GenomeNet

Database: Pfam
Entry: HCV_env
LinkDB: HCV_env
Original site: HCV_env 
#=GF ID   HCV_env
#=GF AC   PF01539.17
#=GF DE   Hepatitis C virus envelope glycoprotein E1
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Swiss-Prot
#=GF GA   22.00 22.00;
#=GF TC   22.70 35.70;
#=GF NC   21.90 21.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8396266
#=GF RT   At least 12 genotypes of hepatitis C virus predicted by sequence
#=GF RT   analysis of the putative E1 gene of isolates collected
#=GF RT   worldwide. 
#=GF RA   Bukh J, Purcell RH, Miller RH; 
#=GF RL   Proc Natl Acad Sci USA 1993;90:8234-8238.
#=GF DR   INTERPRO; IPR002519;
#=GF DR   SCOP; 1emz; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF SQ   2
#=GS POLG_HCVH/193-382         AC P27958.3
#=GS POLG_HCVH/193-382         DR PDB; 4N0Y A; 314-324;
#=GS A0A0P0QKS2_9VIRU/307-490  AC A0A0P0QKS2.1
POLG_HCVH/193-382                    ......QVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATR.DGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFT.FSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVD..
#=GR POLG_HCVH/193-382         SS    ......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXX--HHHHHHHH-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..
A0A0P0QKS2_9VIRU/307-490             rlpdrt--------WTLSNVCTQADLRYCTSDMCWHSPGCYV-----ATDICWTQYSPTLSHHpDRASPLTLFADHLDIFSVVVYGCEVSGAGEVCGVTLVILDLLVeYFPRHVETNCSMSCGLSVDAFT-ITTALDGLLESNAFLDLMAMVLKQVPWLIGMLFTEFHMGILFVSMAYLIEGKAFRVVMLLGLYAT--lh
#=GC SS_cons                         ......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXX--HHHHHHHH-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..
#=GC seq_cons                        ..............aploNsCspuslhYpsuDhhhHoPGChs.....ssshCWsthoPTlup+.Dtt.PhT.htcHlDlhsssshhCps.hsG-lCGsshllhpLhs.a.PRHh.TspshsCul.ssthT.hphAhshhhp.sshhsLhsh.LhplP.hIh.hhsthHhGlLhs.hha.h.Gphh+VlhlLhLaAs....
//
DBGET integrated database retrieval system