMIH....................................................Q........----PV..L...N..S.-...-.....-S...RFEE.N.....P....I...P.....P..P.APCEE.QT..G--.....KKRK.M.RGS..I..A.....T..P.T...VPKA.........KKMR.K----P..KEERD...vTNN.......NVQQQQ.........................QRVK.PV.KK....SVD.LV..I....N.G....V.S...........MDI.SG.LPV.PVCTCTGTP....QQC.YRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEG.YSF.GN.AIDLKS..HWARHGTNKFVTIR.........................................
A0A0D9XHB8_9ORYZ/1-338               ................................................................................................................................................MDDD..G..NIT...LR...................................GWGG.F.YEPp.......pPPP.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSASPF.M.H...............HHA.HQHVPHH.QHHarecggaggngga.....................................pnggmppteapsmnMNFVRND.MW...MH.P....QHhs..........................retKVL..H..T.L.N..V.G.HGghiahs.......................ahhdpvgY.G.M.IPG......TH..S.G..H.T.LQMMQ....................................................Q........PESQPQ..P...Q..P.-...P.....PP...PKEE.C.....I....S...S.....P..L.IEENV.PV..ISE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRP.........KKPK.K-PAAP..REDG-....---.......APNPPA.........................TRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
A0A1J6J273_NICAT/1-327               ................................................................................................................................................MDDS..G..HRDngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssisgggqiarg............................vvkhmhhpqqhvH........VHHQPH..M...G..E.-...P.....TY...NPRD.M.....H....V...N.....E..S.MPVSP.VA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAmt.....gsKKTP.KASKKV..KRETE....DLNq.....tTFGKSQewkgaqemg......dasddlnrqlAVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
A0A6G1DNZ7_9ORYZ/1-324               ................................................................................................................................................MDDD..G..GLS...IR...................................NWG-.F.YET.........-MK.GNLG.LQ.LMS.SVA....aDR...D.T...KP...............LLQNGTF.L.Q...............HHG.HHNAPNH.PRDcggggtsgg..............................................lpseppsihMDFARND.AW...MH.P....SQhqh........................qreqKVL..H..A.L.P..V.G.PAghighpghp.................ghsvhhhptgY.G.M.MPE......AH..G.L..H.T.LQMMQ....................................................P........-----Q..E...P..P.P...-.....--...PKEE.H.....M....P...E.....P..L.IEEHS.VV..RKE.....PPTK.K.RQQ..-..R.....Q..P.K...TPRP.........KKPK.K-PAAP..REDG-....---.......APNGHA.........................PCRR.GP.KK....VVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGSP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.AN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A444ZSL5_ARAHY/1-275               ................................................................................................................................................MDDD..-..MLN...MT...................................NWG-.Y.YEP.........FKG.GHLG.LQ.LMP.GMT.....DR...D.T...KP...............FMPGRDP.-.T...............MLV.NTNGTFH.PRDcvvs.......................................................eaqmpINYVR-D.SW...IS.Q....RD...............................RFF..N..M.Q.P..T.N.PN....................................Y.P.V.LPE......TS..A.A..P.-.TQITQ....................................................P........------..-...-..-.-...P.....DT...SRDE.K.....A....-...-.....D..I.VEETV.-Q..KEG.....VQPR.K.RQG..R..V.....A..S.T...TPKA.........KKPR.K----P..KDNS-....--N.......AP----.........................VQRS.KP.MK....TIE.FV..I....N.G....I.D...........MDI.SS.LPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSTYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.GN.PIDLRN..HWARHGTNKFVTIR.........................................
W9RR46_9ROSA/1-337                   ................................................................................................................................................MDDG..G..HREngrHKgdqy..........................ktaqgQW--.M.MQH.........QPS.M---.KQ.IMA.LMA.....ER...D.A...--...............AIQERNL.-.-...............ALA.EKKAALA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.V..A.T.LQYREnslsngnmsscppg.......................cqisrgvkhmhhpqtH........AHHMQH..V...N..E.-...G.....SY...ATRE.M.....N....T...T.....D..S.LPISP.DA..S--.....DAAK.S.RRG..-..K.....R..M.K...EAKPvs.....pnKKAS.KPPRKL..KRESE....DLNk.....mAFGKAQewksgqgmv......ggsddfnkqlVVSK.SD.WK....GQD.LG..L....N.Q....V.S...........YDE.ST.MPA.PVCTCTGVI....RQC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A0D3A0U6_BRAOL/1-282               ................................................................................................................................mesdgrynpdyykegt----..-..---...HS...................................VWNT.M.PNHhqt..kedqHNA.LVMN.QK.IMS.ILA.....ER...D.A...--...............ALKERDD.-.-...............ALA.AKQEALA.ARD................................................................EALDQRD.KA...LS.L....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.LER......DS..A.L..S.A.LQF-R....................................................-........-EHNLN..Y...I..L.-...S.....RA...KLGS.S.....H....L...S.....N..P.SPLST.IP..HEA.....APSK.R.KKK..-..-.....-..-.-...-RKP.........ET--.--RSKG..KRVGE....DLN......hHVASPG.........................KKCR.KD.WD....SNV.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RHC.YKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQG.HDL.SS.PVDLKD..YWARHGTNRYITI-m........................................
A0A2I0WCW4_9ASPA/1-299               ................................................................................................................................................MDDD..G..TLG...IQ...................................NWGG.Y.YRA........pPLK.GNLG.LQ.LMP.SVG.....ER...D.T...KP...............FFSGLGS.G.G...............GYI.QR-----.--Ecevtg......................................................psampMGFAR-N.IW...YN.S...nRDs.............................sKML..N..V.F.H..G.N.HQeqshsy.......................gsllpeaT.A.G.TVS......GT..A.V..H.T.LQMLQ....................................................N........VEVPLK..E...E..R.-...-.....--...--VP.A.....I....E...E.....P..A.APQQE.VV..S--.....LNKR.S.KGQ..G..R.....P..S.K...ASKP.........KKDK.K-ATTP..REES-....-SN.......PF----.........................GRGR.SA.KK....TMD.MV..I....N.G....I.D...........LDL.SG.MPA.PVCTCTGRP....QQC.YRWGAGGWQSACCTTIISIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.QDF.SS.PIDLKP..FWAKHGTNKFVTIR.........................................
A0A6A3A3B9_HIBSY/1-310               ................................................................................................................................................MDGA..G..KQEngrCKldqf..........................kgapsPWNM.M.PQHhm....keqSNA.LVMN.KK.IIS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AVS.ERKEALA.ARD................................................................EALQLRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.Y.IER......DY..A.L..A.V.LQYREnamnfpig....................................sgiqrggrR........MHPSYH..S...T..D.M...G.....ET...LNCE.K.....H....V...T.....D..A.IPVST.IT..S--.....EEGK.S.CPV..-..K.....R..T.K...VNKA.........VSPK.Q-PRKI..KKVTE....GLN......rQAGTEV.........................RKCK.SE.WN....GQD.IG..L....N.M....V.N...........FNE.TT.MPV.PVCTCTGVP....RHC.YKWGSGGWQSSCCTTTMSSYPLPQLPIKRHARVGGRKMSGSVFTKLLSRLAAEG.QDL.SI.PLDLKT..YWARHGTNRYITIK.........................................
BBRB_ORYSJ/1-341                     ................................................................................................................................................MDDD..A..SMS...IR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aER...D.T...KQ...............LLSGSP-.F.L...............HHQ.HQQHVPH.HHHqphhprdcgangnang................................gamppppateappsmpMNFARSD.MW...MH.P....QQqqqhh.....................hprehKAL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......--..-.T..H.T.LQMMQ....................................................Q.......qTEPQLQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SAAP..REDGA....PPN.......APA---.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PICSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A078FIC2_BRANA/180-337             .............................................................................................................................kpeagevdeslkrrqcggg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....Q..R.A...DPKA.........KKER.K----L..-----....KDN.......IVPRM-.........................QRER.SPlRK....SIE.MV..I....N.G....V.T...........IDI.GC.LPV.PVCSCTGLS....QQC.YRWGCGGWQSACCTTNVSMYPLPMNTKKRGARIAGRKMSQGAFKKVLEKLSADG.FDF.SS.PIDLKS..HWAKHGTNKFVTIR.........................................
A0A1U7YRN9_NICSY/1-313               ................................................................................................................................................MDDG..G..RRE...SRrhrmdc.......................skgghaPWNV.V.PPYqm.....kdQEA.FIMN.TK.IRM.LFA.....ER...D.A...--...............AVEERDR.-.-...............AVI.EKNTVLT.ERD................................................................LAIQQRD.TA...IA.E....RD...............................---..-..-.-.-..-.-.--....................................T.A.I.KER......DN..A.I..A.A.LHFQEstmngtlgc..................................rtrgtkrpnQ.......tKNHCDN..S...T..D.-...S.....VC...INRD.V.....P....L...T.....D..A.FPISA.IS..S--.....EVAK.A.LQV..-..K.....R..T.K...GNKGm.......sRKSA.KSPRKT..KKVSE....DLN.......RHLT-T.........................DGSK.AE.WD....AQD.LG.sI....N.Q....I.K...........FDE.SS.MPI.PVCTCTGIP....RQC.YKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVG.HDL.SM.PIDLKT..YWAKHGTNRYITIK.........................................
A0A6A2WF19_HIBSY/1-336               ................................................................................................................................................MDDG..G..HREngrLKtdqy..........................raaqgQW-L.M.HQS.........--S.M---.KQ.IMA.LMA.....ER...D.A...--...............VIQERNL.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.AER......DN..A.I..A.N.LQYREsslssgnmssclag.......................fhmsrgvkrmqhpqqN........IHHLPH..I...S..E.-...V.....PY...NSRE.M.....H....S...T.....D..T.LPVTP.GT..S--.....EAAK.S.RRG..-..K.....R..A.K...EAKVia.....pnKKAS.KPPKKV..KQENE....DLNk.....iMSCKSHewkgaqdvg......gagddlnkqlVTTK.PD.WK....GKD.LG..L....N.Q....I.V...........FNE.ST.MAP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTALSMYPLPAVPNKKHARIGGRKMSGSAFNKLLTRLAAEG.YDL.SN.PVDLKH..HWAKHGTNRYITIK.........................................
A0A2I4G8A5_JUGRE/1-280               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.TMA.....DR...D.T...KH...............FLPGRDPnS.I...............MVN.TANGTFH.PRDcvvs.......................................................eapvpMNYVR-D.SW...AN.Q....RD...............................KFL..N..M.L.P..A.N.PN....................................Y.G.V.LPE......TS..G.A..H.S.LQILQ....................................................P........-----Q..D...P..-.-...-.....SM...--DE.R.....M....-...-.....V..K.VEEPL.VK..SEG.....GQMK.K.RQS..G..G.....A..P.K...TPRA.........KKPR.K----P..RDNNN....---.......---PSV.........................QRVK.PV.KK....NMD.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSIYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAADG.YNF.SN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A0E0A4I0_9ORYZ/1-331               ................................................................................................................................................MDNL..G..HREngrQRpdqy..........................kglhtQW-M.M.PQTq.......rHLK.DHQS.MN.LLA.LMN.....DR...D.N...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFTQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.V.VER......DN..A.L..A.A.LELARtnglnmnngngfpqg.....................slsgsknihhhdqlshA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIST.AP..G--.....SAGK.A.KRP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKPSG...dWKNv.....gMSGCGDds....................ahaSVMK.NE.WK....DQN.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGKL....RQC.YKWGNGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A540LLM1_MALBA/35-313              ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.T...KP...............FVPGRDP.T.V...............-MV.SANGAYH.PRDcvvs.......................................................daqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN....................................YgA.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...P..-.-...-.....EP...SRDE.R.....V....-...-.....G..R.IEEPV.VP..KEV.....GTSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----A..KDST-....---.......--NPSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PICSCTGVP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRF..HWAKHGTNKFVTLR.........................................
A0A078GAI9_BRANA/1-262               .........................................................................................................................................mmpqhqi----..-..---...--...................................----.-.KEQ.........HNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVKERNE.-.-...............ALA.AKQEALA.ARD................................................................EALQQRD.LA...IS.E....RD...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......EN..A.L..T.A.LQH-R....................................................-........ENHLNY..I...L..D.-...-.....-C...AKRG.G.....Y....Q...T.....C..F.TEETH.LP..NPS.....PLST.-.--I..P..H.....E..P.P...NTKR.........KKDR.K---RK..KAGGE....DLN......rQLASPG.........................KKCR.KD.WD....CND.VG..L....N.L....V.T...........FDE.TT.MPV.PMCTCTGTA....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEG.HDL.SS.PVDLKD..YWARHGTNRYIIIK.........................................
A0A1U7Y9Y3_NICSY/1-327               ................................................................................................................................................MDDS..G..HRDngrHKpp...............................qgQW-L.M.-QH.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.T.LQYREssisgggqiarg............................vvkhmhhpqqhvH........VHHQPH..M...G..E.-...P.....TY...NPRD.M.....H....V...N.....E..S.MPVSP.VA..P--.....EPTK.P.RRN..-..K.....R..A.K...EPKAmt.....gsKKTP.KASKKV..KRETE....DLNq.....tTFGKSQewkgaqemg......dasddlnrqlAVSK.PD.WK....DQD.LG..L....N.Q....V.A...........FDE.TT.MPV.PVCSCTGVL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKN..HWAKHGTNRYITIK.........................................
A0A5B6V2U8_9ROSI/1-256               ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.-MS.SMV.....ER...D.A...KS...............FIPGRDS.N.L...............-MV.TTNTAFH.QQDpvvs.......................................................eahipLNYVR-D.SW...IA.D....RE...............................KIF..S..M.F.P..A.TtPN....................................Y.A.V.SLE......TS..A.A..Y.S.LPILP....................................................-........------..-...-..P.S...P.....DS...STRD.E.....R....V...A.....S..S.VEEPP.SN..KEG.....VEPK.K.RQG..G..A.....A..P.K...MPKA.........KKPK.K----P..KENAN....S--.......----TV.........................QRVK.SA.KK....SIV.FK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTA....QQC.YRWGFGGWQSACCTTNVSMYPLPMSTKRRSARIAGRKMSQGAFKKVLEKLAAEN.YNF.GN.PIDLRS..HWARHGTNKFVTIR.........................................
A0A565APJ2_9BRAS/1-273               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMS.NI-.....DR...N.T...KP...............FLPGRDP.N.L...............M-I.GPNGSYH.PDP................................................................-PIHMSY.NW...IN.Q...qKD...............................KFF..N..M.L.P..V.T.NTp.................................nyG.N.V.LPE......TS..S.A..P.S.MQMNL....................................................-........-HHHHH..P...T..E.D...N.....PV...----.-.....-....-...-.....-..K.CEEEI.VQ..T--.....--KK.R.KPN..S..K.....A..G.S...TPKT.........KKPR.K----P..KDENS....NSN.......T---NV.........................SRVK.PA.KK....SVD.LV..I....N.G....V.S...........MDI.SG.IPV.PICTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A2Z7CHN4_9LAMI/1-280               .............................................................................................................................................mde---D..-..--S...LR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMS.SMV.....DR...H.T...KP...............FLSGHDN.P.L...............-MV.PPNGTYH.PRDrvaae......................................................lpsthMDYVR-D.SW...IN.H....RE...............................KFL..H..M.F.P..T.N.TF....................................N.P.V.LAE......TS..G.A..H.H.AMP--....................................................-........---ATH..Q...P..D.P...-.....--...-TKD.T.....E....-...-.....S..N.IEEPS.AK..KGH.....VPAK.K.RPA..P..A.....A..P.K...TTKS.........KKPR.K-GPVP..KENGR....S--.......----SV.........................HRAK.TS.KK....NMD.VV..I....N.G....V.D...........FDI.SG.IPI.PVCSCTGTS....QQC.YRWGFGGWQSACCTMTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEG.YDF.TN.SIDLRT..YWAKHGTNKFVTIR.........................................
A0A0A0KLI8_CUCSA/1-277               ...............................................................................................................................................m-DGD..-..ALN...MR...................................NWG-.Y.YEP.........SLK.AHLG.LQ.LMS.TIG.....ER...D.V...KH...............FMPGRDP.-.S...............AIV.NMNAAFH.PREsvvs.......................................................eapvaTNWAR-D.GW...IN.H....RD...............................KLF..N..V.L.S..P.N.TS....................................Y.S.L.LAE......TS..A.A..Q.P.LQILQ....................................................P........------..-...-..-.-...L.....DT...SRDE.M.....V....-...-.....L..K.IEEPP.VK..KGT.....KQPK.K.RQN..G..G.....A..P.K...TPKP.........KKPR.K----P..KNNDP....S--.......-----V.........................QQVK.AP.KK....KME.LV..I....N.G....F.D...........MDI.SS.IPI.PVCSCTGTP....HQC.YRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKLAAQG.YNF.SN.PIDLRS..HWARHGTNKFVTIR.........................................
M4DDD6_BRARP/1-305                   ................................................................................................................................................MDDG..G..HRDngrHKap...............................qgQW-M.M.QHQ.........QPS.M---.KQ.VMS.IIA.....ER...D.T...--...............AIQERNL.-.-...............AVS.ERKSAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQY-Rdnsma.........................................tsrqhqPh......mPHHMLQ..L...T..E.N...N.....AY...ETRE.I.....G....T...S.....P..P.PTTGS.AL..A--.....-SAK.P.KRG..-..R.....K..V.K...EPKAa......anKRGP.KNQRKV..KKENE...dDLSk.....iMS--LDyse..................eeeaTGSK.SD.WK....SEE.MMvrL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SS.PVDLKD..RWAKHGTNRYITIK.........................................
A0A287PD58_HORVV/13-269              .................................................................................................................................srrlftwtlcamrpg----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-----CT.PRS................................................................INISQHQ.HQ...HS.R....EL...............................KVL..N..A.V.P..V.G.PAphighpgh....................avhhhptgF.G.M.MPD......AR..G.A..H.T.LQMMQ....................................................P........-----Q..E...P..P.-...-.....-V...PDEE.K.....I....T...P.....P..L.VEDHS.VV..GSK.....PPVK.K.RQQ..G..R.....Q..P.K...VPKP.........KKPK.K-DATP..GEDG-....---.......APKARA.........................PRSR.GP.LK....PVE.MV..I....N.G....I.D...........FDI.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTIR.........................................
A0A314KWS9_NICAT/1-333               ................................................................................................................................................MDDS..G..HHDn.gRRkp..............................pqgQW--.F.MQH.........QPS.M---.KQ.IMA.IMG.....ER...D.A...--...............AIQERNL.-.-...............ALS.EKRAALA.ERD................................................................MAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.I.MER......DN..A.I..A.T.LQYREnsmnsgnmspcppg.......................cqiahevkhmhhpqqH........VHHQPQ..L...G..E.-...P.....TF...NHSD.M.....H....M...N.....E..S.SLLSS.PA..A-P.....EPTK.S.RRN..-..K.....R..S.K...EAKSvt.....ssKKTS.KPSTKV..KKEGE....DLNt.....tMLDESQewngaqemg......ggsddvnrqlGVSK.PD.WK....DQG.LG..L....N.Q....V.S...........FDE.ST.MPV.PICSCTGVL....RPC.YKWGNGGWQSSCCTNNLSMYPLPTLPNKRHARIGGRKMSGSAFTKLLSRLAAEG.HDL.SN.PVDLKD..NWAKHGTNRYITIK.........................................
A0A164SP12_DAUCS/1-146               ................................................................................................................................................MD-D..G..GLN...LR...................................NWNM.Y.GQH........yNKP.GNLN.LH.LFP.SLE.....RH...V.Q...NP...............FLGRESS.-.V...............LLN.HNGGAFH.PSLsks..........................................................tahMDPG-VN.NW...AH.P....RD...............................RYV..Q..M.I.S..A.N.SG....................................L.A.A.FHE......HP..G.A..H.S.MNMLQ....................................................Q........QEHSES..P...K..D.-...A.....RV...CLED.M.....H....V...K.....Q..E.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------ggspvkkkkrtdvnme.........................
A0A2R6R045_ACTCC/1-313               ................................................................................................................................................MDDS..G..HREngrHKpp...............................qgQWF-.M.CQP.........--S.M---.KQ.IMV.VMA.....ER...D.A...--...............ATQERNL.-.-...............AFS.EKKAALA.ERD................................................................LAILQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MAR......DN..A.I..A.T.IQYREnamsrgnmspqcppg......................cqispgvkhmhhpqqN........LNHKPH..M...D..E.-...V.....LH...DSGD.M.....H....T...S.....D..G.LSMSP.VA..S--.....EPTK.L.RQA..-..K.....Q..T.K...EVKPrt.....pnKKPS.ESSKKV..KREDD....PSK......mILGKSRg.......................gNMSK.PD.WK....GQD.LG..L....N.Q....I.A...........FDE.TM.MPG.PVCSCTGFL....RPC.YKWGNGGWQSSCCTTTMSMYPLPAVPNKRHARIGGRKMSGSAFSKLLSRLAGEG.H-L.SN.PVDLKD..HWARHGTNRYITIK.........................................
A0A2K3PDZ8_TRIPR/1-343               ................................................................................................................................................MDDR..E..NGR...HKadqy..........................ksaqgQW-L.M.QQH.........QHQ.HPSM.KQ.IMA.IMA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAALA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.MER......DN..A.I..A.T.LQFREnalanggmsscppgc.....................qisrgvkhihhlpqqqQ........VNHLPT..M...G..D.-...P.....SY...GTRE.L.....H....T...T.....N..A.LPEAP.IP..S--.....EVGK.P.PRR..A..K.....R..P.K...ENKSvs.....pnKKTP.KTTRKV..KKEGE....DLNk.....tMFANDEalewkssqei....inggddlnkqlPVSK.AD.WK....PQD.FA..L....N.Q....V.A...........YDD.ST.MPA.PVCSCTGVL....RQC.YKWGNGGWQSACCTTNLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG.HDL.SH.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2U1MXR1_ARTAN/1-285               ........................................................................................................................................mdhnhlsi----..-..---...--...................................----.-.---.........---.----.KT.FMA.IMA.....ER...D.A...--...............AIRERNL.-.-...............ALD.ERKRAFA.ERD................................................................LAMLQRD.AA...LA.E....RN...............................---..-..-.-.-..-.-.--....................................S.V.M.QER......DE..A.I..A.T.LRF-Rgnfmnenimstpevp......................enipscgskrgfsdeE........MDHMFE..M...P..E.-...D.....SC...TKRE.P.....L....K...M.....D..D.TYQVP.P-..---.....KNTK.P.RKV..T..R.....K..A.K...SPKKg......grKRGD.SVKMKP..DFGGN....DE-.......----SS.........................DDSQ.LE.AW....KDE.LG..L....N.Q....V.N...........FDE.SA.MPV.PVCSCTGAP....QPC.YRWGSGGWQSACCTTTMSMYPLPQLANKRYSRVGGRKMSGGAFTKLLTRLSSEG.YDL.SS.QLDLKD..HWAKHGTNRYSTVK.........................................
A0A2R6Q2Y5_ACTCC/1-283               ................................................................................................................................................MDDD..G..-LN...MR...................................NWG-.Y.YEP.........SFK.AHLG.LQ.LMS.SVG.....ER...D.T...KP...............FLSGREH.A.H..............aGVL.SANGGYH.PRDcvvs.......................................................etplhMDYVR-D.SW...VN.N....RD...............................KFL..N..M.L.P..G.N.SN....................................Y.A.M.YPE......PS..A.S..H.S.MHILQ....................................................P........------..-...-..-.-...P.....DL...SKDG.R.....V....-...-.....-..G.IEDPN.IV..KEG.....SSSK.K.RTG..I..N.....T..P.K...APKV.........KKAK.KGRSLL..NENGD....S--.......----SI.........................QRVK.PT.KK....NVD.VV..I....N.G....I.D...........MDI.SG.IPV.PVCSCTGSP....QQC.YRWGSGGWQSACCTTTISIYPLPMSTKRRGSRIAGRKMSMGAFKKVLEKLAAEG.YDF.CD.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A2T7E3F9_9POAL/1-328               ................................................................................................................................................MDNL..G..HREngrQRpdqf..........................kavhtQW-M.M.PQL.........--K.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqgp....................plngtknihhhdqlshV........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....E..A.YPIAT.AP..GSI.....GKGK.K.SRK..N..N.....S..Q.A...S--Plkrp.sgvlRKTK.KAACGW..KNGGM....SGG......gADSTRA.........................SVMK.NE.WK....DQD.LG..L....N.Q....V.P...........FDE.ST.MPA.PACSCTGEL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.ST.PVDLKD..HWAKHGTNRYITIR.........................................
A0A3Q0HT39_PHODC/25-375              ................................................................................................................................................MDDG..G..QREnvrHKtdqy..........................kqvhaQW-M.M.PQH.........QLK.ENHT.IK.IMA.IMA.....ER...D.N...--...............AIQERNI.-.-...............ALA.EKKAALA.ERD................................................................MAILQRD.AA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DN..A.I..A.A.LQYARenglngngasacppgct..................aprgtkhihhhqqqhlqH.......iHPSPPQ..L...S..D.A...P.....YN...HTRE.M.....H....I...T.....E..A.FPIST.AS..E--.....SIAK.G.RKA..K..R.....P..R.K...ETKAqn....spsKKSS.KSPRKS..RKGGG...eDLNr....qvT--I-Akpasewrnei....rggddlnkqvaLTKH.QE.WK....GQD.LG..L....N.Q....V.T...........FDE.AT.MPT.PVCSCTGKY....QPC.YKWGNGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFRKLLSRLAAEG.HDL.SQ.PVDLKD..NWAKHGTNRYITIK.........................................
A0A061DZM0_THECC/2-285               ...........................................................................................................................................mpqhh----..-..---...--...................................----.M.KEQ.........NNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AIRERNI.-.-...............AIS.EKKEALA.ARD................................................................EALQQRD.KA...LA.E....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MDR......DN..A.L..A.V.LQYREnamnfplg....................................ggiqrggkR........MHPTYH..S...T..D.V...G.....ET...LNSE.M.....H....V...T.....D..A.LPVST.IA..C--.....EEGK.S.RPV..-..K.....R..T.K...ENKA.........VSSK.-SARKV..KKVAE....DLN......rQAGTEV.........................KKCK.SE.WN....GQD.IG..L....N.M....V.N...........FDE.TT.MPV.PVCSCTGVP....RQC.YKWGNGGWQSSCCTTTMSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEG.QDL.SI.PLDLKN..YWARHGTNRYITIK.........................................
BPC4_ARATH/1-296                     ................................................................................................................................................MENG..G..QYD..nARfkpdy........................fkgaqsMWNM.I.PQHqi....keqHNA.LVMN.KK.IMS.ILA.....ER...D.A...--...............AVHERNQ.-.-...............AVS.AKKEAVA.ARD................................................................EALQQRD.KA...LS.E....RD...............................---..-..-.-.-..-.-.--....................................K.A.L.IER......DN..A.Y..A.A.LQHHE....................................................Nsln..falSGGKCV..D...G..D.-...D.....CF...GIGE.P.....H....K...L.....E..V.FPLST.IP..P--.....EVTN.T.KVV..N..K.....R..K.K...ENK-.........----.QGLSKV..KKVGE....DLNr.....rVPAP-G.........................KKSR.TD.WD....SQD.VG..L....N.L....V.T...........FDE.TT.MPV.PMCSCTGST....RQC.YKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLSAEG.YDL.SC.PVDLKD..YWARHGTNRYITIK.........................................
A8MQG2_ARATH/1-282                   ................................................................................................................................................----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtapaanmsacppgc................qisrgvkhlhhphmhhhhQ........QHHIPQ..L...T..E.-...N.....AY...ETRE.M.....E....P...N.....D..G.LPTSP.PA..GST....lESAK.P.KRG..K..R....vN..P.K...ATTQta.....anKRGP.KNQRKV..KKESE...dDLNk.....iMFVKTThdytde............dsskhilIGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A4D8ZMS6_SALSN/1-283               ................................................................................................................................................MDDD..S..---...LR...................................NWG-.Y.YEP.........PLK.G-LG.LQ.LMS.SLA.....ER...D.T...KP...............FLAGRNN.P.V...............-MV.SANGAFH.HRDcvvte......................................................ppvshMDYVR-D.SW...IN.H....RE...............................KFL..H..M.F.P..G.N.PYs..................................sS.S.V.LAE......SS..G.S..HhA.MQQ-Q....................................................-........------..-...Q..E.-...-.....--...TTKD.I.....-....-...K.....P..S.LEELA.VK..KEN.....GSPK.K.RAA..A..A.....T..P.K...TPKA.........KKPR.K-SPAP..KENGN....GNG.......--NPSA.........................QRAK.TA.KK....NVE.VV..I....N.G....M.D...........MDI.TG.IPI.PVCSCTGSP....QQC.YRWGCGGWQSACCTTTISMYPLPMSQKRRGARIAGRKMSQGAFKKVLEKLATED.YNF.AN.PIDLRT..YWAKHGTNKFVIIR.........................................
A0A397YW00_BRACM/1-269               ................................................................................................................................................MDDD..G..---...FR...................................NWG-.Y.YEPa......aaTFK.GNLG.LQ.LMP.SI-.....DR...N.T...KP...............FLTGRDP.N.L...............MIG.QNGPYHH.HPE................................................................PPINMSY.NW...IN.Q...hKD...............................KFF..N..M.L.P..V.T.TTp.................................nyG.N.I.LPE......TS..S.A..P.S.MRHHQ....................................................-........------..T...T..D.-...E.....YP...GTHE.Q.....-....-...-.....-..-.VEEII.--..Q--.....-TNK.K.RKP..-..-.....N..T.K...PGAT.........TKAK.K-PRKP..KEESD....-K-.......-----N.........................IKVK.PA.KK....SVD.FV..I....N.G....V.N...........MDI.SG.LPV.PVCTCTGAP....QQC.YRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDG.FNF.GN.PIDLKS..HWARHGTNKFVTIR.........................................
A0A397Y1R2_BRACM/1-297               ................................................................................................................................................MDDG..G..HRDngwHKas..............................hgkQW-M.M.QQHq.......pQQH.QPSM.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAVA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..A.A.LQY-R....................................................D........SSMSTS..R...Q..H.Q...P.....HI...HHML.Q.....V....T...E.....N..A.YETRE.TE..TSP....pPPTK.P.KRG..-..R.....K..A.K...EPKAaa.....asKRGP.KTQRKV..KKENE...dDLTk.....lMFDEEA.........................TGSK.SD.WR....GQEtVG..L....N.R....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTALSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHNL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A2I0VK71_9ASPA/1-348               ................................................................................................................................................MDDN..G..HREngrHKadhy..........................kavhaQW-M.M.PQH.........QMKdGHNT.MK.VMA.IMA.....ER...D.N...--...............AIQERNI.-.-...............ALA.EKKAALA.ERD................................................................MAILQRD.AV...IA.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.V.IER......DN..A.L..A.A.LEYARenslngdngsacppg......................csaprgtkhfhqhqqH.......lQHPPPQ..L...S..D.S...P.....YI...HGRE.M.....Q....L...T.....E..A.YPIST.AP..D--.....GIVK.I.RKA..K..R.....S..R.K...DTKPq......aaNPTK.KASRKG..KRVTGa..eDLN.......--KQITvvkplnqwrgsv.igggedlnkqaiVTKH.HE.WK....GQD.LG..L....N.L....V.T...........FDE.ST.MPP.PACSCTGKL....QQC.YKWGSGGWQSACCTTTLSMYPLPVMPNKRHARVAGRKMSGSAFTKLLSRLAAEG.HDL.SS.PLDLKD..HWAKHGTNRYITIK.........................................
A0A2I0W2F8_9ASPA/1-272               ............................................................................mdgksklnlrnwdftdnrhsesmfkpglgvsfpesnssvyqpgflkigaysdrttvmdehrseassvs----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.F.T..W.V.PQ....................................R.S.F.LHP......TK..T.I..N.H.LQTM-....................................................-........----PV..I...S..E.T...F.....NM...SSMP.I.....Q....S...N.....S..S.VPESP.IA..A--.....NPIN.A.RKQ..-..-.....Q..S.S...KNKA.........KNVA.TKVLRP..KAEKG....TKK.......-KGGSM.........................STGK.RE.KK....NQD.DM..F....N.G....V.M...........IDL.SG.VPA.PICSCTGMP....RQC.YRWGAGGWQSSCCTTGLSEYPLPVSPTRPGSRMAGRKMSIGAYTKLLQRLVAEG.QDL.SY.GVDLKN..HWARHGTNKFVTIK.........................................
D8RFN3_SELML/9-267                   cnelaelelesvalsaahhhhhhhqhhqhhqpglptaaaavaaaaavkqpkprsaarkqpkiealdsssppgqhdhtklgvrsnakfkkpmlnpghasgwlammetdaagfllghhqqqqqqceqeqiaggvasnnaaaspaaa----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................TATK.AE.KS....GKN.SG..G....A.K....A.Es.........sTTR.KY.YPA.PFCSCTGTN....QQC.YRWGNGGWQSACCTTKISMYPLPMNPKKKGSRVAGRKMSAGAFMKLLDRLTAEG.VDV.NS.SVDLRP..HWAKHGTNR-----r........................................
A0A0E0KCJ0_ORYPU/1-341               ................................................................................................................................................MDDD..A..SMS...MR...................................-WGG.F.FES.........-PA.RNLG.LQ.LMS.SVP....aDR...D.T...KQ...............LLSGSPF.L.H..............hHQH.VPHHHHH.PRDcggngngngvpngg....................................ampppateappsmpMNFVRND.MW...MH.P....QQqqhhh....................hhprehKVL..H..N.L.T..V.G.HGsshia.........................hhdpvgY.G.M.IPG......TH..S.T..H.T.LQMMQ....................................................Q........TEPQPQ..P...P..P.P...P.....QQ...PKEE.C.....I....S...S.....P..L.IEENV.PV..IDE....pPPPK.K.RQQ..G..R.....Q..P.K...VPRA.........KKPK.K-SVAP..REDG-....---.......APNAPT.........................PRRR.GP.RK....NIG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEG.YNL.NN.PIDLKT..FWAKHGTNKFVTI-s........................................
A0A2R6QIF6_ACTCC/1-301               ................................................................................................................................................MDGN..S..GMN...MR...................................NWA-.F.YEPp.......mGLK.GHLG.LQ.LMS.SGA.....E-...-.-...KP...............LLGGRSH.H.Pavmada..nggpfhhH--.-------.--Mptngglfhhr............................................vggvsespmpMDYAR-D.AW...IN.H...sRE...............................KYL..N..P.L.H..G.N.HHh.................................anF.S.V.LPE......TS..E.V..H.H.MQMLQ....................................................P........------..-...T..-.-...-.....ES...PKDD.S.....I....-...-.....A..R.MEETS.AE..RES....vGPLK.K.RRG..S..K.....P..Q.K...SPKP.........KKAK.KAPRAP..RDDGS....-V-.......----SM.........................QRAR.AP.PK....SME.VV..V....N.G....V.D...........IDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTGMSMYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLASEG.YNF.SN.PIDLRT..HWAKHGTNKFVTIR.........................................
A0A022R908_ERYGU/1-192               ...............................................................................................................................................d----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...---N.M.....Q....M...S.....D..T.VPISP.VA..P--.....EPTK.T.RRA..-..K.....R..A.K...EAKPaat...aapRKAS.KNSKRV..KREED...nNLN.......DLNNLNkavfgk.............shdmelGGPK.LD.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPV.PVCSCTGFL....RPC.YKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEG.HDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
W9SG76_9ROSA/1-281                   ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........TFK.GHLG.LQ.LMS.SMA.....ER...D.T...KP...............YMSGRDP.T.T...............VMV.SANGAFH.PRDcvvs.......................................................dapvpMNYVR-D.SW...VN.Q....RD...............................KFL..N..M.L.P..A.N.PN....................................Y.ApV.LPE......TS..G.A..H.S.LQMLQ....................................................P........------..-...-..-.-...P.....ET...TRDE.R.....V....-...-.....G..R.VEEPV.IV..NKE....sGPSK.K.RQG..G..G.....A..P.K...APKV.........KRPR.K----P..KDNTN....---.......---PAV.........................PRVK.PA.KK....SLE.VV..I....N.G....I.D...........MDI.SG.IPI.PVCSCTGTP....QQC.YRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A5N5FNM1_9ROSA/27-337              ................................................................................................................................................MDDG..R..QHEngrHKmdyyr.........................ggvasPWNM.M.TQQqa.....kePNA.LVMN.KK.IMS.IIA.....DR...D.A...--...............AIRERNA.-.-...............ALA.EKNEALA.ARD................................................................EALRQRD.EA...LA.Q....RD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.Y..A.A.LHS-Rdnavnfplgg...............................gaqrgskrvqrP........SIHSVT..L...A..D.-...V.....HY...STKD.V.....N....I...T.....E..A.YPISV.IS..P--.....EAVK.S.RQT..-..K.....R..A.K...ENKA.........SRAK.QSRKKV..GEDL-....--Nr.....qASSD-G.........................IKYK.SE.WD....THD.LG..L....N.L....V.S...........FDE.ST.MPV.PVCSCTGIP....RQC.YKWGNGGWQSSCCTTHMSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAADG.HDL.SI.PLDLKE..YWARHGTNRYITIK.........................................
A0A2I0JDA8_PUNGR/1-127               ...............................................................................................................................................m----..-..---...--...................................QWNV.M.LQHh......pkDTN.AVQN.KR.FMS.IMI.....ER...D.N...--...............AIRERNA.-.-...............AIA.ETKEALI.ARD................................................................EAIKQRD.EA...IA.E....RD...............................RAL..M..M.R.D..-.N.AR....................................E.A.L.RHL......EN..A.I..N.S.PQFAA....................................................-........--SGMK..R...A..H.S...H.....QS...DNGE.A.....R....I...T.....D..A.FPLSS.IT..A--.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------eavkss...................................
A0A445J238_GLYSO/1-282               ................................................................................................................................................MDGD..N..GLN...IR...................................NWG-.Y.YEPa.......tSFK.SHLG.LQ.LMS.SMP.....E-...-.-...KP...............LIGGRNA.A.V...............-LA.GTNGAFH.HRDiggmp......................................................qatypMEYMR-D.AW...IS.Q....RD...............................KYM..N..M.I.P..T.N.HN....................................Y.G.G.IPE......TS..S.A..H.Q.IQMIQ....................................................-........------..-...-..-.A...P.....EL...PKEE.K.....P....-...-.....-..-.VEEAP.VV..EKA....nGTRK.K.RQG..P..K.....V..P.K...SPRA.........KKPK.RGPRAP..KDEN-....---.......APS--V.........................QRAR.VP.KK....TTE.IV..I....N.G....I.D...........MDI.SS.IPI.PVCSCTGVH....QQC.YKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLRT..YWAKHGTNKFVTIR.........................................
A0A200R139_9MAGN/1-231               ................................................................................................................................................MDDN..K..QREngrHKhdpy..........................kllqsQW-M.I.PPHl.......mKDP.HALT.MK.FRT.ILA.....DR...D.T...--...............VIQERNL.-.-...............ALF.EKKATLA.ERD................................................................MAILQQD.QA...IF.E....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.MEQ......NN..A.L..A.A.LEY-Q....................................................G........-NSSVN..S...N..S.A...P.....TY...PLG-.-.....-....-...-.....-..-.----C.PV..PRG.....TKHM.H.HQQ..H..L.....H..H.H...SPHMai....ssnKRAL.KPSRKV..GKRGC....---.......--KD-L.........................NRCS.DP.WR....RHN.LG..L....N.H....V.Y...........FDE.SS.MPA.PICSCRGVL....HQG.YKWEKGEWQFSCCTSTLSMYPLPAVPNKRHS-----------------------.---.--.------..--------------.........................................
A0A444D3U1_ENSVE/1-272               ................................................................................................................................................MDGR..G..RLG...TR...................................SWDL.R.DQS.........KQA.G---.-K.MLK.SVS.....G-...-.A...AP...............AHQETSL.R.Is.............sYPA.PGSHSSH.PPT................................................................MDF----.SW...FP.Q....RS...............................LVS..H..S.K.C..V.D.HP....................................A.A.N.PVS......SE..M.I..G.G.IQTMP....................................................-........---ITE..E...E..E.-...-.....-A...DDKV.A.....T....T...P.....P..P.IPKLR.--..K-Q.....HSST.K.KSG..R..V.....A..A.K...VLRP.........KEPK.KQLPNP..PKKKG....G--.......----SS.........................STGK.RE.KK....NQD.SG..A....EqG....T.M...........LDI.SS.VPV.PVCSCTGVP....RQC.YRWGSGGWQSSCCTTTISEYPLPMSPTRPGARLAGRKMSIGAYGKLLQRLSAEG.FDL.SY.AVDLKD..HWARHGTNKFVTIR.........................................
A0A6A3CMI7_HIBSY/78-207              ..............................................................................................................................................qr----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..E...P..Q.P...P.....GT...STRD.E.....R....V...V.....G..R.VEEPP.AS..QED.....VQSK.R.RLG..R..V.....G..P.K...TPKV.........KKPR.K----P..KDDTK....S--.......----TV.........................HRSK.PA.KK....SMD.IK..I....N.G....Y.D...........VDI.SG.IPI.PVCSCTGTA....QQC.YRWGCGGWQSACCTTTVSL-----------------------------------.---.--.------..--------------tnehqkawrkdsr............................
A0A2P5AKA0_PARAD/1-315               ................................................................................................................................................MDDR..R..QHEtsrHKvdyyr........................gthypvQWNM.M.AQHqv.....kePNA.LVMN.KK.IMS.IIA.....ER...D.A...--...............AIRERNV.-.-...............ALS.EKNEALA.ERD................................................................EAFRQRD.EA...FA.Q....KD...............................---..-..-.-.-..-.-.--....................................S.A.L.MER......DN..A.F..A.A.LQI-Rigsmniplsd...............................gvqrgvkrmnhP........SNNLPN..M...A..D.-...A.....TY...DSKE.M.....Q....I...T.....D..A.FPITV.IS..S--.....EAIK.S.RQE..-..K.....R..R.K...ENKGi.......sSKES.K--SPR..KKVAE....DLNr.....rATSDG-.........................TKFR.TE.WE....SQD.LG..L....N.L....I.T...........FDE.ST.MPV.PVCSCTGVP....RQC.YKWGSGGWQSSCCTTHMSVYPLPQIPNKRHARMGGRKMSGSVFTRLLSRLAAQG.HDL.SM.PLDLRE..YWARHGTNRYITIK.........................................
C5Z3A8_SORBI/1-329                   .....................................................................................................................................mdnlgrengrq----..-..---...-Rpdqy..........................kavhtQW-M.M.PQR.........QLK.DHHS.MN.LLA.LMN.....EK...D.S...--...............AIRERDH.-.-...............ALA.EKKAAIA.ERD................................................................MAFAQRD.AA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnngngfhqgp....................plngtknvhhhdqlshV........QTSPLQ..L...A..D.S...P.....YD...HVRE.M.....H....I...S.....E..A.YPIAT.AP..GTI.....GKAK.K.PRK..-..-.....S..N.S...QASP........lKRPS.GVLRKT..KKATG...dWKNgg..msgV----Agds...................araAVMK.NE.WK....DQD.LG..L....N.Q....V.A...........FDE.ST.MPA.PACSCTGEL....HQC.YKWGNGGWQSSCCTTNMSMYPLPVMPNRRHARMGGRKMSGGAFTKLLSRLAAEG.HDL.SI.PVDLKD..HWAKHGTNRYITIR.........................................
M8ARK5_TRIUA/1-330                   ................................................................................................................................................MDNL..G..HREngrQRpdpy..........................kalhtQW-M.M.PQR.........QMK.DHHS.MN.LLA.LLS.....ER...D.T...--...............AIMERDH.-.-...............ALA.EKKAAMA.ERD................................................................MAFAQRD.SA...MA.E....RN...............................---..-..-.-.-..-.-.--....................................A.A.I.VER......DN..A.L..A.A.LELARtngfnmnsgngfnpg.....................slngaknfhhhdqqphA........QSSPLQ..L...A..D.S...P.....YD...HARE.M.....H....I...S.....D..A.YPIST.AP..VT-.....AAGK.A.KKP..K..K.....N..S.S...QASP........lKRPS.GVLRKT..KKAGG....DWRd....agMSG--Vgedp.................araaSEMK.NE.WK....DQD.LG..L....N.Q....V.S...........FDE.SS.MPA.PACSCTGVL....RQC.YKWGNGGWQSSCCTMSMSMYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEG.HDL.SA.SVDLKD..HWAKHGTNRIV---de.......................................
A0A5N5HD93_9ROSA/1-279               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLS.LQ.LMS.SMA.....ER...D.I...KP...............FAPGRDP.A.V...............-MV.SANGAYH.PRDcvvs.......................................................dtqlpMNYMR-E.SW...VN.Q....RD...............................KFL..N..M.M.P..A.N.PN...................................yA.A.V.LPE......TS..G.A..H.S.LQILQ....................................................P........------..-...-..-.-...P.....EA...SRDE.R.....V....-...-.....G..R.MEEPV.VP..KEG.....GTSK.K.RQG..G..G.....A..P.K...APKV.........KKPR.K----P..KDNAN....---.......---PSV.........................PRVK.PA.KK....SLD.VV..I....N.G....I.N...........MDI.SG.IPI.PVCSCTGAP....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEG.YNF.AN.PIDLRS..HWAKHGTNKFVTLR.........................................
R0GAL8_9BRAS/1-343                   ................................................................................................................................................MDDG..G..HREngrHKaa...............................qgQW--.M.MQH.........QPS.M---.KQ.VMS.IIA.....ER...D.A...--...............AIQERNL.-.-...............AIS.EKKAAIA.ERD................................................................MAFLQRD.TA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.I.MER......DS..A.L..T.A.LQYREnsmvtaasanmsacppgc...............qisrgvknmhhphmhhhhhQ........QHHIPQ..L...T..E.-...N.....AY...EPRE.M.....E....P...N.....D..G.LPTSP.TA..GSV....lESAK.P.KRG..-..K.....R..V.K...DPKTttq..taanKRGT.KNQRKV..KKESE...dDLTk.....iMFLKTThdytee............dsskhilIGSK.SD.WK....SQE.MV.gL....N.Q....V.V...........YDE.TT.MPP.PVCSCTGVL....RQC.YKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A3L6SE24_PANMI/1-168               ..............................................................................................................................................mp----..-..---...--...................................----.-.---.........---.----.--.---.---.....--...-.-...--...............-------.-.-...............---.-------.---................................................................-------.--...--.-....--...............................---..-..-.-.-..-.-.--....................................-.-.-.---......--..-.-..-.-.-----....................................................-........------..-...-..-.-...-.....--...----.-.....-....-...Q.....P..P.IEDHP.VL..KNE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-VAAP..QENG-....---.......APNKPA.........................PRPR.GP.RK....TVG.MV..I....N.G....I.D...........LDL.SR.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEG.YNL.SN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A394DNC2_LUPAN/1-287               ................................................................................................................................................MDGD..N..GLN...MR...................................NWGY.Y.-EAt.......tPFK.NHLG.LQ.LMS.SMP.....EK...Q.-...-P...............LLGARNA.V.A...............---.----PFH.HRDvgms.......................................................qpaypMEYMR-N.AW...IG.H....SHrdr.........................fmnMNI..N..M.I.P..T.N.HN....................................Y.S.L.APE......TS..S.A..H.Q.IQMVE....................................................E........---QQQ..P...T..-.-...-.....EL...SEEE.T.....P....T...E.....E..E.TPVEK.VN..---.....GTGK.K.RG-..-..K.....G..S.K...VPKAl......kaKKTK.RGPREP..KDEN-....---.......APS--V.........................QRAR.TV.RK....CAE.IV..I....N.G....I.D...........MDL.SS.IPI.PVCSCTGAL....QQC.YRWGSGGWQSACCTTGISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEG.YNF.SN.PIDLKT..YWAKHGTNKFVTIR.........................................
A0A200QEH7_9MAGN/1-277               ...............................................................................................................................................m----..-..---...--...................................----.-.---.........---.----.-K.FMS.ILA.....DR...D.T...--...............LIQERNL.-.-...............ALS.EKKAALA.ERD................................................................MAILQRD.QA...IS.Q....RN...............................---..-..-.-.-..-.-.--....................................S.A.M.MEQ......DN..A.L..A.V.LEY-Rgnssvnsnsaptypl......................gcpvpcrtkhmhhqqH........MHHSPH..M...A..E.-...V.....HY...NSKE.M.....H....T...N.....E..A.IPISS.VC..S--.....KSPK.P.RRG..-..R.....R..T.K...EHKAis.....snKRAL.KPMKVG..KRGCN....DLN.......------.........................-MCS.DP.WR....GHD.LS..L....N.H....V.Y...........FDY.SN.MPR.PVCSCTGVL....QQC.YKWGKGGWQSSCCTSTLSMYPLPVVPNKRHSRLGGRKMSGSAFNKLLSWLLAEG.HDL.ST.PLDLKD..HWSRHGTNRYITIK.........................................
A0A1B6QAK9_SORBI/1-133               ..............................................................................................................................................md-DDD..G..SLG...TR...................................NWG-.F.YDT.........-VK.GNLG.LQ.VMS.SVP....pDR...D.T...KS...............LLPNGAF.L.Q...............HHG.HHNAPHQ.LHM................................................................QQHSQHS.VAplvLH.H....-Qrp..........................peqKVL..H..S.R.P..I.G.PAghvghpghg.................ghivhyhptsY.G.M.ISD......--..A.Q..H.T.LQMMQ....................................................P........------..-...-..-.-...-.....--...----.-.....-....-...-.....-..-.-----.--..---.....----.-.---..-..-.....-..-.-...----.........----.------..-----....---.......------.........................----.--.--....---.--..-....-.-....-.-...........---.--.---.---------....---.------------------------------------------------------.---.--.------..--------------slerg....................................
K3ZSA0_SETIT/187-527                 ................................................................................................................................................MDDD..G..NLS...IR...................................NWG-.F.YDT.........-MK.GNLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPTSAF.L.Qhh..........ghhNAP.HQLHSHH.SRDsgggggasg.............................................smptephsihMDFSRNE.AW...LH.P....SHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghgghp...........ghgghavhhhptgY.G.M.MPD......--..A.P..H.T.LQMMQ....................................................P.......qLPSQPQ..E...-..-.-...P.....PP...CKED.H.....V....P...T.....P..P.VEDHS.VV..RTE.....PPVK.K.RQQ..G..R.....Q..P.K...SPKP.........KKPK.K-PAVP..REDG-....---.......AVNGHA.........................PRGR.GP.RK....TVG.MV..I....N.G....I.E...........LDL.SN.IPT.PVCSCTGAP....QQC.YRWGAGGWQSACCTTSISTYPLPMNAKRRGARIAGRKMSQGAFKKVLEKLVGEG.YNL.AN.PIDLKT..FWAKHGTNKFVVIR.........................................
A0A4U5QIV7_POPAL/68-397              ..................................................................................................................................tehcmhkadqykta----..-..---...QG...................................QWL-.M.-QP.........QPS.M---.KQ.IMA.IMA.....ER...D.A...--...............AIHERNM.-.-...............ALS.EKKAAIA.ERD................................................................MAFLQRD.SA...IA.E....RN...............................---..-..-.-.-..-.-.--....................................N.A.L.LER......DN..A.I..A.T.LQYREnslpsgnittcppgf......................hnsrgvkhmhhqqqqH........THHLPH..M...N..E.-...G.....PY...GTRE.M.....Q....T...S.....D..A.VPVSP.VA..S--.....EVAK.P.QRG..-..K.....R..P.K...DAKAtp.....snKKTS.KSPRKV..KRESE....DTN.......MFGKSHewkngqdmd......gggddpnkqlAASK.SD.WK....GQD.LG..L....N.Q....V.A...........FDE.TT.MPA.PVCSCTGVF....RQC.YKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG.QDL.SN.PVDLKD..HWAKHGTNRYITIK.........................................
A0A6A2WZN4_HIBSY/1-284               ................................................................................................................................................MDDD..A..-LN...MR...................................NWG-.Y.YEP.........SFK.GHLG.LQ.LMT.SMA.....ER...D.T...KP...............FIPGHDP.N.L...............-MV.TPNSAFN.PRDcivs.......................................................dapipIHYVR-D.TW...IS.Q....RE...............................KYF..S..M.M.P..P.S.TAp..................................sY.G.I.LPE......TL..A.A..H.S.LPILQ....................................................-........------..L...P..P.-...P.....DT...STRD.E.....R....V...V.....G..R.VEEPP.AS..QED.....LQSK.K.RQG..G..G.....G..P.K...TPKA.........KKPR.K----P..KDDTN....ST-.......-----V.........................QRVK.PP.KK....SMD.IK..I....N.G....Y.D...........MDI.SG.IPI.PVCSCTGTT....QQC.YRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEN.YNF.SN.PIDLRT..HWARHGTNKFVTIR.........................................
A0A3L6QRW5_PANMI/1-336               ................................................................................................................................................MDDD..G..SLG...IR...................................NWG-.F.YDT.........-VK.GSLG.LQ.LMS.SVP....aDR...D.T...KS...............LLPAGAF.-.Lhhh.........ghhNAP.HQVHSHH.SRDsggagtsgg..............................................mptepqsihMDFSRNE.AW...LH.P....LHhqh........................preqKVL..H..A.R.P..V.G.PAghvghpghg.................ghavhhrptgY.G.M.IPD......--..A.P..H.T.LQMMQ....................................................V.......qPQLQSQ..L...Q..E.-...P.....PP...CKED.D.....V....P...P.....P..L.VEDQS.LV..KTE.....LPVK.K.RQQ..G..R.....Q..P.K...LPKP.........KKPK.K-VAVP..HEDR-....---.......AVNGHA........................