GenomeNet

Database: Pfam
Entry: Hema_stalk
LinkDB: Hema_stalk
Original site: Hema_stalk 
#=GF ID   Hema_stalk
#=GF AC   PF08720.11
#=GF DE   Influenza C hemagglutinin stalk
#=GF PI   FluC_stalk; 
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   pdb_1flc
#=GF GA   26.90 26.90;
#=GF TC   28.10 214.70;
#=GF NC   23.30 26.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Hemagglutinin_(influenza)
#=GF RN   [1]
#=GF RM   9817207
#=GF RT   Structure of the haemagglutinin-esterase-fusion glycoprotein of
#=GF RT   influenza C virus. 
#=GF RA   Rosenthal PB, Zhang X, Formanowski F, Fitz W, Wong CH,
#=GF RA   Meier-Ewert H, Skehel JJ, Wiley DC; 
#=GF RL   Nature. 1998;396:92-96.
#=GF DR   INTERPRO; IPR014831;
#=GF DR   SCOP; 1flc; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain corresponds to the stalk segment of hemagglutinin in
#=GF CC   influenza C virus.  It forms a coiled coil structure [1].
#=GF SQ   2
#=GS A0A0E4C2T1_9ORTO/456-631  AC A0A0E4C2T1.1
#=GS HEMA_INCAA/447-621        AC P68762.2
A0A0E4C2T1_9ORTO/456-631             IFGIDDLIFGLLFIGFVAGGVaGGYFWGRSSEGGGGASVSSTQAGFDKIGKDIQQLRSDTNAAIEGFNGRIAHDEQAVKNLAKEIEDARAEALVGELGIIRSLIVANISMNLKESLYELANQITKRGGGIAQEAGPGCWYVDSENCDASCKEYIFNFNGSATVPTLRPVDTNV---iit
HEMA_INCAA/447-621                   IFGIDDLIIGLLFVAIVEAGI.GGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLNDRISHDEQAIRDLTLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIFKFNETAPVPTIPPLDTKIDLQ...
#=GC seq_cons                        IFGIDDLIhGLLFluhVtuGl.GGYhhGppp.uGGGsohpSsptGF-KIGpDIQ.LRSsTNhAIEthNsRIuHDEQAl+sLshEIEsARuEALlGELGIIRuLlVuNIShsLpESLaELAspITpRuGslA.EsuPGCWhlDsp.CDtSCppaIFpFNtoAsVPTl.PlDTpl......
//
DBGET integrated database retrieval system