GenomeNet

Database: Pfam
Entry: HCV_NS4b
LinkDB: HCV_NS4b
Original site: HCV_NS4b 
#=GF ID   HCV_NS4b
#=GF AC   PF01001.19
#=GF DE   Hepatitis C virus non-structural protein NS4b
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_315 (release 3.0)
#=GF GA   20.30 20.30;
#=GF TC   20.30 78.20;
#=GF NC   20.00 20.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9261364
#=GF RT   The hepatitis C virus NS4A protein: interactions with the NS4B
#=GF RT   and NS5A proteins. 
#=GF RA   Lin C, Wu JW, Hsiao K, Su MS; 
#=GF RL   J Virol 1997;71:6465-6471.
#=GF RN   [2]
#=GF RM   9224925
#=GF RT   The nonstructural proteins of the hepatitis C virus: structure
#=GF RT   and functions. 
#=GF RA   Neddermann P, Tomei L, Steinkuhler C, Gallinari P, Tramontano A,
#=GF RA   De Francesco R; 
#=GF RL   Biol Chem 1997;378:469-476.
#=GF DR   INTERPRO; IPR001490;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   No precise function has been assigned to NS4b.  However, it is
#=GF CC   known that NS4b interacts with NS4a and NS3 to form a large
#=GF CC   replicase complex to direct the viral RNA replication [1].
#=GF SQ   3
#=GS A0A0P0QKS2_9VIRU/1786-1954  AC A0A0P0QKS2.1
#=GS O41892_PEGIA/1702-1891      AC O41892.1
#=GS POLG_HCVH/1728-1921         AC P27958.3
#=GS POLG_HCVH/1728-1921         DR PDB; 2JXF A; 1-30;
A0A0P0QKS2_9VIRU/1786-1954             vpfgtq-----------------------------VLGFLAEHGPKIMAAAQVLGGFTILGTSPAMGGAMLGTGFFLLPRSLPGRFFMAMLAGGLGTWLSTPAGGFAAALGSFAGIALADSGFCSIFQQALTTYMGATTAASIVFDLLGGKLPTAQEAVGLFTLIINPGAAVVGCVLAGLLHAYAT..RGSSEWLNRMLA
O41892_PEGIA/1702-1891                 .....k-AWTAGVLVPPAPALADNAPGLLATLDTMFTQTWEAIFTNGRSLLVGXTAAYGAKRNPPLGVAASFLLGMSAGRAVHVRLAAALLLGVGGTMLGQASTGLAMAGAYFAGGSITSSWLS-IIITLLGGWEGAVNAASLTFDLLSGKAE-AKDAWCIISCLASPGASVAGVALGVLLWSVKK..GVGHDWVNRLLT
POLG_HCVH/1728-1921                    ......FKQKALGLLQTASRHAEVITPAVQTNWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNLLPAILSPGALAVGVVFASILRRRVGpgEGAVQWMNRLIA
#=GR POLG_HCVH/1728-1921         SS    ......XXXXXXXXXXXXXXXXXXXXXXX--HHHHHHHHHHHHHHHHHHHHHHHHHS--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
#=GC SS_cons                           ......XXXXXXXXXXXXXXXXXXXXXXX--HHHHHHHHHHHHHHHHHHHHHHHHHS--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
#=GC seq_cons                          .....p.t.pAhsLl.sAsthA-shsshltT..phlpsFWAcHhsNhhSulQsLuGhosLssNPAlGuAMuFTuuhouPRolssRLhhAlLuGslGThLusPuuGhAhAGAuFAGuALsSSGLupIllslLuGYtGAVsAASlsFDLLSGKlPoAcDAVsLlosIlSPGAuVVGVVLAuLL+uhss..cGus-WlNRLLA
//
DBGET integrated database retrieval system