GenomeNet

Database: Pfam
Entry: HHV-5_US34A
LinkDB: HHV-5_US34A
Original site: HHV-5_US34A 
#=GF ID   HHV-5_US34A
#=GF AC   PF17087.6
#=GF DE   Herpesvirus US34A protein family
#=GF AU   Llagostera M;0000-0001-8177-8321
#=GF SE   Manual
#=GF GA   27.00 27.00;
#=GF TC   54.20 63.20;
#=GF NC   22.90 22.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   19906940
#=GF RT   Sequences of complete human cytomegalovirus genomes from
#=GF RT   infected cell cultures and clinical specimens.
#=GF RA   Cunningham C, Gatherer D, Hilfrich B, Baluchova K, Dargan DJ,
#=GF RA   Thomson M, Griffiths PD, Wilkinson GW, Schulz TF, Davison AJ;
#=GF RL   J Gen Virol. 2010;91:605-615.
#=GF RN   [2]
#=GF RM   15105547
#=GF RT   Genetic content of wild-type human cytomegalovirus.
#=GF RA   Dolan A, Cunningham C, Hector RD, Hassan-Walker AF, Lee L,
#=GF RA   Addison C, Dargan DJ, McGeoch DJ, Gatherer D, Emery VC,
#=GF RA   Griffiths PD, Sinzger C, McSharry BP, Wilkinson GW, Davison AJ;
#=GF RL   J Gen Virol. 2004;85:1301-1312.
#=GF DR   INTERPRO; IPR031384;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Proteins in this human cytomegalovirus (HHV-5 )family contain a
#=GF CC   transmembrane domain [1,2].
#=GF SQ   3
#=GS US34A_HCMVA/1-64   AC Q7M6G6.1
#=GS Q8QRS6_9BETA/1-62  AC Q8QRS6.1
#=GS US34A_HCMVM/1-64   AC Q6SVX3.1
US34A_HCMVA/1-64              .MLKFLLKFRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLRKNRARRRQSFP
Q8QRS6_9BETA/1-62             m--KF-FKSRARPPRLTVPRVLRFFGYAVLLAVAWQRLKKERAASLRRYEEKMRRQQVRRRQSFP
US34A_HCMVM/1-64              .MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLQKNRARRRQSFP
#=GC seq_cons                 .MLKFhLKhRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLRKNRARRRQSFP
//
DBGET integrated database retrieval system