GenomeNet

Database: Pfam
Entry: Hom_end_hint
LinkDB: Hom_end_hint
Original site: Hom_end_hint 
#=GF ID   Hom_end_hint
#=GF AC   PF05203.17
#=GF DE   Hom_end-associated Hint
#=GF AU   Studholme DJ;0000-0002-3010-6637
#=GF SE   SCOP b.86.1.2
#=GF GA   32.10 32.10;
#=GF TC   32.10 32.10;
#=GF NC   32.00 32.00;
#=GF BM   hmmbuild  --handHMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Homing_endonuclease
#=GF NE   PF05204;
#=GF NL   G8JWX2.1/454-632
#=GF RN   [1]
#=GF RM   12219083
#=GF RT   Crystal structure of the intein homing endonuclease PI-SceI
#=GF RT   bound to its recognition sequence. 
#=GF RA   Moure CM, Gimble FS, Quiocho FA; 
#=GF RL   Nat Struct Biol 2002;9:764-770.
#=GF DR   INTERPRO; IPR007868;
#=GF DR   SCOP; 1gpp; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Homing endonucleases are encoded by mobile DNA elements that are
#=GF CC   found inserted within host genes in all domains of life. The
#=GF CC   crystal structure of the homing nuclease PI-Sce [1] revealed two
#=GF CC   domains: an endonucleolytic centre resembling the C-terminal
#=GF CC   domain of Drosophila melanogaster Hedgehog protein, and a second
#=GF CC   domain containing the protein-splicing active site. This Domain
#=GF CC   corresponds to the latter protein-splicing domain.
#=GF SQ   217
#=GS A0A291AX64_9CAUD/34-123     AC A0A291AX64.1
#=GS A0A2H5SJ84_RHIID/636-1015   AC A0A2H5SJ84.1
#=GS A0A2T9ZE01_9FUNG/596-760    AC A0A2T9ZE01.1
#=GS A0A1S8W8Q5_9FUNG/814-1285   AC A0A1S8W8Q5.1
#=GS A0A088F962_9CAUD/34-125     AC A0A088F962.1
#=GS A7TLB5_VANPO/284-715        AC A7TLB5.1
#=GS A0A1R0GMB9_9FUNG/1913-2055  AC A0A1R0GMB9.1
#=GS G8BNB8_TETPH/284-799        AC G8BNB8.1
#=GS U7UMX0_9FIRM/43-169         AC U7UMX0.1
#=GS S6E2M2_ZYGB2/284-738        AC S6E2M2.1
#=GS A0A2Z6QPC9_9GLOM/530-911    AC A0A2Z6QPC9.1
#=GS A0A2T9Z5W9_9FUNG/1924-2030  AC A0A2T9Z5W9.1
#=GS F4CAE7_SPHS2/2071-2128      AC F4CAE7.1
#=GS A0A229Z4L1_9EURO/1526-1642  AC A0A229Z4L1.1
#=GS A0A432VA30_9RHIZ/34-147     AC A0A432VA30.1
#=GS A0A368JMP7_9BACT/247-348    AC A0A368JMP7.1
#=GS A0A248SJG5_9CAUD/367-530    AC A0A248SJG5.1
#=GS X5JM31_9CAUD/34-127         AC X5JM31.1
#=GS B9XA08_PEDPL/492-603        AC B9XA08.1
#=GS W8YS26_9CAUD/34-125         AC W8YS26.1
#=GS A0A1E3P9G0_WICAA/599-963    AC A0A1E3P9G0.1
#=GS A0A097EW01_9CAUD/539-615    AC A0A097EW01.1
#=GS A0A1Y5RRB6_9RHOB/32-131     AC A0A1Y5RRB6.1
#=GS G0V8Z3_NAUCC/284-799        AC G0V8Z3.1
#=GS B6JY11_SCHJY/285-759        AC B6JY11.2
#=GS A0A3P3VNX0_9GAMM/62-105     AC A0A3P3VNX0.1
#=GS A0A1E5RAR2_9ASCO/285-785    AC A0A1E5RAR2.1
#=GS A0A1S1Y7K3_9GAMM/229-309    AC A0A1S1Y7K3.1
#=GS A0A017SN98_9EURO/1524-1665  AC A0A017SN98.1
#=GS G7E5L8_MIXOS/284-742        AC G7E5L8.1
#=GS A0A1G4IPL3_9SACH/15-597     AC A0A1G4IPL3.1
#=GS A0A2M9BSG3_9BACT/244-341    AC A0A2M9BSG3.1
#=GS F9ZMR9_ACICS/472-579        AC F9ZMR9.1
#=GS A0A411AV32_9CAUD/8-122      AC A0A411AV32.1
#=GS S6E6E8_ZYGB2/1-463          AC S6E6E8.1
#=GS F8XU21_9PROT/162-253        AC F8XU21.1
#=GS A0A0B4ZZT7_9CAUD/308-349    AC A0A0B4ZZT7.1
#=GS J7RJ26_KAZNA/284-757        AC J7RJ26.1
#=GS A0A1L0DCU1_9ASCO/244-292    AC A0A1L0DCU1.1
#=GS Q6CL64_KLULA/284-692        AC Q6CL64.1
#=GS A0A2T9Z5W9_9FUNG/2500-2748  AC A0A2T9Z5W9.1
#=GS L0ASJ4_9CAUD/37-134         AC L0ASJ4.1
#=GS J0L3T1_9HELI/210-317        AC J0L3T1.1
#=GS A5DXZ0_LODEL/280-699        AC A5DXZ0.1
#=GS A0A2Z6SEZ6_9GLOM/413-846    AC A0A2Z6SEZ6.1
#=GS A0A1X7QY67_9SACH/284-788    AC A0A1X7QY67.1
#=GS U7Q1H8_SPOS1/262-759        AC U7Q1H8.1
#=GS E0UKK2_CYAP2/364-429        AC E0UKK2.1
#=GS A0A2H3NPZ9_9BACT/231-324    AC A0A2H3NPZ9.1
#=GS A0A1D2VFN5_9ASCO/284-685    AC A0A1D2VFN5.1
#=GS A0A0R1VN30_9LACO/36-158     AC A0A0R1VN30.1
#=GS A0A1S8VSS7_9FUNG/870-1291   AC A0A1S8VSS7.1
#=GS HO_YEAST/1-464              AC P09932.2
#=GS A7IX33_PBCVN/439-828        AC A7IX33.1
#=GS A0A0D2X4Y0_CAPO3/1840-1998  AC A0A0D2X4Y0.1
#=GS A0A2I9D0J9_9DEIO/333-389    AC A0A2I9D0J9.1
#=GS G0W3J0_NAUDC/284-783        AC G0W3J0.1
#=GS A0A1M6S312_9ACTN/2074-2144  AC A0A1M6S312.1
#=GS C1GAW5_PARBD/1525-1607      AC C1GAW5.1
#=GS A0A1X2HHI8_SYNRA/1333-1829  AC A0A1X2HHI8.1
#=GS I2GXM6_TETBL/1-463          AC I2GXM6.1
#=GS Q4WI55_ASPFU/1523-1607      AC Q4WI55.1
#=GS F2Z6H8_CANGA/1-463          AC F2Z6H8.1
#=GS A0A367YP60_9ASCO/284-775    AC A0A367YP60.1
#=GS A0A2H5RF69_RHIID/347-781    AC A0A2H5RF69.1
#=GS A0A1G4M6H5_LACFM/170-750    AC A0A1G4M6H5.1
#=GS G0VAU9_NAUCC/2-450          AC G0VAU9.1
#=GS A0A1G4M927_LACFM/181-755    AC A0A1G4M927.1
#=GS A0A0C7MVF1_9SACH/10-531     AC A0A0C7MVF1.1
#=GS A0A2W7I623_9PROT/32-114     AC A0A2W7I623.1
#=GS A0A397HXW0_9EURO/1526-1632  AC A0A397HXW0.1
#=GS A0A0A2EUS2_9PORP/242-243    AC A0A0A2EUS2.1
#=GS A0A397VUW3_9GLOM/15-161     AC A0A397VUW3.1
#=GS Q2S6J9_SALRD/231-332        AC Q2S6J9.1
#=GS A0A2Z4LWQ9_9FLAO/1820-1892  AC A0A2Z4LWQ9.1
#=GS C6HTZ2_9BACT/315-387        AC C6HTZ2.1
#=GS A1CZ00_NEOFI/1524-1611      AC A1CZ00.1
#=GS A0A2T5M975_9EURO/1525-1674  AC A0A2T5M975.1
#=GS C5DTL5_ZYGRC/284-732        AC C5DTL5.1
#=GS A0A1S2VRN5_9BACT/243-330    AC A0A1S2VRN5.1
#=GS A0A397SPX4_9GLOM/415-856    AC A0A397SPX4.1
#=GS A0A0D2X4Y0_CAPO3/768-1237   AC A0A0D2X4Y0.1
#=GS A0A2H5RG61_RHIID/409-843    AC A0A2H5RG61.1
#=GS A0A2P5HXR1_9PEZI/1556-1644  AC A0A2P5HXR1.1
#=GS Q5G7M7_9CAUD/35-130         AC Q5G7M7.1
#=GS A0A084RH77_STACH/260-762    AC A0A084RH77.1
#=GS L7RCI5_9VIRU/857-1126       AC L7RCI5.1
#=GS M3K3J1_CANMX/284-733        AC M3K3J1.1
#=GS A0A1I5TE83_9PROT/207-306    AC A0A1I5TE83.1
#=GS G8C1W5_TETPH/1-463          AC G8C1W5.1
#=GS R4TWJ8_9PHYC/156-255        AC R4TWJ8.1
#=GS G8ZQA5_TORDC/12-474         AC G8ZQA5.1
#=GS E7GTB3_CLOSY/386-455        AC E7GTB3.1
#=GS A0A1A0HJE8_9ASCO/284-750    AC A0A1A0HJE8.1
#=GS A0A372RSX8_9GLOM/409-842    AC A0A372RSX8.1
#=GS S7ZNR3_PENO1/1524-1636      AC S7ZNR3.1
#=GS I2G828_9CAUD/34-127         AC I2G828.1
#=GS A0A2P7TWC8_9SPHI/241-348    AC A0A2P7TWC8.1
#=GS A0A1R1XW24_9FUNG/1914-2100  AC A0A1R1XW24.1
#=GS Q5B4K7_EMENI/1512-1641      AC Q5B4K7.1
#=GS A0A427XK52_9TREE/17-85      AC A0A427XK52.1
#=GS A0A367XLV3_9ASCO/284-775    AC A0A367XLV3.1
#=GS A0A397GDQ6_9GLOM/1034-1470  AC A0A397GDQ6.1
#=GS U5N122_9CAUD/6-97           AC U5N122.1
#=GS A0A329RLC5_9STRA/445-552    AC A0A329RLC5.1
#=GS A0A2I7QJN8_9CAUD/37-143     AC A0A2I7QJN8.1
#=GS A0A2T9Z5W9_9FUNG/596-754    AC A0A2T9Z5W9.1
#=GS A0A0H3TM33_9VIRU/90-180     AC A0A0H3TM33.1
#=GS A0A0F8UW12_9EURO/1525-1670  AC A0A0F8UW12.1
#=GS A0A087SLR2_AUXPR/1128-1278  AC A0A087SLR2.1
#=GS A0A1I0DDC1_9BACT/244-323    AC A0A1I0DDC1.1
#=GS A0A1G4KN40_9SACH/206-777    AC A0A1G4KN40.1
#=GS A0A1E4RQA6_9ASCO/283-765    AC A0A1E4RQA6.1
#=GS A0A2I1CKS8_9EURO/1506-1594  AC A0A2I1CKS8.1
#=GS A0A2G5BDK3_COERN/528-893    AC A0A2G5BDK3.1
#=GS A0A2I1FXS8_9GLOM/642-1019   AC A0A2I1FXS8.1
#=GS A0A139IQD1_9PEZI/439-991    AC A0A139IQD1.1
#=GS A0A0N9R1K5_CEV01/55-442     AC A0A0N9R1K5.1
#=GS A0A1R1XW24_9FUNG/596-1091   AC A0A1R1XW24.1
#=GS A0A1E3NMZ3_9ASCO/284-777    AC A0A1E3NMZ3.1
#=GS F2TVI8_SALR5/1497-1625      AC F2TVI8.1
#=GS Q6BRM0_DEBHA/283-675        AC Q6BRM0.2
#=GS G8ZQA3_TORDC/12-487         AC G8ZQA3.1
#=GS A0A1X7R6R5_9SACH/1-462      AC A0A1X7R6R5.1
#=GS A0A1J9P8N8_9EURO/1526-1623  AC A0A1J9P8N8.1
#=GS A0A1G4KCH8_9SACH/17-636     AC A0A1G4KCH8.1
#=GS A0A076HKJ9_9BACT/244-331    AC A0A076HKJ9.1
#=GS A0A2Z4PZ14_9CAUD/6-97       AC A0A2Z4PZ14.1
#=GS A0A178ZZK1_9EURO/358-911    AC A0A178ZZK1.1
#=GS A0A249XX92_9CAUD/34-125     AC A0A249XX92.1
#=GS A0A2I2EY52_9EURO/1526-1657  AC A0A2I2EY52.1
#=GS A0A1G4J692_9SACH/8-526      AC A0A1G4J692.1
#=GS A0A0D2HES5_9EURO/357-849    AC A0A0D2HES5.1
#=GS A0A397TDD6_9GLOM/1-138      AC A0A397TDD6.1
#=GS E3T596_CROVB/141-526        AC E3T596.1
#=GS A0A1G4KM79_9SACH/18-576     AC A0A1G4KM79.1
#=GS VATA_YEAST/284-736          AC P17255.3
#=GS VATA_YEAST/284-736          DR PDB; 1LWT A; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1JVA B; 284-736;
#=GS VATA_YEAST/284-736          DR PDB; 1GPP A; 1-183;
#=GS VATA_YEAST/284-736          DR PDB; 1UM2 B; 284-736;
#=GS VATA_YEAST/284-736          DR PDB; 1JVA A; 284-736;
#=GS VATA_YEAST/284-736          DR PDB; 1UM2 C; 738-741;
#=GS VATA_YEAST/284-736          DR PDB; 1VDE A; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1EF0 B; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1UM2 D; 738-741;
#=GS VATA_YEAST/284-736          DR PDB; 1UM2 A; 284-736;
#=GS VATA_YEAST/284-736          DR PDB; 1EF0 A; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1VDE B; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1DFA A; 1-453;
#=GS VATA_YEAST/284-736          DR PDB; 1LWS A; 1-453;
#=GS I0K7N6_9BACT/253-341        AC I0K7N6.1
#=GS A0A2V5HZ81_9EURO/1524-1666  AC A0A2V5HZ81.1
#=GS A0A163X063_9RHOB/4-67       AC A0A163X063.1
#=GS A0A1Y1WCU2_9FUNG/283-740    AC A0A1Y1WCU2.1
#=GS A6QC64_SULNB/206-309        AC A6QC64.1
#=GS A0A0P0YNX5_9PHYC/116-216    AC A0A0P0YNX5.1
#=GS A0A015K856_RHIIW/300-422    AC A0A015K856.1
#=GS I0AHG6_IGNAJ/229-328        AC I0AHG6.1
#=GS A0A397UUE2_9GLOM/514-753    AC A0A397UUE2.1
#=GS A0A109UZ17_9SACH/284-669    AC A0A109UZ17.1
#=GS A0A177WQP4_BATDL/623-743    AC A0A177WQP4.1
#=GS R9TRF4_9CAUD/87-211         AC R9TRF4.1
#=GS A0A1R0GMB9_9FUNG/596-1090   AC A0A1R0GMB9.1
#=GS G0VEY7_NAUCC/1-459          AC G0VEY7.1
#=GS F4CAE7_SPHS2/1925-1979      AC F4CAE7.1
#=GS A0A0L0G4G6_9EUKA/50-124     AC A0A0L0G4G6.1
#=GS A0A1L0DCU1_9ASCO/284-333    AC A0A1L0DCU1.1
#=GS A0A1R4H588_9GAMM/230-327    AC A0A1R4H588.1
#=GS G8DCS3_9VIRU/539-615        AC G8DCS3.1
#=GS W6MUU9_9ASCO/244-764        AC W6MUU9.1
#=GS G8ZQA6_TORDC/1-457          AC G8ZQA6.1
#=GS A0A2U3D5S9_9BACL/274-372    AC A0A2U3D5S9.1
#=GS A3LP04_PICST/283-730        AC A3LP04.2
#=GS A8BML4_GIAIC/5-439          AC A8BML4.1
#=GS A0A0D2H4V5_9EURO/358-833    AC A0A0D2H4V5.1
#=GS G8ZLC3_TORDC/1-463          AC G8ZLC3.1
#=GS A0A167X1Y2_9PEZI/262-747    AC A0A167X1Y2.1
#=GS G0WFK1_NAUDC/1-463          AC G0WFK1.1
#=GS S4TRC9_9CAUD/34-122         AC S4TRC9.1
#=GS A0A2T9YGN6_9FUNG/596-1085   AC A0A2T9YGN6.1
#=GS A0A2T9YGN6_9FUNG/1895-2001  AC A0A2T9YGN6.1
#=GS A7TIB9_VANPO/1-463          AC A7TIB9.1
#=GS A0A1G4MEZ8_LACFM/12-541     AC A0A1G4MEZ8.1
#=GS N1J5L1_BLUG1/1500-1624      AC N1J5L1.1
#=GS A0A0A7LLQ8_9BACT/244-331    AC A0A0A7LLQ8.1
#=GS J4U3C4_SACK1/1-464          AC J4U3C4.1
#=GS A0A255Z8B3_9FLAO/232-328    AC A0A255Z8B3.1
#=GS R9TND4_9CAUD/87-211         AC R9TND4.1
#=GS C1H7Q2_PARBA/1525-1605      AC C1H7Q2.2
#=GS A0A0L0G3W8_9EUKA/49-159     AC A0A0L0G3W8.1
#=GS A0A0J9XBH9_GEOCN/191-601    AC A0A0J9XBH9.1
#=GS A0A318ZZU1_9EURO/1524-1635  AC A0A318ZZU1.1
#=GS A0A1G4JMS3_9SACH/285-731    AC A0A1G4JMS3.1
#=GS A0A1Q5SSI5_9EURO/1524-1603  AC A0A1Q5SSI5.1
#=GS C6JQ04_FUSVA/2-124          AC C6JQ04.2
#=GS A0A177WDJ3_BATDL/1297-1751  AC A0A177WDJ3.1
#=GS Q6FQS3_CANGA/285-698        AC Q6FQS3.1
#=GS A0A0N9R2V4_CEV01/649-739    AC A0A0N9R2V4.1
#=GS B8FA79_DESAL/3543-3591      AC B8FA79.1
#=GS A0A1V2LD80_CYBFA/284-778    AC A0A1V2LD80.1
#=GS A0A345J3R8_9PROT/205-303    AC A0A345J3R8.1
#=GS A0A372RW14_9GLOM/638-1022   AC A0A372RW14.1
#=GS G8JWX2_ERECY/284-671        AC G8JWX2.1
#=GS A0A437MC52_9PROT/38-115     AC A0A437MC52.1
#=GS A0A1G4KM81_9SACH/10-538     AC A0A1G4KM81.1
#=GS U9W5T1_9CYAN/226-319        AC U9W5T1.1
#=GS A0A126PB81_9BACT/246-324    AC A0A126PB81.1
#=GS E1F2U6_GIAIA/5-439          AC E1F2U6.1
#=GS A0A0N9R0K9_CEV01/529-934    AC A0A0N9R0K9.1
#=GS A0A2I7R1S6_9CAUD/377-498    AC A0A2I7R1S6.1
#=GS A0A411BAQ8_9CAUD/87-212     AC A0A411BAQ8.1
#=GS R5PFQ2_9BACT/260-341        AC R5PFQ2.1
#=GS A0A317XTZ4_9BASI/279-707    AC A0A317XTZ4.1
#=GS A0A0J9X536_GEOCN/284-719    AC A0A0J9X536.1
#=GS K9YRK7_DACSA/214-315        AC K9YRK7.1
#=GS A0A2I1GLX1_9GLOM/408-602    AC A0A2I1GLX1.1
#=GS A1ZUM1_9BACT/19-89          AC A1ZUM1.1
#=GS A0A0C7N7Q2_9SACH/10-529     AC A0A0C7N7Q2.1
#=GS L1KI73_9ACTN/223-281        AC L1KI73.1
#=GS A0A0J6WV84_9FIRM/33-158     AC A0A0J6WV84.1
#=GS A0A1S5V145_MIMIV/737-1126   AC A0A1S5V145.1
#=GS A0A2T9ZE01_9FUNG/1894-2011  AC A0A2T9ZE01.1
#=GS H2APW1_KAZAF/284-774        AC H2APW1.1
#=GS A0A1E1GE23_9CAUD/386-498    AC A0A1E1GE23.1
#=GS C5M9I6_CANTT/244-713        AC C5M9I6.1
#=GS C5DTQ4_ZYGRC/1-463          AC C5DTQ4.1
#=GS J7RZB8_KAZNA/1-458          AC J7RZB8.1
#=GS A0A1V8TSS6_9PEZI/1542-1678  AC A0A1V8TSS6.1
#=GS A0A431TXW0_9BACT/240-336    AC A0A431TXW0.1
#=GS A0A1G4JPN0_9SACH/284-666    AC A0A1G4JPN0.1
A0A291AX64_9CAUD/34-123                ............................................................................................................................................................................................................................................CLKINTKIIMFDGSI.KHVQDVVVGDLLMGPD...S....T.....PRRVL..S..L..G...R.GR..E.M.MYEVTPVK.GD---.----............--PYTVNESHILSL.R....T.T..T...G.....T.R......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nktwpdntvfdiplk....................................................................................................................................................................................................................................................................................................................................
A0A2H5SJ84_RHIID/636-1015              ............................................................................................................................................................................................................................................CFGKGTPILMYDGSV.HAVETIQTGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.L.LYKIIPIN.NSSA-.----............-QPFVCNDAHILVL.R....I.T..S...S.....P.Y......I.....Q.H.Q.K..R.K......G.Q..--.....FCLN.Y..FIYNNNTN.LV.......K.KTNIFY...K.YPT...SQFQTKY...HA...KR.....A.A..IKS...LEMLNSD......KI..PN........L..FYQSV.N.SnADL............K..IIrG.DFIWQPSV..T.Q..FL......N....C......S.....SE..VQ...SAA..NMFTpnkvrfsvregtfakiieriigspitnniikfyawligywigtdfvmsndnhdivaslfgelgilrrkdipeimmyedid...................................................................................................................................................................................................lvrlpllagiidskglcipqedvieltltdvcnaknfvkisrscglqasisdpqnkcilhkasiipsvlfrsnckindhkHDQLWGF..QIKE.L.G.VGEYFGFVV-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A2T9ZE01_9FUNG/596-760               ............................................................................................................................................................................................................................................-FGKGTNVILSNGQI.KPIEEISIGDTLLGDD...G....Q.....ICSVV..S..T..T...K.GK..S.P.LYRVSPHScFEYLP.KGICra........ewDNGFVVNPNHELVI.F....F.R..D...F.....P.K......I.....K.I.D.N..-.E......Y.P..GY.....LSLS.F..VQLTYDDN.L-.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------givipkvskelirvtdfdhkdgtcakrslekaldelsdsnvkaeivndsinrk..............................................................................................................................................................................................................................................................................................
A0A1S8W8Q5_9FUNG/814-1285              ..........................................................................................................................................................................................................................................ir---------MPCGAT.RSIEGLSAGDQVMGVD...G....S.....VRRIK..D..T..M...K.GE..D.D.MFCVVILS.DGFVQ.DNGSvvtt...anvwkPSQFTCNSRHDLII.A....A.P..L...-.....L.D......V.....V.A.L.K..I.D......D.D..LC.....HAIV.W..FAEIQPSS.SI.......V.GVESQY...A.TVS...RIFSWSA...DS...GEfsmksD.A..VLA...AKIFAGK......RQ..EL........Q.pIYWTV.P.T.RQF............A..AF.A.RAMPLVAQ..D.-..MR......M....V......R.....AA..VS...KFP..SVASsadlksvsktafnsvgadsatraltdaklgaigylfgswlcvgvqespmlsldmrqsefltlvvatashmdmkvtcspavegvtrvllesmdgvssfdhlllreigcllfsrnpisme.......................................................................................................................vrdffvsqsqsfrihllagiidaggiivpqllstnspsrwfsvskngsldgvqdlmllardtarslgfhcdvvsgctfdsasnddtltffiggrsgdaipcnlhinktvgcdsssvkpSDVLVPF..SIAE.K.G.HGPYFGFELE..ASVScapPY..FLLDSFIVV-...................................................................................................................................................................................................................................................................................................................................................
A0A088F962_9CAUD/34-125                ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdw..................................................................................................................................................................................................................................................................................................................................
A7TLB5_VANPO/284-715                   ............................................................................................................................................................................................................................................CFAKGTEVMMADSSI.KNIEDIEIGDLVMGQD...G....Q.....PREVT..Q..L..P...R.GS..D.K.MYKVNEIN.ENSTS.---E............LFSFVCNATHQLIV.R....T.P..R...N.....I.K......V.....Q.T.R.I..I.D......G.I..EC.....NEIV.Y..TDLFKEIT.ED.......A.RIIELI...K.EVS...KIYP-VS...EG...MD.....D.-..---...VQEFVSQ......YN..KSl......eD.yFQWTV.E.P.RDI............N..RL.T.ESIREATY..Q.V..YA......P....V......L.....YE..CE...NLL..QYLKntkynlneksptalayllglwtgsgmtrraglsvsttdeslmnnivaaadllnlksefkqertttrvgnvnfygnststnqnvdnllwdaiqelgfiqdgnktv..................................................................................................................................................psflssdlieiretflaglidsngsvdnnkqdisctielednkvmsgivslirslglkadvtqssgklndvcynvtvkggellksvlsrcsainytkcesrdllrEPVEFYF..ELQE.L.E.EAEYYGITLP..EYSD...HQ..FMLSNQVVVH...................................................................................................................................................................................................................................................................................................................................................
A0A1R0GMB9_9FUNG/1913-2055             ............................................................................................................................................................................................................................................CFAFGTKVMMSDGSD.KNVEDIVNGDKVMQDI...G....S....vPRTVL..K..T..C...V.GR..D.S.LIKASFSS.PD---.----............MGGFYCTGNHILVL.I....S.T..Q..sS.....V.S......M.....G.R.-.-..I.S......G.E..-E.....TFVT.Y..YDSELNKF.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------qrtfvnsdkartfisgldlevgsvfeisaenflkkskhnpsik........................................................................................................................................................................................................................................................................................................
G8BNB8_TETPH/284-799                   ............................................................................................................................................................................................................................................CFAKGTKVLMADGSD.KSIEDIAIGEQVMGKD...G....A.....PRSVV..G..L..P...R.GQ..K.T.MYHVKHTTqHKKSD.QEVG............LMDYVCSGNHKLVL.R....T.P..Q...L.....I.S......T.....A.T.N.R..L.N......G.K..LY.....TSVT.Y..FALEDSIY.GK.......-.----IV...K.KKT...NTYEHSA...HG...GK.....Q.E..AAR..kASEFVSS......LD..MQ........P..IDWDI.E.A.SDY............N..HL.G.YFVKKSTF..Q.M..IN......P....I......F.....KE..SG...NLA..SKLEklgfegslapkiawmlgfwvgagninqsefsidpsgtqlvdrisevgkyfnlttatskhysrvfskaqeeveiaklnngkieadgsivfdddiegtpseeelieiemssdaskassndasfarvngngslectdlsvilrdsvan................................................................qakrennpfwnfveslcvksknipslnesfekhipfelsydnmevreqfiaglidatgsvkkdkasnstkatvatafkgvaeglvriarslgikvyvtaekncmdkndvkhqlyysislsgealssslrfcsldrnvaslspffnrEAVPFYF..TLEE.Q.E.EDQYYGVTLP..DSTD...KQ..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
U7UMX0_9FIRM/43-169                    ............................................................................................................................................................................................................................................CHAIGEKVLLADGNI.KKVEDVQLKDCLLGSD...G....T.....PRHIL..Q..I..I...H.GE..G.Y.LYKICPVK.G----.----............-KPFVVDENHMLTL.K....R.T..Ke.sN.....H.P......V.....Y.P.S.E..K.H......G.G..EI.....IDVS.V..KEWLTWSK.WK.......K.HIHKLI...R.ADA...ITFYHSH...QN...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dypi...............................................................................................................................................................................................................................................................................................................................................
S6E2M2_ZYGB2/284-738                   ............................................................................................................................................................................................................................................CFAKGTEVMMHDGSV.KAIETIEAGEAVMGTD...G....Q.....PRKVV..G..L..P...R.GR..E.V.MYKVSQKT.AHRVH.KTDEtra.....apvaLFEYNCNATHKLVV.R....T.P..R...S.....C.R......S.....I.T.R.K..M.Q......G.V..DY.....NEVI.F..FDLKKKKL.ED.......G.REIEIV...K.EVS...RSYP-AA...EG...AE.....K.A..AQM...VKDYYDA......AR..GK........E.fFEWTI.E.A.RDV............G..EL.G.AHVRKATH..Q.V..YA......P....V......L.....YE..SD...FFF..HYVKnskfalrseastalayllglwvgdglsdravlsvdsedsslleritgyadildlsaeykdreipkraktvclypktirgndirrnlntdnpvwnaivdlgylkdgvknvp.......................................................................................................................................sylfsdsichrevflaglidsdghvrgddglsvtiktihktvmegtvavarslglivsvnteeakidkndvnhrfvyaiyisggdallsvlahcaaakkfrappsnevvrGLKKVFF..EMEE.L.K.EDDYYGITLA..KESD...HQ..FLLANQLVVH...................................................................................................................................................................................................................................................................................................................................................
A0A2Z6QPC9_9GLOM/530-911               ............................................................................................................................................................................................................................................CFGKGTPILMYDGSV.RAVETIQAGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.L.LYKIIPIN.NSSA-.----............-QPFVCNDAHILVL.K....I.T..S...S.....P.Y......I.....Q.H.Q.K..R.K......G.Q..--.....FCLN.Y..FIYDKKTN.LV.......E.KANRFY...K.YPT...SQFQTKY...HA...KK.....A.A..IKD...LEMINSE......KN..PNls...insN..ADFEI.V.R.RDFiwqp...svtqfL..NC.S.SEIRSASN..M.-..FT......Pn..rVr....fS.....IR..EG...TFA..KIIEriigspitnniikfyswltgywigtnfvmsntkfenenqdivvslfdelgilqrkdipeimmyedidlvrlpf................................................................................................................................................................................................................lagmidstglynsqddvtevtlmndynvknfvkisrscglrvsvsdpqnrcivhkasiissvlsrsnckindhkHDQLWGF..QIKE.L.G.VGEYFGFVV-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A2T9Z5W9_9FUNG/1924-2030             ............................................................................................................................................................................................................................................CFAIGTKVRMNDGSD.KNVEDIVVGDLLEPDM...G...tT.....PRRVL..K..T..C...K.GQ..E.E.LIQIDFDS.SE---.----............MEGFSCTKNHILVL.L....P.T..D..gA.....F.K......V.....T.H.-.D..T.-......-.Q..GC.....VDVS.Y..YD------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------edlnyiseqykng......................................................................................................................................................................................................................................................................................................................................
F4CAE7_SPHS2/2071-2128                 ............................................................................................................................................................................................................................................CFIAGTQVLLIDGST.KPIEQVQLGDKLLGMD...G....Q.....INEVI..G..F..D...H.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------pllgnrklyalnkgdy...................................................................................................................................................................................................................................................................................................................................
A0A229Z4L1_9EURO/1526-1642             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.IEVQDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...S.GE..D.R.LYRIKIDG.-----.---S............VEDLVVTPNHILVL.H....R.E..K...K.....A.R......N.....N.E.D.D..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------elpevsaaesydtvemtaeefaalsteergryrafr...............................................................................................................................................................................................................................................................................................................
A0A432VA30_9RHIZ/34-147                ............................................................................................................................................................................................................................................CHAAGTRILMYDGST.KPVERVAANDNIMGPD...S....K.....PRRVL..R..T..I...A.GR..E.P.MYRITPKK.-----.----............GEPFVVNENHILSL.K....T.T..N...E.....G.K......K.....A.D.R.H..P.N......S.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------hrragevenisvrdylqksrswkhlrklwrv....................................................................................................................................................................................................................................................................................................................
A0A368JMP7_9BACT/247-348               ............................................................................................................................................................................................................................................CLGKGTKVVMFDGTL.KKVEDVQAGDLLMGDD...S....T.....PRRVL..S..I..A...R.GQ..E.R.MFWVRQNH.-----.----............GIDYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egshqrgdvlnitvrdyltkstkfksnyk......................................................................................................................................................................................................................................................................................................................
A0A248SJG5_9CAUD/367-530               ............................................................................................................................................................................................................................................CLVADTDILT-DNGI.KSIQDFEVGDKVLSSD...G....Q.....YHDVI..Q..T..W...H.YQ..K.E.TYEIELED.-----.----............GTVFECSPEHKFLV.K....D.D..N...N.....E.Q......V.....W.K.-.E..I.Q......I.M..SE.....NDVV.Y..TYSENKLV.LK.......V.KSITKT...N.NIK...DVYDIQV...ED...TG.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------eyiladnnvvshnsgqifassivvaskklklktddegnktsev........................................................................................................................................................................................................................................................................................................
X5JM31_9CAUD/34-127                    ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdwlk................................................................................................................................................................................................................................................................................................................................
B9XA08_PEDPL/492-603                   ............................................................................................................................................................................................................................................CHEKGAMILLADGSV.KKVEDVRVGDELQGWD...G....T.....PRRVL..E..L..R...R.GQ..D.E.MMRIVPTK.-----.----............GEPFVVNINHILTL.V....R.T..N...K.....S.R......N.....E.A.S.K..A.T......-.-..-V.....IDVS.V..KDW-----.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lswnttqkhihklfrvpvqwp..............................................................................................................................................................................................................................................................................................................................
W8YS26_9CAUD/34-125                    ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdw..................................................................................................................................................................................................................................................................................................................................
A0A1E3P9G0_WICAA/599-963               ............................................................................................................................................................................................................................................CFAKGTDVIMYDGSD.EKIENIRVGDRVLGKD...G....T.....SREVV..A..L..P...R.GN..D.T.MYKVTQKS.SK-AD.--VS............NISFTCNATHLLVV.N....T.P..Q...S.....I.K......L.....I.E.D.N..V.N......G.K..TC.....TQVA.Y..FDMANEVV.DR.......-.RPIKIV...K.EQI...KSFEHEL...FG...GA.....SkA..FEQ...ATLFMSS......LN..RE........G..FEWTI.E.A.RDY............K..LL.Q.TSVQRATR..Q.M..IS......P....C......L.....LE..TN...HIE..QSLVkrgvsqestpafayligllaaqdskakefasknnfnetiqelantykslpsqlsydnieireyvlaalid.......................................................................................................................................................................................................................sngkvgqqntviettdvevrdsmvklarslairasaqessvtlsgealssvlnkctvagkqlaemrsierKAEAFQF..SLKT.A.G.TDDYYGITLS..DESD...HQ..FLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A097EW01_9CAUD/539-615               ............................................................................................................................................................................................................................................CHAPGHPIMLANGLV.KAVEDVQVGDRLMGLD...G....S.....PREVL..R..L..A...H.GS..E.E.MFRVVPTH.-----.----............GESFVVNLGHILPV.R....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ightdvvi...........................................................................................................................................................................................................................................................................................................................................
A0A1Y5RRB6_9RHOB/32-131                ............................................................................................................................................................................................................................................CHAPGTLILMHDGSV.RPVEDIAVGDVLMGPG...S....T.....PRHVL..E..L..H...R.GR..D.Q.MFEVRPLK.GD---.----............--PFVVNLGHILTLvR....T.N..E...G.....H.N......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------krgtnregqlvdisiadwlaasdh...........................................................................................................................................................................................................................................................................................................................
G0V8Z3_NAUCC/284-799                   ............................................................................................................................................................................................................................................CFAKGTEVLMADGSD.KAIEAIEVGEQVMGKD...G....A.....PRTVI..A..L..P...R.GT..E.T.MYEVCHTT.QHRNG.NEKF...........gLMNYVCSGNHKLVL.R....T.P..Q...L.....I.R......T.....T.I.H.E..L.R......G.K..HY.....TSVT.F..FVTEKSAN.GT.......-.----IV...K.QRT...KTFQHEF...HG...GE.....E.A..ATK..lAADFAST......ID..PK........H..IDWDI.E.A.KDY............K..QL.D.HYVKKSSY..Q.M..IN......P....V......F.....KE..SG...NLA..NILGdagiektlaakmawllgfwvgnghmetaqfpvdswdtqlvdriseygkhfnlttttenhyrsnhvesnkdieifemneaqieeaeqtgvvafdsnrkgdpsetelieaeifnesrpstaglftpaaispaslvtdlsvtlrgtgi................................................................ggagvskernlnnifwdivtsfgvrtngqgstyeksvplhlsyddievreqfiaglidsdgyvksadnrfsatvttiykgvseglirlarslgirvsvstekehvdknnvkhkscyrvflsgealigvlrfcaldrkrtafkeftrEAVPFYF..TLQE.K.D.QDEYYGITLP..DETD...KQ..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
B6JY11_SCHJY/285-759                   ............................................................................................................................................................................................................................................CFAKGTEVLMANGAD.KKIEDVVIGDKVMGKD...G....R.....PRDVV..A..L..P...R.GF..D.T.MYTVSQKI.SRKGA.KSSN............NLSYTCNATHKLVL.K....T.P..Q...Q.....I.S......L.....V.E.Q.V..V.R......G.K..KQ.....SSVS.F..LRLADVVV.GSsr..ggdR.RRIQIV...K.KVT...KSFQHEP...RG...VE.....K.A..REL...AMEFLST......IG..DD........D..IYWTI.E.A.RDY............T..LV.S.QEVRELTQ..Q.M..IS......P....V......L.....FE..KA...DLQ..NRLVkrgisakyaseaayllgvwvgagfsrssafslyeedselvsriisfgkalglkavtaehnprtvkivrgelgvdgtftsevedlvevvdfqegseipaweqrgnlsvsfegntdnvfwkli.................................................................................................................sdlgfsgavksipshfayesfpvreaflaglidadgsvkhgdlssahlsttspkvrdgtvriarslgisayvstkseqivdgvyypetytielegnealqsvlsksalssnvapapgsferKAVPMYF..DLGI.T.T.PANYYGVTLA..EDSD...HQ..FLLSNLTLVH...................................................................................................................................................................................................................................................................................................................................................
A0A3P3VNX0_9GAMM/62-105                ............................................................................................................................................................................................................................................CFIGCTRILMADGSY.RAIKDIRVGERVVGES...G....Q.....INRVV..Q..I..E...R.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------vp.................................................................................................................................................................................................................................................................................................................................................
A0A1E5RAR2_9ASCO/285-785               ............................................................................................................................................................................................................................................CFTKGTQVMMANGED.EAIENIQVGDFVMGKD...G....L.....PRKVI..G..L..P...R.GN..D.T.MYEVSQLTgNRRDA.EIHD............LMDFVVSSDHKLVL.K....T.K..Q...N.....I.K......V.....A.T.R.S..Y.N......G.N..SF.....SSVS.Y..FALEANKS.G-.......-.--IDMV...K.NKT...KVFGHHV...HG...GK.....S.G..ADE..kAAAFVAE......LD..AQ........P.fIEWVL.E.A.KDY............Q..QV.S.ANVKANTT..Q.L..IN......P....V......F.....YE..SG...KLG..QLLEsngysknlapemayllgswvgngtmksaqfsidpkdtsfvkkineyaqnfdlssysnddhhcyssnsnatgspatneyqffvekigasqdengdftfdadfesgneletsesslvswtekgdltvtfetaethgkt..................................................................................vrknnxgsnifsriaesfgvktqtkcvpkhlaiddikvrefflaglidadgcvrenqdgsksasittvhksvsegvvrvarslgievsintederidsqgvrhqfsycvslngaplagvlqnsalernstnsvtvxrKPVSFHF..DLTE.AaE.KQDYYGITLD..ESSD...HM..YLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1S1Y7K3_9GAMM/229-309               ............................................................................................................................................................................................................................................CFGKGTRILMYSGEL.KAVEDIQVGDLLMGDD...S....T.....ARGVL..S..L..A...R.GR..E.E.MYWVRQNK.-----.----............GLDYRVNASHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egkhrngd...........................................................................................................................................................................................................................................................................................................................................
A0A017SN98_9EURO/1524-1665             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.VNVEDVREGDELLGPD...G....T.....PRRAF..N..I..V...N.GQ..D.R.LYRIKIDS.E----.----............IEDLVVTPNHILVL.H....R.E..N..eT.....V.E......I.....T.A.E.E..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------faaleaaersqyraprtfpeqwnqasgdivaqapsffikdisleaettewagfrvdkdql.......................................................................................................................................................................................................................................................................................
G7E5L8_MIXOS/284-742                   ............................................................................................................................................................................................................................................CFAKDTAVLMADGTE.KPIQDVAIEDEVMGKD...G....C.....GRVVV..G..L..P...R.GV..E.T.MYDVAAIG.QHHNQ.AENG............LLNFTCNASHKLVV.C....T.P..Q...H.....V.R......L.....T.D.H.M..L.G......Q.K..MQ.....TSVS.Y..FVMGQERV.SA.......D.RVISAV...T.LRM...RSWQHEL...HG...GH.....R.A..ARV..kAEAFKAS......ID..KD........E.iFNWTI.E.A.QHV............A..AL.N.MHVRKATQ..Q.T..IS......P....V......L.....HE..NH...RFG..DILSqhgldpqldarvaylvglwlgsgssdepaltiasndaktveridslcsalglvasvsdehhrakiarvqenvahsaataddqklhrdlhikivadggetshnvfwttlsengfr..............................................................................................................................gasakepkavpswvasepfgvreafvagmvdsagqvkaskdramrrnvdiltghasvcdglvrvarslgirvsasmqavnayavflsggeviqsmlslcavecnraarpegpvkrPGQSFNF..TVTK.T.D.QAPYYGITLA..DDTD...HK..FLLGNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1G4IPL3_9SACH/15-597                ...........................................................................................................................................................................................................................................w-FAEGTKMILFNGET.IKVEELIPGSQLLWAD...G....S.....YRFID..D..V..F...R.AN..D.N.LYHLTQYT.KHRAH.KLDPsrp.....epfgVFRMVCFERAVLSL.Q....T.G..I...H.....A.R......V.....S.Y.D.K..R.R......-.-..DV.....KLLR.F..SKLRDHLT.DN.......G.RVIKML...K.WTE...ESFPVDT...P-...NS.....V.L..VDL...VKKFREA......TG..KK........F..VEWEC.E.I.GDL............K..YL.I.NDIRASTR..L.L..LY......P....I......P.....FE..IP...TLK..PWLQrtferevsdreleamswmlgfwigdgcragalfalnmedndvngmleenakiwgmsyekrkyansglsafaalhtpkadgkgrnwnvknpfvavlrglkfykngllngpknipefmrvdqllvrkcfmaglidsdgyssvaddflsakvssvyppirdgilficrslglnvsvsfcpahrdekrgineadiwnflitsgtnrgillsilqrcshgrkkdppifhynktpsneadayarrpkrylnlsepisnlenesisdksmtgstavddvsfsecenefdsnteieqeqtvsetgfgcfdlaidleeiqletdltetdpdiveldlgldadisktfdepyfendgdrdyasfnNSRQFFK..TAPM.N.Q.KGTIYGIQL-..----...--..----------kergiltesqivy......................................................................................................................................................................................................................................................................................................................................
A0A2M9BSG3_9BACT/244-341               ............................................................................................................................................................................................................................................CLGKGTKVLMYDGTL.RNVEDVREGELLMGDD...S....T.....PRRVL..N..I..A...R.GR..E.R.MYWVRQNK.-----.----............AEAYRVNESHILSL.K....R.S..R...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------tegphrhgdvlnitvkdwlsksekfr.........................................................................................................................................................................................................................................................................................................................
F9ZMR9_ACICS/472-579                   ............................................................................................................................................................................................................................................CHAKGHPILMADGTI.RPVEEVRIGDRVMGPD...G....Q.....PRTVL..T..L..H...R.GL..S.D.RYRIVPIK.-----.----............GEPFVVNGDHILSL.K....R.G..H...D.....V.P......S.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rageicnisvrdylrksltfrhyhklyrcavr...................................................................................................................................................................................................................................................................................................................
A0A411AV32_9CAUD/8-122                 ............................................................................................................................................................................................................................................CHAKGTEVLMFDGSI.KKVEDVVVGDKLMGPD...S....K.....PRNVL..F..L..C...R.GR..E.S.MRKITPTK.-----.----............GEPFVVNASHVLHL.K....K.V..A...S.....G.S......K.....Y.P.S.Q..K.H......G.Y..ID.....EKVS.E..FES-----.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ssqwhkhthklcragvqfpea..............................................................................................................................................................................................................................................................................................................................
S6E6E8_ZYGB2/1-463                     ............................................................................................................................................................................................................................................MFEEGTKLILANGHV.KDITAIETGTYLMCED...G....T.....AAKVT..S..V..S...R.DV..Q.T.TYQILQKT.KHRAN.EGEAakndplrkqiyhRLGFKCSVAHELAL.R....T.S..T...K.....P.T......V.....E.N.S.F..A.R......Q.H..--.....FKVR.W..KNMEEHLT.LD.......G.RVILLP...K.SHH...KDFPMTP...EG...QQ.....A.-..---...ARAFLAE......KE..AVy......gK.fVEYTI.Q.V.RDL............D..LL.E.AQIRVNSF..L.R..FN......P....V......L.....TG..SG...VLS..EFLTgqkglnspavltmawllglwmgdgttkepeisvdshdtslmegliergkiwglhpeykdeeiplrakhvklyygcapeehrrnrhlrkhnpfwttvvglkfkraldgekqipsf...............................................................................................................................mwtedievreaflaglidsdgyvskhkdpsdsykvsiqtvypsimggivhisrslgmpvtvttrsakvativgrtvnchftydchiagrtpmqkvlsycrsghkvkaspefverTPIYFGF..NEEK.R.E.SHNVYGVTI-..-DSN...KK..ILLDNKVVVH...................................................................................................................................................................................................................................................................................................................................................
F8XU21_9PROT/162-253                   ............................................................................................................................................................................................................................................CHAKGTEIMMADGSL.KKVEDIRVGDQVMGPD...S....S.....PRNVL..R..L..H...R.GI..D.K.LYRVTPNK.GD---.----............--AFVVNGGHVLAL.E....G.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------gptpngerkmlfstvrdamekm.............................................................................................................................................................................................................................................................................................................................
A0A0B4ZZT7_9CAUD/308-349               ............................................................................................................................................................................................................................................CFPAGTMVLMADGTQ.KLIETIQVGDQVMGWD...G....Q.....PDEV-..-..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dlmey..............................................................................................................................................................................................................................................................................................................................................
J7RJ26_KAZNA/284-757                   ............................................................................................................................................................................................................................................CFERGTEVLMADGSD.KPIEQITLGEKVMGKD...G....S.....PRTVV..G..F..A...P.RV..R.T.YVRRAATRrPRLGD.----............--AVHLSGNHRLVL.R....T.E..Q...K.....I.Q......L.....R.E.H.T..L.E......G.R..KY.....TNVS.Y..FALQESEH.GP.......-.----VV...K.RLA...KAFDHSV...QA...GS.....S.A..A--...AQAFAHT......ID..TA........P..IEWDV.L.A.SEF............V..KL.G.DRVRAASV..Q.L..IN......P....V......F.....SE..SH...HLS..TRMQalgsddalasklawllgtwvavgdvnasesattfslsvgthaalldriseygkalglstttverqnrhyvdreteeaevakiktgsvqedgsvvfeddvctkhdgnsaqslqvtmdiddlaisltgelg.................................................................................................nildrivksfgvrvakegnsdlfertvpkhlasddlavrenfiaglvdsigyvdrhyggtvksatipaldmhavsgfvkvarslgikvsiadnndvekqcvtlsgdalvgvlsccadknkadtprsfarEAIPFHF..TLKE.Q.R.EDEYFGITLP..ETTD...NQ..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1L0DCU1_9ASCO/244-292               ............................................................................................................................................................................................................................................CFAKGTEVYMADGSE.KPIESIEIGEQVLGKD...G....A.....LSKCV..-..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lsrnrasesav........................................................................................................................................................................................................................................................................................................................................
Q6CL64_KLULA/284-692                   ............................................................................................................................................................................................................................................CFSKGTEVMMGDGKD.ELIENIQVGDEVMGRD...G....L.....PRQVV..G..L..P...R.GH..D.D.MYQVTEKS.ED---.NETA............KISFQCNSSHKLVL.V....T.P..Q...D.....I.R......L.....T.E.S.K..-.-......-.-..EK.....VTVA.F..NRLADISV.GNg....teS.RTVRLV...E.RAE...KSFANAE...SN...QA.....I.I..--N...AAEFVTT......ID..TT........S..IEWTL.E.A.RDM............L..LV.D.SSIREVTQ..Q.L..IN......P....V......L.....LE..KE...HLA..GVLKsndfqsslapqfsyllgafvgssgkdnseylqqlsaqfdkkivaeksidvqsngktvgtasivisqepvqenkrrkvaqvslvskivqesfss........................................................................................................................................................................gipsfmmseninvresflagivdsqnqklddtvalktlsvkthdgiarlarslgirvsgkkqnqeytltlsgdalksvsnwtstsniekvdvihKAQPISF..DLEK.I.E.SADYFGVTLA..EESD...HK..FLLSNMTLVH...................................................................................................................................................................................................................................................................................................................................................
A0A2T9Z5W9_9FUNG/2500-2748             ............................................................................................................................................................................................................................................CFEPGTLLRLFNGDI.VKAKDVQVGHKLIGDD...G....L.....SRNVL..K..V..W...S.GR..S.NlMYQVCQNN.-----.----............AIDYTVTPKHILVL.L....Y.N..G..fS.....P.R......V.....F.K.-.-..-.S......S.S..NY.....VKAE.Y..YDFNLKKH.SL.......-.-VIKVS...G.REN...SLFTKSI...KH...QQ.....I.I..RKL...SSKTRKS......RG..KF.......tN..NKFVV.L.D.NSL............D..NA.Y.KLARNWLQ..K.S..AK......R....T......G.....YA..KK...GMT..VEMMvsqyvklpvniqtllng.................................................................................................................................................................................................................................................................................................................................fkateefektqmasingEISKISI..KAIK.V.P.NQEFIGITT-..-DCN...QR..FILTDRTVVH...................................................................................................................................................................................................................................................................................................................................................
L0ASJ4_9CAUD/37-134                    ............................................................................................................................................................................................................................................CLGKGTPVLMYDGTI.TPVENIIVGDTLMGPD...S....K.....PRRVL..S..L..A...R.GR..E.Q.MYKVTPVK.GD---.----............--PYVVNESHILSL.K....R.T..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ntgrddkvgeienisvrdylnkskhwk........................................................................................................................................................................................................................................................................................................................
J0L3T1_9HELI/210-317                   ............................................................................................................................................................................................................................................CMSKGTKITLYDGTQ.LSVEKIKVGDLLMGDD...S....T.....PRKVL..S..I..T...T.GR..E.K.MYWIRQNK.-----.----............GIDYRVNESHILSL.K....R.S..R...N.....E.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------gkhkhgdilnisvkdyiqksdkfksnykgykvav.................................................................................................................................................................................................................................................................................................................
A5DXZ0_LODEL/280-699                   ............................................................................................................................................................................................................................................CFTKGTQVMMADGKD.KSIEDVQLGELVMGKD...G....D.....ARKVV..G..L..P...R.GF..D.T.MYKVEQIG.HD---.---D............SLNFTVSADHKLVL.K....T.E..Q...R.....I.E......V.....T.T.R.K..F.A......G.K..NY.....AAVN.Y..FAMGKTKK.SAg.....gK.DGVEIV...R.VKS...KVFAHHI...HG...KE.....V.A..ESK...ALEFAAS......VD..MS........A..IEWVV.E.A.KDY............Y.eQV.E.DTVKQNST..Q.L..IN......P....V......F.....YE..SN...AIG..KWLAdngetkpssaselaylmgaafnesresisdaatntkrtlenvefddlksvdssldlsmddgyetdntsihsvnekesvnvarllkqaldhfgfstgs................................................................................................................................................................nkvipssiavenievresflagfvdasqtelkqdsaiinigasnksiianivklarslgikaackddglnritlegpalagvlskcssssvdaksfarDAVPFNF..NLLR.S.A.KEDYYGITLS..ETSD...HM..FLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A2Z6SEZ6_9GLOM/413-846               ............................................................................................................................................................................................................................................CFAKGTKVLMYDGTH.KSVEELDIGNQIMGDD...D....S.....PRTIQ..S..T..T...K.GE..G.T.MYRIIPNN.KGPAK.----............--FFECNDQHILVL.K....F.A..A...K.....P.Y......V.....R.S.E.E..I.P......IvN..RS.....PRIR.L..FWYEYDVR.NN.......-.---MIV...K.KND...SFYYGPG...KD...YP.....K.K..EVA...KRAAMRE......IE..RRpnl..vtsD..FIWEV.P.I.KDF............L..TA.S.DEVQRSC-..L.M..FK......Pn..rV......I.....FKsvQG...RFR..VVLSeilrvnptdsqilaaswlvgawigggimnspaiyvneneneilkaigqysetlnwkfmkelqksisecsewkitfmddnnengflallqmlnildtkkvppaim...................................................................................................................................................tdeldqvrlpllagildisghlleengnckyvyesiqerceqicnlanlsgfystntvanmkecsnnittsshcaiisgnkldilplvvsrkkvlknhdhhkldRDMVWKF..KVEK.V.G.PASYYGFKV-..-DKN...ER..ILLADLTVSH...................................................................................................................................................................................................................................................................................................................................................
A0A1X7QY67_9SACH/284-788               ............................................................................................................................................................................................................................................CFAKGTQVMMADGTD.KSIEDIQLGELVMGKD...G....T.....PRTVI..S..L..P...R.GK..E.T.MYEVCHSS.AKGVA.-PST............LMNYVCSGNHKIVM.Q....T.P..Q...Q.....V.G......I.....T.E.H.G..L.D......NnK..TY.....TSVS.Y..FALTDSQH.GY.......-.---PVV...K.KVT...KSFEHQQ...LG...GK.....E.Q..TQL..lVNQFVAS......LD..AK........P..IDWDV.E.A.KHY............E..TL.G.HYVKKCSY..Q.L..IN......P....V......F.....QQ..SG...KLA..QQLNnfgyasslapqlgwllgfwvgngamrysqftiesqdivlitriqenasalgltattacyysgskdneaqlakinggkvqpdgtvvfeddlestptakelsdmdrlsesktatvatsfgvesidelvvtlgaadsrgnifa...........................................................................nivesfgidisdkdalpekianelahddfevreqfiaglvdangyvrkdvydhaseatvtttsnavveglvklarslgikivvttdaddeeeeghhdhahcghdhdsttftavmtgdaltnsmrfcalgrnkvvakeftrEAVPFFF..TLDK.K.A.EDDYYGITLP..DNTD...KQ..YLLSSMALVH...................................................................................................................................................................................................................................................................................................................................................
U7Q1H8_SPOS1/262-759                   ............................................................................................................................................................................................................................................CFAAGTPVMMSDGTI.QPVETIDLGDHVMGKD...G....T.....PRMVM..G..L..P...R.GT..E.T.MYKVSMKT.QHRNE.NAR-............LASFVCNASHLLVV.V....T.P..Q...H.....I.R......K.....T.T.H.V..L.R......G.K..KM.....TSVC.W..FDWHTAQA.ED.......G.RPVRLV...K.LFT...KSWDHDT...HG...GE.....A.A..ADA..kAAAFRSE......LP..SG........D..FEWSI.E.A.RDV............S..LL.G.THVRKATQ..Q.L..IN......P....V......L.....FQ..AG...HLS..QVLErhgyesgalemayllgfwvgdgyydraafavdardtaikgrmqeygsmfdlvvdtreykkymysnqaddkadptddspakearkvlgdlevnatlnrdetsptvkkgftgigdetiflrssgtfagagkrkplnt.....................................................................................gnvfwavanamgvrgpdgqhakvvpdvlmcepfevreqflaglidsdghvkhgppsatiktiytticdgvikiarslgvrvsvsteaatvvrgvshkkayavflsdpentgvlasilsrcalerkklpapaavnrKGQAMYF..DLEK.Q.A.PAKYYGVTLA..DNTD...HQ..FLLGNMMLVH...................................................................................................................................................................................................................................................................................................................................................
E0UKK2_CYAP2/364-429                   ............................................................................................................................................................................................................................................CFGKGTLVLMADGSA.KPIESIQIGDKVLSNL...G....-.....PRQVV..L..I..EkplR.AN..R.T.LYSINNL-.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nlfassahpfr........................................................................................................................................................................................................................................................................................................................................
A0A2H3NPZ9_9BACT/231-324               ............................................................................................................................................................................................................................................CLGRGTPVMMADGTV.KPVETIMVGDQLMGDD...G....T.....PRTVQ..S..L..A...R.GR..E.P.MYWVRQKR.-----.----............GIDYRVNESHILSL.K....K.S..Q...S.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egarargsitdipvheylqks..............................................................................................................................................................................................................................................................................................................................
A0A1D2VFN5_9ASCO/284-685               ............................................................................................................................................................................................................................................CFAEGTEVLMADGFD.KRVEDINIGDQVLGKD...G....K.....PRDVI..A..L..P...R.GT..E.T.MYKITQSN.KDKNE.NTYG............LTSFTCNSNHRLVL.Q....T.S..Q...I.....T.T......V.....S.E.-.-..-.-......-.-..--.....STVS.Y..FALEKEYK.-D.......G.RLIDLV...K.ENI...KSFENPQ...Q-...--.....-.-..---...ANDFATS......ID..SH........P..IEWTI.E.A.CDF............S..IL.N.SNVRNATQ..Q.L..IA......P....I......L.....LE..NN...ILQ..SLVEkydfdqsftqsiayllglwignghpskpsisvnpdnlqlinhvislanslglsitieksslecyitfykknssmntnvfwnivkdlglkhnksip....................................................................................................................................................................lffrsesinvreqilaglidsngtfsksyttisttdsylrdslvsvsrslglstsvntkkantyiikllssevlnsvlsksclaqskisasknivrKPVAFDF..TIQE.L.E.QAPYYGLTLS..DDCD...HQ..FLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A0R1VN30_9LACO/36-158                ........................................................................................................................................................................................................................................chsl----EQNLLMSDGSL.KNVKKINVGDELLGLD...G....T.....PRKVL..F..K..H...A.GS..E.Q.MYKIIPIK.G----.----............-KPFIVTENHKLTL.V....R.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ineksrrkypcdflngrlidvsvkeyltwsknkkhihklirsseiknfkgnkk..............................................................................................................................................................................................................................................................................................
A0A1S8VSS7_9FUNG/870-1291              ............................................................................................................................................................................................................................................CFGRDTPLIMADGSS.RVVQDIKASDELMGDD...C....T.....PRIVQegS..L..V...H.EY..G.M.LYRVTPDI.NA---.---G............HESFVCNGEHILVL.I....N.V..K...Q.....P.W......I.....S.T.T.T..T.S......D.H..--.....--VNtY..HACNLAIN.KE.......-.------...-.--N...RPYH-EI...SG...DY.....T.S..IDE...A--QISL......PP..WA........P..LLWEV.S.V.LDY............M..TV.D.AEIRENF-..M.I..YK......P....M......EgieypAS..AS...NLS..HIIQqectlssksdgaamwclglwlamgstdangkpvvplanvggissnnsivtalrahsenlemifptsidegvaditnddcvvfgdrlgklvdsvsvfgykgipnvl................................................................................................................................................mraskmhrsallaglmegtgqanvaksvvsawnlysknqelisdikrlasslglgvgaishtsdadefqdyhvcihgprldlinswisnplyhsdttasskpwdvaTSNSCSF..QISN.I.G.QGEYFGFTV-..QGPN...SR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
HO_YEAST/1-464                         ...........................................................................................................................................................................................................................................m-LSENTTILMANGEI.KDIANVTANSYVMCAD...G....S.....AARVI..N..V..T...Q.GY..Q.K.IYNIQQKT.KHRAF.EGEPgrldprrrtvyqRLALQCTAGHKLSV.R....V.P..T...K.....P.L......L.....E.K.S.G..-.R......N.A..TK.....YKVR.W..RNLQQCQT.LD.......G.RIIIIP...K.NHH...KTFPMTV...EG...EF.....A.-..---...AKRFIEE......ME..RSk......gE.yFNFDI.E.V.RDL............D..YL.D.AQLRISSC..I.R..FG......P....V......L.....AG..NG...VLS..KFLTgrsdlvtpavksmawmlglwlgdsttkepeisvdsldpklmeslrenakiwglyltvcddhvplrakhvrlhygdgpdenrktrnlrknnpfwkavtilkfkrdldgekqipef...............................................................................................................................mygehievreaflaglidsdgyvvkkgegpesykiaiqtvyssimdgivhisrslgmsatvttrsareeiiegrkvqcqftydcnvaggttsqnvlsycrsghktrevppiikrEPVYFSF..TDDF.Q.G.ESTVYGLTI-..-EGH...KN..FLLGNKI---evk................................................................................................................................................................................................................................................................................................................................................
A7IX33_PBCVN/439-828                   ............................................................................................................................................................................................................................................CLHPETDVITFSGTV.IKAKDLRPGMQLMGLD...S....T.....PRRVL..D..I..G...R.GR..E.M.MYEIVPIK.-----.----............GEPWKCNETHVLSL.I....Y.N..E...H.....G.S......I.....Q.K.T.K..-.-......-.-..--.....-SNT.Y..FVKFHEYT.SD.......G.RGVF--...-.---...-KYP--T...V-...--.....K.T..LKE...AQDIVAR......LN..PN........H..I-VDI.P.L.NEY............L..NL.P.KHVKNSLK..L.F.rSG......P....I......T.....FP..NKpepKFH..PYILgawlgdgksstaeitidvkekpllnhvsnllrplgmiaskrtgasslkrtdhyriqypdnnsrkgksnpfmdalksydlisnkhipddikcgsl......................................................................................................................................................................nvrlqilaglldtdgylggncfeitqknkrlsediafvarslgyaaylkmvkksctykgekkcgtyykvsisgeglekiptilerkcakprqqvkDARRTGF..TVRK.L.S.VGDYVGPVL-..-DKD...HR..YLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A0D2X4Y0_CAPO3/1840-1998             .........................................................................................................................................................................................................................................tap----DTLVRMADGSV.RAMGAIRVGDRVLGHD...G....T.....ARTAA..H..V..H...S.GR..A.A.MYRVRPAE.NKCGD.-ILY............DDGFECNGNHILVI.Sl..aP.G..A...G.....L.R......V.....A.D.D.E..A.G......A.R..GS.....YAAR.Y..TVLKVDAAlGA.......P.RPYEVE...K.RVQwnvANFARYA...DG...YS.....R.A..MAA...AEAYAST......CR..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------aqieaalgt..........................................................................................................................................................................................................................................................................................................................................
A0A2I9D0J9_9DEIO/333-389               ..........................................................................................................................................................................................................................................yy---------------.KNIEDVRVGDRVLNMH...G....Q.....PVTVV..N.sW..C...T.GI..R.E.VIAVRHVH.AP---.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------retlvtpdhrywv......................................................................................................................................................................................................................................................................................................................................
G0W3J0_NAUDC/284-783                   ............................................................................................................................................................................................................................................CFAKGTQVMMADGSD.KSIEEIQIGEQVMGKD...G....N.....PRTVI..A..L..P...R.GK..E.T.MYEVCHIT.PHRTT.SGENf..........gVMDYVCSGNHKLVL.R....T.P..Q...N.....V.T......L.....T.T.H.E..L.D......G.Q..TY.....TNVS.Y..FALEESAY.GQ.......-.----IV...K.KKT...KSYQHQR...HG...GK.....Q.E..TEK..kVNEFLAT......IN..PD........S..IEWDV.E.A.KDY............K..KL.G.YDVKKSSH..Q.M..IN......P....V......F.....KE..SG...NLI..AKLNelgfskeiapqmgwllgfwvgngsittssfsidsldtqlldriteygklfaltttsatnhcrnysgsgnqdielskinngkvetdgtitfdddterepseqelidmessgckassemtvalgaplvrgnairqllte.................................................................................nnvflkliesfgvrkengseyvkaipmhlsyddievreqfiaglvdsighvkrtsngtiecaaistayksvseglirlarslgikvsvttkrecldkhnvkhqicysiclsgatlsgalrfcaldknnanskkpfvrGPVPFYF..TLKE.K.D.EDNYYGITLP..DSTD...KQ..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1M6S312_9ACTN/2074-2144             ...........................................................................................................................................................................................................................................s-FVRGTRVLMADGSH.KAIEDIQIGEKVWASDpetG....Ee...gPRTVL..AtiV..G...E.GA..K.T.LVEITVDT.TTQ--.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------vdagtlg............................................................................................................................................................................................................................................................................................................................................
C1GAW5_PARBD/1525-1607                 ............................................................................................................................................................................................................................................CLAKGTLLLRYDGTK.VEVENVREGDLLLGPD...G....G.....PRRAF..N..I..V...G.GR..D.R.LYRIKMEG.-----.---G............KEDLVVTPNHILVL.H....R.E..K...R.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dgvdkvyar..........................................................................................................................................................................................................................................................................................................................................
A0A1X2HHI8_SYNRA/1333-1829             .........................................................................................................................................................................................................................................yga----GMPVRMADGST.RLIEDIKAGDLVLGSD...G....Q.....ARTVA..S..T..V...S.GT..A.P.LYRVKPSDyP-LKE.TGDDmd.......ilfEPGFLCNENHYLVL.R....L.PpiR...D.....V.RgpvydtS.....R.T.S.N..A.T......A.M..GY.....FGVR.C..YQLKYDEE.LQ......mE.RPFEVE...K.TIK...FDAARDA...DA...AS.....E.M..KDG...CPVFSSI......EE..AKqaaenyyeA..TEWTI.P.V.KEF............I..RY.T.EHMKATGR..Q.P..ID......C....E......M.....RY..SG...PIE..QWPIaathgglekvikeahqstsrpyagltsaecayiigvwlgggakdlpeftfagrepelekrieaiggkmgltitsessksesktgahrlslsscsdasreafrpidenaerstgnvsdnpllfil...........................................................................................................sklglltdkhvsdearelfvqesadvrrsllaglldtdgyasetgymlsqsitddksvlrlaydigrslglyttttpyevpdksyladvkesqrgvlrlggdvhllpcvlpknrfaqatvpseqRFRRFQV..RAEP.E.C.IDKYYGFQVA..DGQS...PL..F---------chgdfligh..........................................................................................................................................................................................................................................................................................................................................
I2GXM6_TETBL/1-463                     ..........................................................................................................................................................................................................................................ml--QADMKVIMADGSA.KAISQVERNSFVKCED...G....S.....ISRVV..S..I..K...Q.DK..Q.Q.IFKISQKT.KHRAD.TGEPgrvdpkrkniyeLMSFDCTAGHELVL.R....T.S..S...K.....P.N......L.....E.Q.S.Y..K.N......-.-..KR.....YRIR.W..TSLEDAIT.PD.......G.RAIQIP...K.HHH...KYFQMTP...EG...KL.....D.A..LMF...LNEK-IQ......ND..AK........P..IDFRL.Q.V.RDL............D..LL.T.AQIRVSTF..S.K..FS......P....I......L.....GG..NG...VLS..KFLTgkrhlitssvinmawllglwmgdgttkepeitvdtvdkelikalikkgeqwgiypeyvpepeekrarhlrlyygnkveepkktrnlrkhnpfwvvvtalnfkregdgqkqipqf...............................................................................................................................mwdedievreaflaglidsdgyvkkqfeskgiykaaiqtiypsimegisnisrslgisvtittrserkekiggknchckftfdcnitggtalqnvlaycrsghkrrvspdkiirEPIYFGF..SDEQ.V.G.EDSAYGIEI-..-ESK...KS..ILLENKFVV-s..................................................................................................................................................................................................................................................................................................................................................
Q4WI55_ASPFU/1523-1607                 ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.IEVQDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...N.GK..D.R.LYRIKIGG.S----.----............KEDLVVTPNHILVL.H....R.E..K...R.....A.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rnvytgpsvq.........................................................................................................................................................................................................................................................................................................................................
F2Z6H8_CANGA/1-463                     ............................................................................................................................................................................................................................................MFEKGTFILMADGHL.EDISAIKSNSYVMCED...G....T.....PGRVA..Y..T..T...K.AK..Q.T.IYEIVQKT.KHRAN.EGEPgrldprrrtvynRLGFNCSATHKLVL.K....T.P..S...I.....P.T......L.....E.N.N.P..R.R......P.N..--.....LTVK.W..RCLEEILT.TD.......G.RAITVP...K.NHH...KNFPKTK...EG...QL.....Q.-..---...AQNFMRD......KR..LIw.....gpD..IDYEI.Q.V.RDL............E..YL.D.ASMRVTST..L.K..CN......P....V......F.....SG..NG...ILS..NFLSgqrhlitpaivsmawllglwigdgttkepeitvdsvdeklmesltvlgrywglyptykdekvplrakhvrlyygkgpeerrktrnlrknnpfwntiqnlgikreidgekqvpef...............................................................................................................................mwhedieireaflaglidsdgyvvkrkenpdvykvsiqtiypsvmnaivhiarslgisatvttrsarneviegrrvqcrftydcnisgstplqnvlsycrsghkrkpapevvirDPQYVGF..IDRK.L.R.EAEVYGIHL-..-DQP...RN..ILLGNKIVV-y..................................................................................................................................................................................................................................................................................................................................................
A0A367YP60_9ASCO/284-775               ............................................................................................................................................................................................................................................CFTKGTQVMMADGQD.KSIEAIQVGELVMGKD...G....K.....PREVV..G..L..P...R.GH..D.T.MYKVREIT.GHRSDaDVHG............LMDFTVSADHKLIL.R....T.K..Q...N.....I.N......V.....T.T.R.K..Y.G......G.N..KY.....AAVT.F..FALETAKS.G-.......-.--IDMV...R.TKT...KVFGYHV...HG...GQ.....A.G..AEE..kATKFAAD......LD..AT........A.sIDWII.E.A.RDY............E..LV.P.ANVKSNTT..Q.L..IN......P....V......H.....FE..SG...KLA..QWLSangqdknlapemgyllgtwvgnghmdraaysfdpkdaqlalrilnnaskfgltcssneyhrqatskrsksvdelatefneeeyfeklgaekddnsdftfdedsendcvargdmtvtmhgtrgngagknstgn..........................................................................................vfwdamktfgmrrktssglvktvphhlavedidvresflaglvdsegsvrtrsdrsahaiistvhksvsegvvkvarslgirtsvstedkridaygvqhpfayrvylagsalagvlskcalerkqvpakkfsrDPVLFHF..DLIK.S.E.EEDYYGITLS..EETD...HQ..FLLSNMALVH...................................................................................................................................................................................................................................................................................................................................................
A0A2H5RF69_RHIID/347-781               ............................................................................................................................................................................................................................................CFAKGTKILMYDGTH.QNVEELNVGNQIMGDD...D....N.....PRTIQ..S..T..T...K.GE..G.I.MYRIIPND.KGPAK.----............--FFECNDQHILVL.K....F.A..A...E.....P.Y......M.....R.S.E.E..I.P......IiN..RS.....PRIR.L..FWYEYDTQ.NN.......-.---MIV...K.KND...SFYYGPG...EDypkKE.....V.A..KRA..aIREMARR......PNlvSS........D..FIWEI.P.I.KDF............L..TA.S.DEIQRSC-..L.M..FK......Pn..qV......I.....FKsvQG...RFR..VILSkilgvsptnsqisaaswlvgvwigggivkspiiyvnenekeilraieqysemlnwrymkelhkaklddsewkisfmsdndiengfyvllqtldildtkkvtpvi..................................................................................................................................................mtdeldqvrlpllagildisshlleenrnyryvyrslherceqicnlanlsgfystnivsnmkecsdnittpscctiisgnkleklplvisrkkvfrnrdhpkfnRDMVWGF..KVEK.V.G.LGSYYGFKV-..-DKN...ER..ILLADLTVSH...................................................................................................................................................................................................................................................................................................................................................
A0A1G4M6H5_LACFM/170-750               ...........................................................................................................................................................................................................................................n-FTQGTSVFMSDGNC.RLVEYLQIGDVILTED...G....S.....TGVVK..K..I..E...E.RW..E.D.AFGIKQRT.HHYIH.LVDEtrd.....npygLFETTFFAKQVVLL.E....T.F..Q...R.....S.A......E.....S.V.R.K..E.R......G.N..-Q.....RRFH.I..VTVEDFDT.NE.......G.RLIKLA...K.IVE...KHFPSNT...SD...-D.....V.V..QEY...LSKFRKQ......AD..SN........R.fVRWSC.E.I.GDL............K..YL.S.DRARASTR..L.L..LM......P....L......A.....FE..LP...TLL..PFLEktfhkkvsareleamawligfwv.....................................................................................................................................................................................................................................................................................................................gdgfrrgaafalhsedhevngrlE------..----.-.-.----------..----...--..----------enakiwgmtytqkpprpgtfsayavlhtiqngrrrwnvgnpfitvlkglffyengkindaknvpfflrtdqlmvreaflaglidsdgcsliadgflytnivtayplirdgvqviarslglnvfayvgperrikntnyiskkhwnfylsngsnpkvlrsvldrcsatrkrnpkeanykqrkrlqaleeeepleeitagndandeesifedrfirekmeankggnleedtdptlaaedatadeeleegtegtfatenerhipeegsertlavadastgnsteksdaeqtktnsdlsdsekalvcynysrqffhsnplnrkvkvfqithtsqqriipehqiv
G0VAU9_NAUCC/2-450                     ..........................................................................................................................................................................................................................................gi--AKGTRIYLEDGSL.KKIENINIGDMILQPV...G....P.....AMEVL..E..I..N...S.KS..E.K.LVKVEQIT.QHRRT.DAN-............--GFTKPVYDIINL.R....A.S..E...D.....Q.V......I.....M.T.S.-..-.-......S.K..MV.....AGIF.L..ENQNPAKP.LN......dR.RNAATA...T.AAV...DDLTLFV...SE...EE.....E.G..---...---NLTD......DH..IS........I..FNWPA.R.I.SEL............N..LL.N.KNTRLRTR..L.Y..LS......P....F......E.....YN..RP...IMR..KELEtlfqksitteelasmawllgfwlgdghkrdpyfainredvdvnstleeygkiwgmetkywanphtkggtaemglsqphrltfnlvhsplwrainklqflldkkknfpikyvmderi..........................................................................................................................vresliaglidsdghsdlsrcyifwivsvydpirvgitkvcrslglnlythfrpahinndgwhcldifamgvtpgsnfqifesvlsrcgcirkktakgnlmstlsmnafddsikkisPPSPPLF..NVQN.D.V.IEECFDVTL-..----...--..----------ttsegvlitednivvc...................................................................................................................................................................................................................................................................................................................................
A0A1G4M927_LACFM/181-755               ...........................................................................................................................................................................................................................................n-FTQGTSVIMSDGNC.RLVEYLQIGDVLLTED...G....S.....TGVVK..K..I..E...E.RW..E.D.AFGIKQRK.NHYIH.FLDKtrd.....npygLFETTFFAKQVVLL.E....T.F..Q...R.....S.A......E.....S.I.R.K..E.K......D.-..NQ.....RRAY.I..TTVEDFDT.SE.......G.RLIKLA...K.IVE...KVFPSNT...S-...NE.....V.I..QEH...LSKYRKQ......AD..NN........R.fVRWSC.E.V.GDL............K..HL.C.YKTRASTR..L.L..LM......P....L......A.....FE..KP...TLL..PFLEktfhkevsareleamawligfwmgdgyra........................................................................................................................................................................................................................................................................................................gamfalhsedhevngrleenariwgmtytqK------..----.-.-.----------..----...--..----------pprpgtfsayaalhtiqngirrwnvgnpfitvlkglffyengkindaknvphflrtdqlmvreaflaglidsdgtaaivngylytsittvyplirdgiqfvvrslglnisthirpsgpvantpyirkkqwrfhlsngsnpdvlrsvldrcsatrkrnpteathkqkkrlqaldeqecfgesnndielieedddlfedrfirekreanrgenleedtdltlaaedatagedleeeleehhapeeesertlavadasvgnttgksdveitkihsdlndsdkqlvcynysrqffysiplnrkvkvfhithtskqrlipehqiv...................
A0A0C7MVF1_9SACH/10-531                ...........................................................................................................................................................................................................................................g-FVAGTKFMMANGEP.RAIENVLVGDKLMKDD...G....T.....AVEII..A..V..P...C.QV..T.D.TVKIRQTS.KHTAH.LRDSnrk.....ppwgLLDFTCAWRQSLNF.G....T.Y..Q...-.....V.K......K.....D.S.F.R..S.N......G.K..RV.....IS--.I..HQMAVART.KD.......G.REIALV...K.NRD...KLFRHHG...D-...-E.....Y.A..ANK..yIAETMAP......YP..DQ........L..IFWDC.E.V.GDL............E..YL.T.SAPRTSTC..L.S..YY......P....L......Y.....FE..NH...VLQ..SWLEkhfdravtqkalegmawllgfwvgdghrrgpmfalhsgdhdvngrlkrnaelwgmdliikkegpsdgykaigylhtysgtlrnlyhkspicevlsglgfwengrrgaakrvpkflstdqrivreaflaglidsdgctriqdnlirik.............................................................ivtvlpsvrdaiyaiarslglnvtvffyhermhklgyhesdawtfnlfkgtnldtlqsilsrcscerkrnppiqlaktrdveefedqedeedqrssirkemlaeedsndsddscylsddeetavfeidttdtyfekhqgltgediilNPNRVTF..TMEP.N.G.KQEVFGLVCS..DDC-...-N..----------lltsdqvav..........................................................................................................................................................................................................................................................................................................................................
A0A2W7I623_9PROT/32-114                ............................................................................................................................................................................................................................................CHAAGTPILMFDGAI.LPVEDVRIGDRLMGPD...S....S.....PRTVL..E..L..H...A.GE..D.E.MVEVRPIK.GD---.----............--PFIVNAGHILTL.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ikvnegsrgshataa....................................................................................................................................................................................................................................................................................................................................
A0A397HXW0_9EURO/1526-1632             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.IEVQDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...N.GE..D.R.LYRIKIGG.-----.---G............IEDLVVTPNHILVL.H....R.E..K...K.....A.R......N.....N.E.D.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------delpeisaaerydtvemtaaefaalgt........................................................................................................................................................................................................................................................................................................................
A0A0A2EUS2_9PORP/242-243               ............................................................................................................................................................................................................................................C--------------.----------------...-....-.....-----..-..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------l..................................................................................................................................................................................................................................................................................................................................................
A0A397VUW3_9GLOM/15-161                ............................................................................................................................................................................................................................................CFGATQKIMLSDGSF.KQAKNIAIGDSLMGDD...D....E.....SRKVV..S..L..T...S.GR..S.I.MYQVTYDY.ANSSD.NLWE............DDELICNGDHLLVV.K....S.R..Y...Y.....P.R......T.....E.L.K.S..M.Q......N.T..--.....FCVH.Y..MEFDVFDE.EL.......-.-GFNIP...K.LNV...ANFPWN-...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rniyrsrvtaktaarayynkllek...........................................................................................................................................................................................................................................................................................................................
Q2S6J9_SALRD/231-332                   ............................................................................................................................................................................................................................................CLGKGTPVMMYDGRT.KPVEKVEVGDRLMGDD...G....S.....PRTVQ..S..L..A...R.GR..E.Q.MYWVRQKR.-----.----............GMDYRVNESHILSL.K....K.S..R...R.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egardrgsiadisvrdyldqsdkwkddnk......................................................................................................................................................................................................................................................................................................................
A0A2Z4LWQ9_9FLAO/1820-1892             ............................................................................................................................................................................................................................................CFVKGTKVLMSDGSE.KNIEDIVVGDEIMSVD...I....DmmiieKDIVV..Q..I..P...D.YV..K.K.YRKIV---.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------atfsngttndfspahpy..................................................................................................................................................................................................................................................................................................................................
C6HTZ2_9BACT/315-387                   ............................................................................................................................................................................................................................................CHAKGTKILMAEGSV.KNVEEVLVGDKVMGPD...S....R.....PRTVL..R..L..H...R.GS..D.R.MVRIVPNT.GD---.----............--PFVVNQGHI---.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lslldgls...........................................................................................................................................................................................................................................................................................................................................
A1CZ00_NEOFI/1524-1611                 ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.IEVQDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...N.GE..D.R.LYRIKIDG.S----.----............KEDLVVTPNHILVL.H....R.E..K...R.....A.T......T.....F.E.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------smpstnaee..........................................................................................................................................................................................................................................................................................................................................
A0A2T5M975_9EURO/1525-1674             ............................................................................................................................................................................................................................................CLAKGTRLLLYDGSE.IEVQDVREGDLLLGPD...G....G.....PRRAF..N..I..V...N.GK..D.R.LYRIKIGA.D----.----............KEDLVVTPNHILVL.H....R.E..K...S.....A.S......E.....P.S.E.S..Y.D......T.V..EM.....TAEE.F..AALSPEEL.SR.......Y.RLFR--...-.--S...PSFDLPE...QG...VE.....Q.L..TPQ...AHRFT--......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ikdislenettewagfrvdkd..............................................................................................................................................................................................................................................................................................................................
C5DTL5_ZYGRC/284-732                   ............................................................................................................................................................................................................................................CFAKGTEVMMSDGSI.KEVEGIEVGQEVMGKD...G....K.....PREVV..R..T..P...S.GR..E.K.MYKVSHKT.AHRAH.KSDStse......rfgLFEYTCNATHKLVV.R....T.S..R...S.....C.R......P.....L.V.R.N..I.Q......G.T..DY.....VEVC.L..FNMTKKTL.ED.......G.RVIDIV...E.ETS...DFYP-AV...EG...PE.....K.A..LRI...LKEYAEA......DG..GK........E.yFEWTI.E.A.RDV............A..LL.S.AQVRKATY..Q.L..SA......P....V......L.....LE..NN...HFS..HYLKdsnsavgndtvralsyflglwigdgmlnnaatfsvdsqnasllnrinefaevlglsaeykdsqepkraktvnlyakairdegvrknldthnllwdaivdlgylkdds............................................................................................................................................knvpgyicsdsfqhrevflagiidstgyvsdetatvktidqsvmtgtvavarslginvsvdvevdedgvdrsfvyaiymdrsdallavlancasnnkqieapphgvirEFNKAYF..EMEE.L.E.EDEYYGLTLS..NESD...HQ..FLLANQLVVH...................................................................................................................................................................................................................................................................................................................................................
A0A1S2VRN5_9BACT/243-330               ............................................................................................................................................................................................................................................CLGKGTKVVMFDGSL.RNVEDIQVGDLLMGDD...S....T.....PRRVL..S..L..A...R.GR..E.R.MYWVHQNK.-----.----............GISYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egphtkdevlnigir....................................................................................................................................................................................................................................................................................................................................
A0A397SPX4_9GLOM/415-856               ............................................................................................................................................................................................................................................CFAKGTKVLMYDGTY.QNVEELNVGNQIMGDD...D....T.....SRTIQ..S..T..T...K.GE..G.I.MYRIIPND.KGPAK.----............--FFECNNQHILVL.K....F.S..A...G.....P.F......V.....R.N.E.E..I.P......IvN..RS.....PRIR.L..FWYEYDTK.NN.......-.---MIV...K.KND...SFYYGPG...KDy.pKK.....G.I..ARRa.aIREMARK......PN..LAa......sD..FIWEV.P.I.KDF............L..TA.S.DEVQRNCL..M.-..YK......Pn..kV......I.....FKsvQG...RFR..IILNeilgvnptdsqisaaswlvgvwinsgivnlpticvneneneilkviakysemlnwryikesyktmtddsewrisfmcndddiengflrllqkldildtkkvppvimie...........................................................................................................................................eldqvrlpllagildigghlleesgnykyvyepsqercdlveqvcnlanlsgfysksdfastkkcqdnitipssyctiisgndldklplvvshkrvcknhehnlklinRDMVWRF..KVVN.V.G.LGSYYGFKV-..-DKN...ER..VLLADLTVSH...................................................................................................................................................................................................................................................................................................................................................
A0A0D2X4Y0_CAPO3/768-1237              ...........................................................................................................................................................................................................................................v--------RMADGSV.KRADAIAQNDRVLGAD...G....R.....SLPVK..R..T..M...A.GR..D.A.MYKISIVT.PPESK.AQRKdae.....wqpsESGFTCNSRHDLVL.A....C.P..H...I.....D.T......V.....H.V.H.H..D.A......A.S..RT.....FTVR.H..AALRKYSG.PV.......K.GLETSM...Q.QVS...STFSYSA...T-...-F.....V.A..AEN...DRRFATE......TA..AR........DaaTTFAN.E.C.RAA............Q..PV.L.WTVGTAAF..V.R..FA......A....A......H.....PT..QA...GHM..RMIRsgciewpvpasvdlsqvieqvvpaissneprptpetlgyllglhladgsaerasffvghaessllayldevapqfglvshrvsqpdmyevsltralgsekqnpllaafrglgylrkpvkdis...............................................................................................................asfvrnvltqsvsvrravlagfldgegslvacnscgsacaysavqavgaarsahhgdilrliqhvarslgllcnvyarktasftassqalrrltcrlsgdgihllpckqkpmmaehtcaearERRFVKF..TVSR.VsE.SGPYVGFEL-..-DGS...PL..FLLDNWLVV-...................................................................................................................................................................................................................................................................................................................................................
A0A2H5RG61_RHIID/409-843               ............................................................................................................................................................................................................................................CFAKGTKILMYDGTH.QNVEELNVGNQIMGDD...D....N.....PRTIQ..S..T..T...K.GE..G.I.MYRIIPND.KGPAK.----............--FFECNDQHILVL.K....F.A..A...E.....P.Y......M.....R.S.E.E..I.P......IiN..RS.....PRIR.L..FWYEYDTQ.NN.......-.---MIV...K.KND...SFYYGPG...EDypkKE.....V.A..KRA..aIREMARR......PNlvSS........D..FIWEI.P.I.KDF............L..TA.S.DEIQRSC-..L.M..FK......Pn..qV......I.....FKsvQG...RFR..VILSkilgvsptnsqisaaswlvgvwigggivkspiiyvnenekeilraieqysemlnwrymkelhkaklddsewkisfmsdndiengfyvllqtldildtkkvtpvi..................................................................................................................................................mtdeldqvrlpllagildisshlleenrnyryvyrslherceqicnlanlsgfystnivsnmkecsdnittpscctiisgnkleklplvisrkkvfrnrdhpkfnRDMVWGF..KVEK.V.G.LGSYYGFKV-..-DKN...ER..ILLADLTVSH...................................................................................................................................................................................................................................................................................................................................................
A0A2P5HXR1_9PEZI/1556-1644             ............................................................................................................................................................................................................................................CLAKGTRLALYDGGE.IKVEDVKKGDLLLGPD...G....G.....PRKAF..N..I..V...S.GK..D.R.LYRIKMGR.--RG-.----............-EDLVVTGNHILAL.R....K.E..K...P.....F.R......I.....N.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------yqgpdedshrq........................................................................................................................................................................................................................................................................................................................................
Q5G7M7_9CAUD/35-130                    ............................................................................................................................................................................................................................................CHAYGHDIMMSDGTK.KQVQDIAVGDKVMGPD...G....N.....PRKVI..R..L..V...K.GQ..D.E.MFRVTPTK.-----.----............GESFVVNGGHILSLyQ....T.P..R...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ragqtpgyteisvneyirssstf............................................................................................................................................................................................................................................................................................................................
A0A084RH77_STACH/260-762               ............................................................................................................................................................................................................................................CFAAGTEVMMANGTT.QYIETIIVGDRVLGKD...G....A.....PREVV..G..L..P...Q.GS..D.T.MYRVSVKT.QHRNE.TYS-............EVSFTCNASHLLVV.F....T.P..Q...H.....I.R......T.....T.T.H.I..L.R......G.K..YL.....TSVT.Y..FDWTRVQV.KNgq...drA.RSVRLL...K.QFT...KTWDHIT...HG...GE.....E.L..ANA..kAETFKKT......LS..QE........G..FNWTI.K.A.SDV............S..LL.G.VHVRKATQ..Q.F..FN......P....V......L.....FE..AR...RLR..SMLEdygfngkcdkemayllgfwvgdgyytgsifsvdprdtaileqiqkygslfglevdtreykkyrytedcdvseplngsvaigstparaplgeisfnitkkprenfkgvgdvsiklrptstpividgkrkrkskpln....................................................................................tsnifwqmvndtgvrgpdsnnaksipdflvyesievreaflaglidsdghvkrdepsatiktiypsvcdgivriarslgvrvsicveqahttrgvshktaycvylgassgngvlesilsgcsldrkkfsipiqvdrHPQPVYF..DIEE.Q.P.AAQYYGITLA..DDTD...HQ..FLLANTMLVH...................................................................................................................................................................................................................................................................................................................................................
L7RCI5_9VIRU/857-1126                  etvksdkgkilhisvddylkkpshwrinyytyhvgvdfieqevdvdpyiighwlgdgtsastsftsadqeivdyyekyfnntgisvkkckeyrydistgskkggkyknwylnalnkynlinnkhipeeyllnsrqvrlavlaglidsdgsncknrgidiiqknerladdivylarslgfwcdkkqctktctngkngpvtgtyyriyiygndfselpllleykrphpeekthkldhl---------------.----------------...-....-.....-----..-..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................---ISSF..KIEK.L.G.KGKYCGFEL-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
M3K3J1_CANMX/284-733                   ............................................................................................................................................................................................................................................CFAKGTKVLMSDGKD.RNIEDVAVGDKVLGKD...G....L.....PREVV..G..L..P...R.GR..E.V.MYDVVQKT.QHQAD.TVDG............AISYTCNSTHKLVV.R....T.N..Q...K.....V.N......M.....T.N.H.V..L.R......N.E..PQ.....TSVT.Y..FALVDDKD.SN.......G.REFKMV...K.LCT...ESFEHKT...HG...PE.....N.A..VKK...AQEFKDT......VS..IL........D..IDWVI.E.A.RDV............A..KM.G.YHVRRATK..Q.L..WA......P....I......L.....VE..NN...VFS..SMIEkqgsdtsiapelayltglwvgngssesaafsvdsrdeeiinriqdcaeaaglemrgshykktydatislhnhekrangvvrrnqntdnlfwtllgdmfesdgkkliktvps.....................................................................................................................................flraetiavreqflaglvdadghvkkddvtdaclsatvktiypairdglvtlarslgivasvtteaaktvggvshqeayvvslgassaldsvlskcaasrkkaaepvgvsrEPHQFSF..YLQE.K.P.VDDYYGITLS..AESD...HQ..FLLANTALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1I5TE83_9PROT/207-306               ............................................................................................................................................................................................................................................CLGKGTRVLMYDGTL.KKVEDIKVGDLLMGDD...S....T.....PRRVL..S..L..A...R.GR..E.M.MYWVRQNK.-----.----............GIDYRVNESHILSL.K....R.S..R...T.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egkhkhgdvlnisvrdylqksdkfksn........................................................................................................................................................................................................................................................................................................................
G8C1W5_TETPH/1-463                     ............................................................................................................................................................................................................................................MFEDGTRVMMADGRS.KDISELRANDYLMAED...G....A.....PVKVT..G..V..I...K.DS..Q.S.TYEIVHKT.KHRAF.EGEAatndplrkiiyqRLSFNCTLTHDLVL.R....T.P..A...K.....P.M......I.....E.N.D.F..T.K......-.-..NI.....YRVR.Y..RTLDKVNT.DD.......G.RIINIP...K.QHK...KYFKMTP...EG...KT.....D.-..---...AENFRDE......ME..RQc......gE.fLNYNL.Q.V.RDL............D..LM.M.PLLRITTY..L.R..FS......P....L......T.....SG..NG...VLS..QFLTgtkhlntkavlqmawmlglwigdgttnepqitvdsfdtslidalnenskpwgiyptykdeafasrckhvslhygqeagenrvyrnlrknnpfwnvvtslkfkrdgdggkqiptf...............................................................................................................................mwsedeevreafmaglidadgyvckwtektgnlkvsiqtiypsimngivhisrslgitatvttrssktitirgrqvqcqftfdcnmygserlqnilsychsghktrpvpstisrDPVYFTF..LDIK.K.G.INDVYGLTL-..-EED...KN..VLLENKTVV-t..................................................................................................................................................................................................................................................................................................................................................
R4TWJ8_9PHYC/156-255                   ............................................................................................................................................................................................................................................CHGINTPILMYDGDI.KMVQDIKIGDQLMGDD...S....T.....PRNVL..S..L..A...R.GR..E.M.MYDIVPTK.GD---.----............--KYTINESHILSL.K....M.S..C...P.....Y.N......S.....K.K.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------yshlkkddvldvclmdylnlpk.............................................................................................................................................................................................................................................................................................................................
G8ZQA5_TORDC/12-474                    ..........................................................................................................................................................................................................................................ls---ENTRLFLSNGTL.IDITKLKSGDRLLSAE...G....K.....ASEVE..R..V..V...Q.FT..G.N.LVKFTQTF.SHVTT.GFEPgyi......pygVVSFTVSDTQVLVF.R....T.L..Q...R.....L.K......V.....M.R.-.-..V.K......E.K..RV.....FEI-.-..TELRKQLR.EA.......V.GMLMLP...V.TGS...RTFLSSS...T-...IR.....E.A..KDY...VKRKTAA......SD..DG........Y..ITWNC.V.A.KNI............A..QL.S.KELRVSTK..V.L..LS......P....M......N.....LE..IP...VLK..PWMDkwygedvtsdkvdalawlfgfwigngyrkgaifglhseghdvndylrncagklgmickfkkrgedgfraeatllmpdgsrdrnspltnaleelrfylhgkkgdpksvpkflgfearsv......................................................................................................................reyfmaglidsdgstkyqqgtvraciktthqpirdgillvwrslglnltvsfepeqmrrdvhqndtwifdlfegankpvfwsilekcscerkrnpqkdkdyrpllcppvkpnatdvdplNFMSISF..ETSN.S.G.SGKLYSIQLK..DPS-...--..----------stfitedqlic........................................................................................................................................................................................................................................................................................................................................
E7GTB3_CLOSY/386-455                   ............................................................................................................................................................................................................................................CLGKDTRILMADGSE.RAIEDIRIGDLAQNMD...G....M.....PIRVT..N..I..I...S.GM..EaE.MVYVKTMG.NK---.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------eilmteshpvrvr......................................................................................................................................................................................................................................................................................................................................
A0A1A0HJE8_9ASCO/284-750               ............................................................................................................................................................................................................................................CFAKGTDVFMADGAE.QPIESIKVGDEVLGKD...G....Q.....PRLVV..G..L..P...R.GN..D.Q.MYEVVQTS.TE---.SAHG............KIKYTCNSNHELVV.V....T.S..Q...K.....I.L......T.....T.E.D.A..-.-......-.D..KS.....VSVS.Y..FALAATKT.DD.......G.RSIKMA...Q.QAT...RVYQDNS...D-...--.....-.-..---...AQRFVQS......LS..KE........D..LHWTI.E.A.RDV............S..LL.T.GSARESTY..Q.L..IN......P....V......L.....VE..KP...TLA..PLIEkyggdvdavnemsyllgvwtgsgrsdascisvdsadsglidrleafseklglsvecsknhkrarldaplspagrenivvnetdsgyfslplspgspaatprandeneasellvvicngnmrgkgvr......................................................................................................qtledenifwkmiaafkvadtvksvpnslasesisvreyfiaglvdsegrvahnketdaftatirtsnlkvrdglvkasrslgirasvkedtamsfavslsgnaltgvlskcasfskkapvsskterLPEAFSF..DIKK.T.S.VDDYYGITLE..EGSD...HQ..FLLANCALVH...................................................................................................................................................................................................................................................................................................................................................
A0A372RSX8_9GLOM/409-842               ............................................................................................................................................................................................................................................CFAKGTKILMYDGTQ.QNVEELNVGNQIMGDD...D....N.....PRTIQ..S..T..T...K.GE..G.I.MYRIIPND.KGPAK.----............--FFECNDQHILVL.K....F.A..A...E.....P.Y......M.....R.S.E.E..I.P......IiN..RS.....PRIR.L..FWYEYDAQ.NN.......-.---MIV...K.KND...SFYYGPG...EDypkKE.....V.A..KRA..aIREMARR......PNlvSS........D..FIWEI.P.I.KDF............L..TA.S.DEVQRSC-..L.M..FK......Pn..qV......I.....FKsvQG...RFR..VILSkilgvnptnsqisaaswlvgawigggivkspiiyvnenekeilraieqysemlnwrymkelhkaklddsewkisfmsdydiengfyvllqtldildtkkvppvi...................................................................................................................................................mtdeldqvrlpllagildinshlleenriyryvyrslherceqicnlanlsgfystnivanmkecsdnittpsctiisgnkleklplvvsrkkvfrnrdhrkfnRDMVWGF..KVEK.V.G.LGSYYGFKV-..-DKN...ER..ILLADLTVSH...................................................................................................................................................................................................................................................................................................................................................
S7ZNR3_PENO1/1524-1636                 ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.VNVEDVKEGDQLLGPD...G....Q.....PRIAF..N..I..V...S.GE..D.R.LYRIKLGA.S----.----............KEDLVVTPNHILVL.H....R.E..R...S.....E.N......A.....E.Q.Y.D..-.-......T.V..EM.....TAEE.F..ASLS----.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------pevrstyrafrspefahpd................................................................................................................................................................................................................................................................................................................................
I2G828_9CAUD/34-127                    ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdwlk................................................................................................................................................................................................................................................................................................................................
A0A2P7TWC8_9SPHI/241-348               ............................................................................................................................................................................................................................................CLGKGTKVLMYDGTL.KNVEDIIAGDLLMGDD...S....T.....PRTVL..G..I..N...T.GR..E.N.MYWIHQNH.-----.----............GISYRVNESHILSL.K....R.S..R...S.....G.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nhkhgdvlniavreylqqsekfktnykgykvsv..................................................................................................................................................................................................................................................................................................................
A0A1R1XW24_9FUNG/1914-2100             ............................................................................................................................................................................................................................................CFAFGTKVMMSDGSD.KDVQDIIVGDKVMQDV...G....T....iPRTVL..K..T..C...V.GN..D.H.LIKVSFTS.DE---.----............MGGFYCTKNHILVL.S....S.T..P...D.....S.I......I.....R.S.Q.T..N.E......G.K..--.....TIVT.Y..YDANLEKT.D-.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ftfentsdantfienlltnqpqiyeisaedllnkfnhdlqiknhfvmytipnsensirtfsfdltlsseqdfagfevdgngrfvlg.............................................................................................................................................................................................................................................................
Q5B4K7_EMENI/1512-1641                 ............................................................................................................................................................................................................................................CLANGTQLLRYDGTK.VNVEDVKEGDLLLGPD...G....G.....PRRAF..N..V..V...S.GK..D.R.LYRIKIDG.DK---.----............-EDLVVTANHILVL.H....R.A..K...A.....M.N......T.....S.V.C.F..D.R......S.K..EQ.....QGGA.G..EQLDISEV.SA.......A.ERYDTV...E.MTA...AEFA---...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------alhpqerswyrai......................................................................................................................................................................................................................................................................................................................................
A0A427XK52_9TREE/17-85                 ............................................................................................................................................................................................................................................CFGAGTQLLLANGRL.INVEDVKVDDDLLGPD...G....T.....GRRVT..G..V..H...Y.GR..Q.R.MYRESQG-.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------idgrlsgvsvncdssf...................................................................................................................................................................................................................................................................................................................................
A0A367XLV3_9ASCO/284-775               ............................................................................................................................................................................................................................................CFTKGTQVMMADGQD.KSIEAIQLGELVMGKD...G....K.....PREVV..G..L..P...R.GH..D.T.MYKVREITgHRRDA.DVHG............LMDFTVSADHKLIL.R....T.K..Q...N.....I.N......I.....S.T.R.K..Y.G......G.N..KY.....AAVT.Y..FSLETAKS.G-.......-.--IDMV...R.TKT...KVFGYHV...HG...GQ.....A.G..AEE..kATKFAAD......LD..AT........A.sIDWII.E.A.RDY............E..LV.P.ANVKSNTT..Q.L..IN......P....V......H.....FE..SG...KLA..QWLSangqdknlapemgyllgawvgngymdraaysfdpkdaqlalrilnnaskfgltcssneyhrqatskrsksvdelatefneeeyfeklgaekddnsdftfvedsenycvargdmtvtmhgtrgngagknstgn..........................................................................................vfwdamktfgmrrktstglvktvphhlavedievresilaglvdsegsvrtrsdrsahaiistvhksvsegivkiarslgirtsvstedkridangvqhqfayrvylagsalsgvlskcalerkqvpakkfsrDPVLFHF..DLIK.S.E.EEDYYGITLS..EETD...HQ..FLLSNMALVH...................................................................................................................................................................................................................................................................................................................................................
A0A397GDQ6_9GLOM/1034-1470             ...........................................................................................................................................................................................................................................w--APGTEFLMFDGSI.KKVEEIQINDKLMGDD...N....T.....IRNVL..G..I..N...N.GH..G.Q.MYRIQTGK.MCPG-.----............-DSFEVNDEHILCL.K....I.S..R...A.....P.K......V.....Y.K.Y.QrcC.D......N.K..SH.....WEYI.L..EWWEHIPE.TNn.....iK.KMNKYF...K.FPS...KNWSNES...S-...AK.....K.A..AEI...AKNCVPN......LH..KD........G..FVWEI.S.V.NDY............I..VQ.P.KFIQKVCT..L.-..YM......P....G......V.....VN..FP...SCE..GYLAgvihkvlnkkldtkqlheiawligaqigssfvvyqngdfinrvknavkaieceitttiqknfiksndefatfyintnkneitklvihgysyiailhelnilsnkgdd............................................................................................................................................skifprslildnlevrlhllsglidvagsykenknifnfihqkhivdavrelanisglnaskvttfikndeiqtqsmwhvrvgghnvhllpttnkmfvpkfsekenysQYNSWSF..KVIP.T.DtNGQFYGFTT-..-DGN...ER..MLLRDCTVTH...................................................................................................................................................................................................................................................................................................................................................
U5N122_9CAUD/6-97                      ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdw..................................................................................................................................................................................................................................................................................................................................
A0A329RLC5_9STRA/445-552               ............................................................................................................................................................................................................................................CHVANAQIRMFDGSV.ELVQNVRVGDLLMGDD...N....K.....PRTVR..K..L..H...T.GV..D.R.MVRVAFNG.ED---.----............-YSFEMTEHHVLSL.K....F.M..D...V.....H.E......V.....I.S.Q.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rgsgedihyaiwhrccgsdeparlevpf.......................................................................................................................................................................................................................................................................................................................
A0A2I7QJN8_9CAUD/37-143                ............................................................................................................................................................................................................................................CLAKDTPVLMYSGTV.KKVQDVVAGDLLMGPD...S....S.....PRTVR..S..T..C...T.GR..E.M.MYRVTPTK.GD---.----............--PYTVNESHILSL.K....K.T..G...S.....E.D......V.....V.N.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ltvpeylassatfkhthkgwrsavdwpeq......................................................................................................................................................................................................................................................................................................................
A0A2T9Z5W9_9FUNG/596-754               ............................................................................................................................................................................................................................................-FGEGTDVLLANGST.EKIEFLRPGDSLVGDD...G....M.....VRKVI..S..T..V...S.GK..S.P.MFRVKPSSiIGKLP.KGISra........swDRGFVVNPAHLLVI.S....F.P..D...Y.....P.K......M.....L.N.S.T..Q.N......S.E..YE.....VTVR.F..IQLEFNEQ.L-.......G.MTIPQI...D.ERI...FNYESVD..sDN...GI.....S.A..RSK...SKALIKK......LE..SK........N..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------iiaefh.............................................................................................................................................................................................................................................................................................................................................
A0A0H3TM33_9VIRU/90-180                ..........................................................................................................................................................................................................................................cl--GPDVGVMMHDGGI.KLSQCIQPGDILMGSL...G....E.....PRPVI..S..V..C...N.GT..E.E.MYKITPTH.-----.----............GAPFTCNGSHILSL.K....H.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rytgvvvdiplneyiktqsya..............................................................................................................................................................................................................................................................................................................................
A0A0F8UW12_9EURO/1525-1670             ............................................................................................................................................................................................................................................CLAKGTRLLLYDGSE.IEVQDVREGDLLLGPD...G....G.....PRRAF..N..I..V...N.GK..D.R.LYRIKIGA.D----.----............KEDLVVTPNHILVL.H....R.E..Q...S.....A.S......E.....P.S.E.S..Y.D......T.V..EM.....TAEE.F..AALSPEEL.SR.......Y.RLFR--...-.--S...PSFDLPD...QG...VE.....Q.L..TPQ...AHRF---......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------tikdislenettewagfr.................................................................................................................................................................................................................................................................................................................................
A0A087SLR2_AUXPR/1128-1278             ...........................................................................................................................................................................................................................................r---------MADGRV.KPAAEVRVGDRVLGAG...G....E.....ALAVR..R..T..I...R.GR..D.A.MFAVGVLPgNAREA.KALAgeg.....wallDRGFVCNSRHDLVL.T....W.A..A...A.....P.R......V.....V.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------cggdrgsawavehaevreytgpacgverslqatrtefasadearahaaalaaaspllwtvpaaay..................................................................................................................................................................................................................................................................................
A0A1I0DDC1_9BACT/244-323               ............................................................................................................................................................................................................................................CLGRGTKVLMFDGTL.RNVEDVCEGELLMGDD...S....T.....PRRVL..S..I..A...R.GR..E.N.MYWVRQNK.-----.----............GEAYRVNESHILSL.K....R.S..R...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------negphrhg...........................................................................................................................................................................................................................................................................................................................................
A0A1G4KN40_9SACH/206-777               ...........................................................................................................................................................................................................................................r-YTSGTEIFMYDGHC.KIVDELQIGDEILTAD...G....S.....CGVVR..Q..K..S...E.EL..D.E.AFTIKQQK.NHYIH.FYDEsrd.....lpygLFETTCFEGQVLLV.E....T.Y..L...R.....L.K......R.....S.I.R.R..-.D......K.E..NQ.....RRVL.I..LTVNDFET.KD.......G.RLIKLA...R.DVE...KLFPAET...SD...-E.....V.V..ENY...IKSFRGH......TE..NN........S.fVRWKC.E.V.GDL............K..YL.G.EAARASTR..L.L..LL......P....L......A.....FE..RP...TLL..PFLEkefmrkvsekeleamawligfwig...................................................................................................................................................................................................................................................................................................................dgcrvgatfalhsedhevngrleeN------..----.-.-.----------..----...--..----------akiwgmtyvkkhcknkvfgatgtlhtfqngrrrwnvgnpfiavlkgllfyengkindkknvphfmrtehlmvreaflaglidsdgysllvdgflctsittvyppirdgiqfitrslglnvsthvqpacpvagtsyikkkqwqfqisngtnpkvlrslldrcsaqrkrhpkeasytqrksldilrednteaegvdtpelfscdilqdrfvrekraaineeyseewsddeliaddetldgttdngepcityenqpispisdetnfdcgaesivhnysrqffqsiplnqkvkvikithstkqklipehqiiteeslletgetkkidiftet...........
A0A1E4RQA6_9ASCO/283-765               ............................................................................................................................................................................................................................................CFAKGTKVLMADGTD.KVIENITVGENVMGKD...G....N.....AREVV..A..L..P...R.GT..E.T.MYEVKQET.QHKHE.-DHA............SVGYTCNAKHILVL.K....T.K..Q...H.....V.K......M.....T.D.D.I..V.G......G.K..AQ.....TSVV.Y..FAMETVIT.ED.......K.REFRLV...K.EKT...RSFQHST...WG...GK.....E.N..AHA..eAEKFMST......IP..RD........D..IDWTL.E.V.RDL............E..RL.N.VHARKATQ..Q.L..IS......P....V......L.....HE..ND...IFA..ENMKaigadasvrdqlsyllglwvgdgysdrssfsidpadvdlierisqyasdldlvsdadpykrarnevveeanvedpefadqedraeasasfddeevtlvgedisqekthkggditvnvrapvtrgntg....................................................................................................nalweavktfgvkgekckavpyslasapftvrenflagiidsdghvkrddvsatvktiypevrdgltrlarslgirvsvnkeiasvykgvsheesyavymsggdvlksvlskcsldrkrfeapatftrSAQAFNF..TVKE.L.P.RADYYGISLP..SESD...HQ..FLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A2I1CKS8_9EURO/1506-1594             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.IEVQDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...S.GE..D.R.LYRIKIGG.S----.----............KEDLVVTPNHILVL.H....R.E..K...K.....A.R......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nvytgpsiqghtq......................................................................................................................................................................................................................................................................................................................................
A0A2G5BDK3_COERN/528-893               ............................................................................................................................................................................................................................................CWGRDTPILMYDGTR.RSVQDVRERDLVMGDD...N....T.....ARTVQvgS..V..I...R.GS..G.M.LYRVVPEK.LA---.---G............AEAFVCNADHILVL.A....I.T..C...R.....P.Y......V.....R.T.T.T..MaR......G.G..RA.....ARTK.F..TA------.ES.......-.---VVV...D.RVA...NSLRVVS...HG...SF.....D.T..EEA...AAA--AL......PK..WE........P..LEWQC.T.V.LEY............M..EL.V.RRDRSLARmcS.M..YK......P....VdgvefpA.....SA..--...---..---Gqpfadavahtlgsaptlaqeldaaarlgrelfvggnggvlgsvvspdsaggipaalmttsiahrraflagvidtagq........................................................................................................................................................................................................ltndsgkehwqidykheqllaqlrslvrsvglyaggvvkrgtdysvavfgelmysigqhitvdhkraavcapepwkalCNNSWQF..IIEE.I.G.HGDYFGFTL-..-DGN...SR..VLLGDYTVSH...................................................................................................................................................................................................................................................................................................................................................
A0A2I1FXS8_9GLOM/642-1019              ............................................................................................................................................................................................................................................CFGKGTPILMYDGSV.RAVETIQTGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.L.LYKIIPIN.NSSA-.----............-QPFVCNDAHILVL.R....I.T..S...S.....P.Y......I.....Q.H.Q.K..R.K......G.Q..--.....FCLN.Y..FIYNNNTN.LV.......K.KTNIFY...K.YPT...SQFQTKY...HA...KR.....A.A..IKS...LEMLNSD......KI..PN........L..FYQSV.N.SnADL............K..IIrG.DFIWQPSV..T.Q..FL......N....C......S.....SE..VQ...SAA..NMFTpnkvrfsvregtfakiieriigspitnniikfyawligywigtdfvmsndnqdivaslfgelgilrrkdipeimmyedid...................................................................................................................................................................................................lvrlpllagiidskglcipqedvieltltdvcnaknfvkisrscglqasisdpqnkcilhkasiipsvlfrsnckindhkHDQLWGF..QIKE.L.G.VGEYFGFVV-..-DGN...HR..FLLGDF----tt.................................................................................................................................................................................................................................................................................................................................................
A0A139IQD1_9PEZI/439-991               ............................................................................................................................................................................................................................................CFEAGTAVMMANGRS.RVVESLAVGDQVMGKD...G....L.....PRDVV..A..L..P...R.GT..E.E.MYRVSVKT.QHRNE.TLR-............EVFFTCNASHKLVV.Q....T.P..Q...H.....I.R......Q.....S.D.H.V..L.R......G.K..QQ.....TSIV.Y..FDWARLNV.DQas...arP.RSIRIV...K.QCT...KSWDHDT...HG...GL.....N.N..VHR..lAARFRAT......IP..SS........T..FDWTV.Q.V.RDL............A..RV.G.VDVREATQ..Q.M..FS......P....V......F.....YQ..NN...RLS..TMITdagydgnyagqmayllgfwvgdghyvspafsidpedlairdqiaaygkhfglsidtrqdkgyfcgeepshdldddqfeneapmaidtdviqdldtvqtdgepfnasamkmnpivldestpskaaglqiassdsrpalsqisanivkrtddqydtgkkrvr..................................edfhgrgnitvilrnalqapgaqrktgtvnnffwdmvkttgvrgpssdraklipdflscdsfevrehflaglidsdgyvnldapgatvktiypavckgmvkiarslgvrasicveqakvvngvshktaycvylsghdalasvlskcslqrnkmpapsrvarQPQLVYF..DIEE.L.P.PAPYYGITLA..NDTD...HQ..FLLANNFLVH...................................................................................................................................................................................................................................................................................................................................................
A0A0N9R1K5_CEV01/55-442                ............................................................................................................................................................................................................................................CLKIDTEIIMFDGSI.KKVQDVKVGDKLMGDD...S....T.....ERNVL..G..L..A...R.GI..E.P.MYEIKLSD.G----.----............-DSFTCNESHILCL.K....Y.N..V...K.....P.S......I.....R.N.N.K..-.-......N.S..NR.....FEVN.W..FDNKE---.--.......-.-----I...K.MKS...KSFNYKN...ND...KE.....R.C..FNE...ANILLEE......KL..LK.......qE..SDFNI.S.V.KDF............L..TL.S.KYLQRNSL..S.Y..KV......G....I......E.....FN..ER...NIQ..--LDpyilglwlgdghsssaritnqdatilkylnenlikydcflkfisnyeysfhtlkeytrngrknnittilqnynllnnkhipddykinsrenr..........................................................................................................................................................................lkllaglidsdgyyqcknyeisqknnslakdivylakslgfactckkvikscmyknvkregeynritifgdgltdipvlckrkkceeeriikkPALEYFF..KIEA.K.G.IDNYYGFEL-..-DGN...HK..FILGNFIVTH...................................................................................................................................................................................................................................................................................................................................................
A0A1R1XW24_9FUNG/596-1091              ............................................................................................................................................................................................................................................-FGPDTPVITSSGQT.KMIQNIKIGDTLIGDD...G....E.....SRVVT..S..I..T...S.GK..S.P.MFRVNPVS.SFGAI.NKGLsr.......sfmDNGFLVNPAHILII.S....F.P..D...Y.....P.K......V.....V.F.S.H..-.N......N.F..ES.....VEVQ.Y..ISLKFNEK.LK.......SiAPVIHK...K.IIT...NAFNKEI...G-...LR.....S.S..HSK...ASKKLEL......LK..SK........N..YRCKIvEcP.KDC............Y..TH.L.YYVRGDGS..KaK..VS......Y....N......H.....RK..ES...SL-..---Hfasefiqslpkvewevsvseyirayemypeiskisyiprssskltyeisgvssnikfssyfsdiqlqalesssligsilslyasskynasinfitedkyirisleesssnnendlkksvssiaksltelkedfn.......................................................................................iskissgyiisinkhsniisviqnrynislnnsrpldftklvdslrvdsveirerfvygvisvlgfksqtnngkdcfilsqvvddlkscttfntfiasvhlvalslglnsevfnsnleskifvfisyckphsdnRNNDYLF..TITKeL.N.HGHYYGVSVS..GAND...K-..FLLADN----tv.................................................................................................................................................................................................................................................................................................................................................
A0A1E3NMZ3_9ASCO/284-777               ............................................................................................................................................................................................................................................CFTKGTQVMMADGQD.KVVEDIKVGETVMGKD...G....K.....PRSVI..G..L..P...R.GH..E.T.MYKIHHITgHRRDA.EVHG............LMDFTVSADHKLVL.K....T.R..Q...N.....A.L......I.....T.T.R.R..Y.G......G.K..EY.....AAVV.F..FSLEKSKY.D-.......-.--IEMV...R.TKT...KVFGYHV...HG...SK.....A.R..AEE..kAVKFAAE......LN..AS........P.yIDWVI.E.A.KDY............H..LV.S.DNVKTNTT..Q.M..IN......P....V......L.....YE..SG...SLG..KTLEsrgqekssaaylaymlglwvgdghmdraafsfdpsdtelfarvseyseklglsasshehlhryfansnvsrpitpkidnndflvdedmdtdltdvtyesennessfgsygsrgdmtvtihdagndirnksnvs........................................................................................nvfwdmvesfgvryntssgyekavpshiacddikvremflsglidsdgcvklnsdgtknatittihktvsegivkiarslgikvsvgtedekidsngvrhqfsyrvflngkalagvlsncalarnsadavsftrEPVLFHF..DLIE.S.E.MEDYYGITLD..ESSD...HM..FLLSNMALVH...................................................................................................................................................................................................................................................................................................................................................
F2TVI8_SALR5/1497-1625                 ............................................................................................................................................................................................................................................CFRTTTELLLASGDI.VRASDVRVGDKLMGDD...G....T.....PRNVQ..H..V..V...T.GL..S.R.LYEVTVAS.SD---.----............VEPLVVTGNHILCL.K....P.S..A...H.....L.S......V.....D.E.Q.Q..E.E......V.A..RK.....LK--.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------aaalraataatgdasvngaampqaqqpqdstlfemtvee............................................................................................................................................................................................................................................................................................................
Q6BRM0_DEBHA/283-675                   ............................................................................................................................................................................................................................................CFAKGTEVLMADGSN.KNIEEVQIGESVLGKD...G....E.....ARNVV..A..L..P...R.GN..E.T.MYEINESTpEEEAD.--LA............RIAFTCNAKHELVV.N....T.K..Q...D.....I.A......V.....E.Q.-.-..-.-......-.-..--.....NCVT.Y..FALESVTD.EA......nG.REFSVV...K.SQT...KTFEESS...M-...--.....-.-..---...AKEFAST......IS..KN........S..IDWTI.E.A.RDV............G..HM.S.DDVRCATQ..Q.S..WA......P....V......L.....AS..KE...VLA..PVVQeagfdatiapyvsyllglwigngysdrvqylidgkntelinrvreydeaiennnqtsaktvdflwdvinsmsfkvegksgkaipsflrte..............................................................................................................................................................................sfevreqflaglidsdgivtknplsasvrtnsskvgegviavsrslgictsvkaenesyiismtrnsalesvlskcalaekttsvpshitrTGQNFDF..SVKK.I.E.AADYYGVTLP..DNSD...HQ..FMLANQAVVH...................................................................................................................................................................................................................................................................................................................................................
G8ZQA3_TORDC/12-487                    .........................................................................................................................................................................................................................................lst----DCNLFLSNGNL.VNITQLQPGDLLLSAD...G....K.....ASEVE..H..V..V...Q.FI..G.D.LVRITQKF.KHVKE.GLPNgyv......pcgGMAITVSATQELLL.R....T.A..Q...R.....V.K......R.....V.T.K.KdgE.S......G.S..EK.....RVIE.I..TQLRSIFY.KG......fG.KLVRPI...-.TSS...KSFTVTS...PI...FS.....T.I..AEM..kAHTKKAT......SS..SD........DgyYYWKC.R.V.KNL............QepQL.N.KELRGSTK..V.L..LS......P....I......N.....LE..IP...VLK..EWMNkwfneevtsgkveamawllgfwigdgyrrgavfalhsedhdvneylrmaaeklgmtltikvrnevgfkadgylhtqtgsrdrnspltsalkelkfyqngringpkcvpaflrfetrsvk.....................................................................................................................effmaglidsdgctntiegtarvaiktvfepikdgifiivrslglnltvsfdpeqiredglhqndtwifhlfeganksvfwsilnkcscerkrqprelkncriplyppteieesdtvrlNVIPMAF..DIQK.S.G.TGRLFAVYLK..NPS-...--..----------stfiteeqlic........................................................................................................................................................................................................................................................................................................................................
A0A1X7R6R5_9SACH/1-462                 ............................................................................................................................................................................................................................................MFEEGTQITMADGSI.EDIHNIMEGSMVMCDD...G....A.....ATRVT..S..I..F...R.DI..Q.T.TYVLSQRT.KHRKI.ETNAtslrpsctkvdgILEVRCSLGHTINL.T....L.F..T...K.....P.T......F.....E.K.S.F..K.F......N.Q..--.....VLVR.W..VKLVDIVT.SD.......N.RIINIP...K.YHN...KKFPLDD...VG...IL.....E.A..HTY...LENILV-......QN..NK........P..LSFDI.E.V.RDL............D..YL.D.AQTRSRSK..L.C..FK......P....V......L.....SG..NG...RLS..EFLTgqrhlntlsvqnmawllglwigdgttvrpeisvdsldvslmdalielcepwgiypgytdsviplrakhvklyygkkpanrkyyqncktnnpfwkavtnldfknredgskeipqf...............................................................................................................................lcgddieireaflaglidadgyvakelsqsgkyqvniqtiypsvmkgivniarslginatvttkperiaiikgkevhckltydcgitgntalqnilsycrsghkirpkpalvdrGPTHFTF..NDNK.R.G.LNHVYSLKL-..-ENS...KK..ILLGNKM---sl.................................................................................................................................................................................................................................................................................................................................................
A0A1J9P8N8_9EURO/1526-1623             ............................................................................................................................................................................................................................................CLAAGTQLLRYDGTR.VAVENVKEGDLLLGPD...G....G.....PRRAF..N..I..V...S.GR..D.R.LYRIKIDA.-----.---G............NEDLVVTPNHILVL.H....R.E..K...R.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dqnwnnglpvsaaerydtvemiaa...........................................................................................................................................................................................................................................................................................................................
A0A1G4KCH8_9SACH/17-636                ...........................................................................................................................................................................................................................................w-FAKGTRVRIFGKDA.VAVEDVENGDLLLGED...G....E.....PCEVE..S..L..H...H.AR..D.N.LIELKQFT.RHRAH.IEDPtrl.....ppfgVVKVNTFERAVLTL.A....T.P..N...R.....A.G......A.....T.H.N.T..K.-......-.T..DV.....KLLK.Y..CELMDHMT.ND.......G.RIIKLI...K.IKE...IPYPSNT...PN...-S.....T.L..QDM...VKIHRDK......YE..NN........N..IEWQC.E.V.GDL............K..YL.S.KWIRASTK..L.L..LC......P....I......S.....FE..IP...WLL..PWLEwrfqrkitereleamswmlgfwigdgcrkgalfalnsedhdvngkleenakiwgmsyekrhyrrdtfgafaalhtpkangngrhwnvnnpfiavleglrfygdgirngpknvpiflrtdqllvrkcfmagvidsdghsnvcddfmsveiasvyppirdgvlfvarslg..................invsvhikpggyrngmncadawlftlssgsnrdillsilkycshgrkkdppifyyhkmdpdaginvnalesnactketgedvssttaigeelemgfaglpglnvdeststtiagsndsddsegdddralaqsaenfesevvemvsgedldedgndetdpdiieldtntnD------..----.-.-.----------..----...--..----------gfrvphrpkrqtyyarrvdgevepylpnegdkycikfhksrqrfrltpsseegdiiglkvcekdhpilsesqiiygqssfdeerskady..........................................................................................................................................................................................................................................................
A0A076HKJ9_9BACT/244-331               ............................................................................................................................................................................................................................................CLGKGTKVLMYDGTL.RNVENVQAGELLMGDD...S....T.....PRRVL..N..I..A...R.GR..E.N.MYWVRQNK.-----.----............GEAYRVNESHILSL.K....R.S..R...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------tegahrhgdvlnitvk...................................................................................................................................................................................................................................................................................................................................
A0A2Z4PZ14_9CAUD/6-97                  ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdw..................................................................................................................................................................................................................................................................................................................................
A0A178ZZK1_9EURO/358-911               ............................................................................................................................................................................................................................................CFAAGTPVMMADGTN.MNIEDITVGDSVMGKD...G....K.....PRVVQ..A..L..P...R.GE..D.T.MYEVGVKT.QHRNE.TFR-............EVSYTCNATHLLVL.K....T.P..Q...H.....V.R......I.....T.D.H.R..I.R......G.K..MQ.....SSVC.Y..FTYDTRRF.ITe.....gGlRGVRKL...K.QVT...KSFQHDT...HG...GG.....K.K..ARR..lAEEFAAT......IP..RE........D..FHWTL.E.A.RDV............D..SL.G.VHVRKATQ..Q.L..IS......P....V......L.....LQ..NE...RLN..SLLVgqgcdgrlapqmayllgfwvgdghhagskmsvdpndeelvdrledygkkfdlettlvrnykyynvsvkgvlvgkvaasgtervthsprrrtvmgeimgemadgdsglinsplsgrgsgvendavdfalpppgrtvlgeidanrskpatsipaafgvaknlg................................pnyyegrdltvelrgkgmctktnrnlntnnifwdmvlatgvrgpadgqrkvvplwlasetfevrehflaglidsdgyvklndnersatvktiypavceglvrvarslglrvsvcveeektvqgvshrkafcvymsadgildsvlskcalprkttgdpgsverKAQPVYF..DVVE.K.P.AAPYYGITLA..DDSD...HQ..FLLSNLMLVH...................................................................................................................................................................................................................................................................................................................................................
A0A249XX92_9CAUD/34-125                ............................................................................................................................................................................................................................................CLKRGTEVIMFDGTT.KKVEDVIVGDVLMGPD...S....T.....PRNVL..S..L..G...R.GR..E.M.MYEVKPRK.-----.----............GESYTVNESHILSL.R....T.T..T...G.....I.A......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kgswpdntvfdisvrdw..................................................................................................................................................................................................................................................................................................................................
A0A2I2EY52_9EURO/1526-1657             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGGE.VEVQDVREGDLLLGPD...G....G.....PRRAF..N..I..V...N.GQ..D.R.LYRLKVDA.-----.---G............KEDLVVTPNHILVL.H....R.E..K...K.....S.P......A.....A.S.E.AepF.D......T.V..EM.....TAAE.F..AALPTE--.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ersqylafkcpefegaersspqersffvkdis...................................................................................................................................................................................................................................................................................................................
A0A1G4J692_9SACH/8-526                 ...........................................................................................................................................................................................................................................g-FPKGTKIVLSNGES.RAVEDIKVGDEVMNVD...G....E.....GSQVT..E..I..R...T.GF..G.S.LVKIKQLT.KHTAH.LRDQsrs.....epwgTFEFVCSSHQQILV.Q....T.L..Q...R.....V.K......H.....C.Y.K.-..-.K......N.R..TT.....SVVE.H..RVLDKIRT.ND.......G.RTVVRI...K.TAS...KTFQHVK...F-...--.....-.T..AAM...IESYKQK......IS..LD........P..IQWQC.Q.V.DDL............T..NL.T.PVVRTATK..M.L..RF......G....F......S.....FE..KP...YLQ..VHLEqiferkislrev...........................................................................................................................................................................................................................................................................................................................................eamawmlgfwigD------..----.-.-.----------..----...--..----------ghrrgalfalhsgdhdvnqrleenaatwgmslrivprdgfkangylhthdengirhwnrhnpftltlksldfllkgridapknvpifmrtdtflvreafmaglidsdgctsiadnivrakistvyvpirdgilfigqslglnvtttfspmqdsrrgihendiwtfnlfpgqngatlmsilkrcacerkrnprsinqsrkrgpdsdeleieddedeedlrkrvtaddtevdvlspeesadsddellddleaepqhevmvpirrsnrlnlslmpfqvsdhgsgeiielvldsesnaslvtdshlif...................................
A0A0D2HES5_9EURO/357-849               ............................................................................................................................................................................................................................................CFAAGTPVMMANGTD.KNIEEIAVGDCVMGKD...G....D.....GREVV..A..L..P...R.GT..D.T.MYEIGVTT.QHHNE.TYR-............EVLYTCNASHQLVV.Y....T.P..Q...H.....V.R......I.....T.D.R.H..I.R......G.Q..RQ.....TSVT.Y..FDFQTVTV.ATea..eghY.RVVRLL...K.QCT...KSWPHDH...HG...GR.....E.R..ARG..lAETFASN......IP..RT........G..FDWTI.E.A.RDV............A..LL.D.AQVREATQ..Q.M..FN......P....V......L.....LE..NE...TLK..TRLVhrgfdgslapqmayllgswvgdgsytrsilsmdpnddelvdritsygklfdletatveyhhhrnkvtggerhalgeidgnrsgptlsspeesnvpkrtrldydqrgdlsvelrggsvrgkgihknqnahn...............................................................................................lfwdmvletgvrgpsskeakavpmylaseaievrehflaglidsdghvklgegsatvktiypavceglarlarslgirvsisveaakvvngvshqksyavcmsgtdpvasvlskcalerkkltagncvrrEPQPVYF..DAIK.K.P.AAPFYGITLA..DDTD...HQ..FLLGNMMRVH...................................................................................................................................................................................................................................................................................................................................................
A0A397TDD6_9GLOM/1-138                 ............................................................................................................................................................................................................................................---------MYDGSV.RAVETIQTGDQVMGDD...S....T.....PRNVS..G..V..T...T.GK..G.F.LYKIIPTN.NSSA-.----............-QPFVCNDAHILVL.K....I.T..S...L.....P.Y......I.....Q.H.Q.E..-.-......R.K..SQ.....FCLN.F..FTYDKSTN.LV.......R.KSNKYY...K.YPT...SQFQTKY...HA...KR.....A.A..NKD...LE-----......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------llnsgknpnlfypsis...................................................................................................................................................................................................................................................................................................................................
E3T596_CROVB/141-526                   ............................................................................................................................................................................................................................................CISSDTNVLIWNSKIsKKAKDIQIGDILVGDD...G....N.....KRNVI..D..V..S...F.GK..G.Q.MYKIIQSK.-----.----............GENYSVNNNHTLTL.M....M.P..L...H.....K.V......I.....S.N.S.-..-.-......N.N..KL.....KLLW.W..DNVYKIIK.SK.......-.-PIDVQ...E.NKI...S--DDEI...LL...NS.....V.Y..HDR...TKHYRKV......RK..ES........Q..IYTLA.E.I.DQL............-..NL.S.DEIKKEII..D.L..CN......T....I......P.....DE..NVfdiNIQ..DYMNldkttqtyligvsgkcinypyksvnidpyllglwigedcshnskiylnnrvnlnmyklkskgipddylynnkyiresvlagiidk........................................................................................................................................................................................kgsvvrngtkiiieqklsnkelindiiylaqslgfvcstaninktitttgvthsdniktiyitgnlasipvlreknkcinptnfniLDSPGYI..TVEK.D.G.IGDYVSITVD..TTTN...QR..FLINDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A1G4KM79_9SACH/18-576                ...........................................................................................................................................................................................................................................g-FPKGTIIFLSSGEK.VPVEVIQAGDQVLTSD...G....S.....KSTVI..A..T..P...R.AS..A.T.CSTVTQLS.NHRAH.LNRSsrp.....dpwgLVKFACDQRQELWL.L....T.T..Q...I.....F.K......H.....Q.Y.P.V..-.-......G.N..--.....HKVN.I..SQLRPFRT.PD.......G.RDIEIV...M.AAG...KTFPSTG...HE...DE.....I.-..EQY...IADCSKQ......YP..EK........L..IYWKI.E.A.ADL............K..FI.N.KDVIASSK..I.A..TL......P....L......S.....FE..KP...VIL..PWLEaffkrkislqeleamswllgfwigdgfrkgasfalhvhdqdvngrlrknaklwgmdlrikpftdslgaigylqtydgpvrrfnyqnpfslvlkglkfwknggwndpknvpqfmtteqilvresflaglidsdgcsrnqhssirikivttlppvrdsilaigrslg........................lnvtvysspahiteqglhasdtwifnlfagrnhqvlyailnrcacerkrnpptqyskdrdseefedaddaaesdgtldaenvvdksapcenpsedetatdeldteeqrnqvrknllaeaeevlesvveehassqaadgdsllkeleakpdnyfehrqgdehkdvnfELGRMRF..GIVP.A.E.KQELFGVVC-..-ATD...SK..IITADQIIV-g..................................................................................................................................................................................................................................................................................................................................................
VATA_YEAST/284-736                     ............................................................................................................................................................................................................................................CFAKGTNVLMADGSI.ECIENIEVGNKVMGKD...G....R.....PREVI..K..L..P...R.GR..E.T.MYSVVQKS.QHRAH.KSDSsre......vpeLLKFTCNATHELVV.R....T.P..R...S.....V.R......R.....L.S.R.T..I.K......G.V..EY.....FEVI.T..FEMGQKKA.PD.......G.RIVELV...K.EVS...KSYP-IS...EG...PE.....R.A..NEL...VESYRKA......SN..KA........Y..FEWTI.E.A.RDL............S..LL.G.SHVRKATY..Q.T..YA......P....I......L.....YE..ND...HFF..DYMQkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgvknip.......................................................................................................................................sflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarECRGFYF..ELQE.L.K.EDDYYGITLS..DDSD...HQ..FLLANQVVVH...................................................................................................................................................................................................................................................................................................................................................
#=GR VATA_YEAST/284-736          SS    ............................................................................................................................................................................................................................................CEETT-EEEBTTS-E.EEGGG--TT-EEEBTT...S....S.....EEEEE..E..-..-...E.EE..E.E.EEEEEE-S.SSBHH.SSSTSSS......-B--SEEEEETT-EEEE.E....E.E..-...E.....E.E......E.....E.E.E.E..E.S......T.E..EE.....EEEE.E..EEEEEEE-.TT.......S.-EEEEE...E.EEE...EEEE-GG...GT...TH.....H.H..HHH...HHHHHTS......-S..SS........E..EEEEE.E.G.GGG............G..GS.-.HHHHHH-E..E.E..E-......-....B......-.....--..B-...HHH..HHHHTSSSSSSTTHHHHHHHHHHHHHHHBETTSSEEEEESSSHHHHHHHHHHHHHTTEEEEEESTSSTTSEEEEEEEESS--TTTT---SSTTSHHHHHHHHTTSEETTEE---.......................................................................................................................................GGGGGS-HHHHHHHHHHHHHHHEEEE-TTSSEEEEEES-HHHHHHHHHHHHHTT-EEEEEEEE--ECCCTSC-SEEEEEEEE-THHHHHHHTT--STTT-----SSS-----EEE-E..EEEE.E.E.EEEEEEEEEE..TTS-...SE..EEBTTSBEEE...................................................................................................................................................................................................................................................................................................................................................
I0K7N6_9BACT/253-341                   ............................................................................................................................................................................................................................................CLGKGTKVVMFDGSL.RKVEDVREGDLLMGDD...S....T.....PRTVL..S..I..A...R.GR..E.R.MYWIRQNK.-----.----............GIDYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egghtkgevlnisvrd...................................................................................................................................................................................................................................................................................................................................
A0A2V5HZ81_9EURO/1524-1666             ............................................................................................................................................................................................................................................CLAKGTLLLRYDGSK.IAVEDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...S.GE..D.R.LYRIAMDG.C----.----............DEDLVVTRNHILVF.H....E.A..I...S.....Q.A......S.....D.V.-.A..P.K......Q.V..EM.....TAAE.Y..AALDDAER.RN.......Y.RLFKSP...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------tsgsfepqahsfavkdivlesepkewagfrvdqdq................................................................................................................................................................................................................................................................................................................
A0A163X063_9RHOB/4-67                  ............................................................................................................................................................................................................................................CFVAETLVLMADGTE.KPIEQVQLEDLVMGFD...GlgalE.....PREVT..D..L..F...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ihgkrkvldvdgvlttpeh................................................................................................................................................................................................................................................................................................................................
A0A1Y1WCU2_9FUNG/283-740               ............................................................................................................................................................................................................................................CFAKGTEVMMADGTD.KNIEDIVIDDDVMGKD...G....L.....PRKVV..A..L..P...R.GY..E.T.MYKVELAG.-----.----............-TSFTCNATHLLVV.K....T.P..Q...H.....V.G......I.....T.N.H.V..L.R......N.K..QQ.....TSVT.Y..FQLKTVHV.FDet..tgsM.RNVELV...E.QST...KSFQHDV...HG...GA.....E.R..ANQ..lAADFAST......IS..TS........D..INWTI.E.A.RDV............E..LL.H.VHARKATQ..Q.M..IS......P....V......L.....FE..DP...VLE..RHLFnagaeieatptvayllglwvgdgyhdrisfsidpkdeeligrirdygnvldmdvtsveyhhhivpehansnkhvyqrgdstvslrnrsvrgngvrrnlntgnivwsiikdigvrgdd.........................................................................................................................gskvvpsflaresilvrehflaglidsdgyvvkdtrphatvktiypsvrdglvklvrslgihasvscepehvtkgvhhktsyavyisggnegalasvlskcslsrkrtpaptfaverKVQPTYF..KITK.T.D.ADDYFGVTLA..DGSD...HQ..FLLSNMALVH...................................................................................................................................................................................................................................................................................................................................................
A6QC64_SULNB/206-309                   ............................................................................................................................................................................................................................................CLGKGTNVLMYDGTL.KKVEDVKVGDQLMGDD...S....T.....PRNVL..S..L..A...R.GR..E.E.MYWVRQNK.-----.----............GIDYRVNKSHILSL.K....R.S..R...N.....E.N......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ghhhgdvlnievseyitksdkfksnykgy......................................................................................................................................................................................................................................................................................................................
A0A0P0YNX5_9PHYC/116-216               ............................................................................................................................................................................................................................................CLGKDTPVMMFDGTI.KKVQDIRTGELIMGDD...S....M.....SRNVL..S..T..C...T.GT..E.Q.LYKIVPTK.GD---.----............--PYIVNESHILSL.K....Y.V..Q...R.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rnkkcgqvldisvldylntssdfkhnev.......................................................................................................................................................................................................................................................................................................................
A0A015K856_RHIIW/300-422               ............................................................................................................................................................................................................................................CFGKGTPILMYDGSV.HAVETIQTGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.L.LYKIIPIN.NSSA-.----............-QPFVCNDAHILVL.R....I.T..S...S.....P.Y......I.....Q.H.Q.K..R.K......G.Q..--.....FCLN.Y..FIYNNNTN.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lvkktnifykypsfvkfqvhqir............................................................................................................................................................................................................................................................................................................................
I0AHG6_IGNAJ/229-328                   ............................................................................................................................................................................................................................................CLGKGTKVLMFDGSV.KKVEDINVGDMLMGDD...S....K.....PRKVL..S..I..A...R.GR..E.M.MYWVRQKH.-----.----............GIDYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------evghskgdilnievreyltkskkwksn........................................................................................................................................................................................................................................................................................................................
A0A397UUE2_9GLOM/514-753               ..........................................................................................................................................................................................................................................cc-----TPILMYDGRK.KTVETIKEGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.I.LYKIVPIN.SS---.---F............AQPFVCNDEHILVL.K....M.M..S...G.....P.S......L.....Q.HeC.N..K.D......G.E..KL.....LRLV.Y..FTYDCTTN.LM.......Q.KISKIY...P.VRS...TDYSTIN...NA...KQ.....A.A..IRD...LE-----......--..--........-..-----.-.-.-LL............N..KV.G.NHSLNSSS..S.I..VR......P....G......F.....IW..QP...TVT..QFLNcdpevqsqakmftpekirfp...........................................................................................................................................................................................................................................................................................................................sqegaftnivksfvvikfhkKKQHWGF..KVEK.I.G.MGDYYGFVV-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A109UZ17_9SACH/284-669               ............................................................................................................................................................................................................................................CFAKGTDVLMSDGAV.KAIEDINIGDFVMGKD...G....N.....PREVT..A..L..P...R.GR..E.M.MYRVGDEN.-----.---S............EFEFVCNGAHKLVV.E....T.P..R...S.....V.R......V.....T.R.N.G..-.-......-.-..PK.....HTVN.Y..LGMCYEQT.KD.......G.RVIELC...K.QIS...KDFETAE...E-...--.....-.-..---...FMSFTAE......MP..KD........K..IQWTI.E.A.RDV............Q..LI.E.PAVRELTT..Q.I..IS......P....I......N.....YE..GR...KLV..EYLSnlkvdspvelpfivayflglwfsnssetltvgaelfsrisksaqmlglaaerksnqlvdiniknsilsdvisefgfengatkqipdflr.................................................................................................................................................................................telvlvreyflagivdclgsiedvaegyvlkidipktslgtalipllrslglnthladstlnvsgksslesllslsgntniarpynvtrESQNFKF..FLEE.Q.G.ENDYYGITLP..EDSD...RQ..FLLSNQVLVH...................................................................................................................................................................................................................................................................................................................................................
A0A177WQP4_BATDL/623-743               ............................................................................................................................................................................................................................................CFGRDTPLLMADGTT.KFVQDIKALDQLMGDD...C....T.....PRIVQerS..L..V...H.ES..G.A.LYRVVPKN.AN---.---G............HDAFVCNKEHILVM.V....N.V..K...Q.....P.W......V.....S.Q.T.V..I.D......G.V..DQ.....FHVS.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------evvcigniptvrssgnfasaveatka.........................................................................................................................................................................................................................................................................................................................
R9TRF4_9CAUD/87-211                    ............................................................................................................................................................................................................................................CLAIGTMVRMFDGSL.KRVEDIVVGDKVMGPD...S....K.....PRNVL..N..I..C...R.GF..D.D.MYTVHQKY.AD---.----............--DYTVNSSHILSL.R....KiP..S...A.....I.S......D.....E.T.K.T..P.D......G.K..RI.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------yryhpnepeilnigvseylsratskkfrhvfkgwrtgw.............................................................................................................................................................................................................................................................................................................
A0A1R0GMB9_9FUNG/596-1090              ............................................................................................................................................................................................................................................-FGPDTPVLMASGQT.KLIKNIKVGETLVGDD...G....N.....KRIVT..S..L..T...S.GK..S.P.LFRIKPVS.SFGVS.-IKGlkr......samDNGFVVNPAHILVV.S....F.P..H...Y.....P.K......V.....R.Y.T.R..-.N......N.P..DL.....IEIQ.Y..VSLEFNDK.LK.......-.SILPII...H.KEI...LTFKFKN...EL...IP.....E.N..PDS...ISPHLSKelislnIH..SD.......aN..IKNSA.E.N.DSY............Y..ST.N.KKIDCSEI..S.H..KN......F....K......H.....SR..--...---..---Aqfarkcieklpkiewevsvsdyiricdlypvisqisfiprakprlvsnskdstsvdrasnieplqsyekflligsilslyvssefdnsikfsntgdsidifiskstsnstpsvnkdnylrlilkslkslnskfk.......................................................................................inkstvgyslsieksnefikvcsesfgiefnppkdldfslltsslqnessiakenfisgvlsvlgirsqtfkgndcfilsqevpdlnscttsntfiatihlislslgliselfesesesnvyaiisnfqfspnkKIRGYRF..EISK.EsD.YGRYYGVSIS..G-SN...DK..FLLADST---v..................................................................................................................................................................................................................................................................................................................................................
G0VEY7_NAUCC/1-459                     ...........................................................................................................................................................................................................................................m-IEEGTRIIMADGQI.KDIADVTVNSYVMCED...G....S.....SSRVT..S..V..S...K.DV..Q.T.VYNVTQRT.RHRAY.EGEPgridplrrqiyqRLEINCTATHRLNL.R....T.L..T...K.....P.T......L.....E.N.S.F..K.R......N.H..--.....YVVK.W..KRMHNVTT.ID.......G.RVISIP...K.IHH...KDFLMTP...EG...EV.....A.-..---...AKLFLTQ......LQ..EEf.....gpQ..FNYNL.E.L.RDI............D..YL.S.TQICQTTM..L.H..YT......P....L......L.....TG..NG...ILS..EFLTgqkhlitpytlsmawllglwlgdgttkkpeisvdsidtnlmhsliqlgslwgldavykecpvplrakhvrlyygkgspkerkfrkdnifwnilldlrfkreddgvkqipefm..................................................................................................................................wtedveireallaglidsdgyvmkttpnsdifivsiptiypsimegivniarslgmtatvttksakqnvienrqiqckfayectisgktslqnvlsycrsglkhreppeevirNPVYFGF..NIEP.S.S.QKNTVGLAI-..-EDN...KQ..ILLENKI---ci.................................................................................................................................................................................................................................................................................................................................................
F4CAE7_SPHS2/1925-1979                 ............................................................................................................................................................................................................................................CFTAGTEVILADGSV.KPIELIGIGDQLLGYD...G....Q.....INTVV..A..Y..D...R.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------pllgkrklyafnd......................................................................................................................................................................................................................................................................................................................................
A0A0L0G4G6_9EUKA/50-124                ............................................................................................................................................................................................................................................CMAPETMVKMFTGEI.KRLDQVVVGDRLLGPD...E....R.....PRVVK..T..R..V...T.GR..E.Q.MYTVYQAD.S----.----............-DPYVVTGDHKLAL.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------fdhgvsr............................................................................................................................................................................................................................................................................................................................................
A0A1L0DCU1_9ASCO/284-333               ..................................................................................................................................................................................................................................rnrasesava---------------.----------------...-....-.....-----..-..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..---R...................................................................................................................................................................................................................................................................................................................................................................EAEPYYF..DLNK.T.E.VADYYGVTLE..DGSD...HQ..FMLANTALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1R4H588_9GAMM/230-327               ............................................................................................................................................................................................................................................CFGKGTRILMYSGAI.KAVEDIQVGDVLMGDD...S....T.....PRQVL..S..L..A...R.GQ..E.A.MYWVRQNK.-----.----............ALDYRVNASHILSL.K....R.S..R...N.....E.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nnskngdvlnlpltdymaasakfk...........................................................................................................................................................................................................................................................................................................................
G8DCS3_9VIRU/539-615                   ............................................................................................................................................................................................................................................CHAPGHPIMLANGLV.KAVEDVQVGDRLMGLD...G....S.....PREVL..R..L..A...H.GS..E.E.MFRVVPTH.-----.----............GESFVVNLGHILPV.R....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ightdvvi...........................................................................................................................................................................................................................................................................................................................................
W6MUU9_9ASCO/244-764                   ............................................................................................................................................................................................................................................CFAKGTKVLMADGTD.KPVERIAIGEEVMGKD...G....T.....PRSVI..A..L..P...R.GK..A.T.MYEVRHTTqHQSAD.DAEG............LMNYVCSDHHKLVL.R....T.P..Q...H.....V.N......L.....T.T.H.Q..L.R......G.K..MY.....TSVT.Y..FEKVATAV.GE.......-.----IV...K.KKT...RTYQHDI...HG...GA.....A.G..ALR..kAELYASD......IS..TE........P..IDWTI.E.A.KDY............K..NL.G.YFVKKSSY..Q.L..IN......P....V......H.....LE..TG...KLG..KTLEsygfskdlapqmayllgswvgdgymtrsmfsldpldtqyserinafgeefglvastaehhhryyktneaeeveasklteaaiaedgalvyegdlpgdpteqdlieeieasedsrpsssgsavsehswdergdlsvmlrpirqsgdsvl...........................................................rpklnvgnvfwdvvksfgvrkvsehdngdsvevhyskhvpthlsnddisvrehfiaglidsdgyvktdndsysatvttiysgvseglvrlarslgirvsvtvekahidksgvnhrlnyrvflsgpallgvlrncsldrkraefkeftrEAVPFYF..TLEE.K.P.EADYYGVTLP..DSSD...KE..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
G8ZQA6_TORDC/1-457                     ...........................................................................................................................................................................................................................................m-------VLCPDGNP.IAVDDIKIGDLLLSDG...G....R.....AVKVV..E..V..S...K.ST..D.E.LFEIKQKTnQSTWK.KPQE............LVHFTCAGKQRLVL.R....T.R..Q...R.....V.K......Q.....Y.V.I.S..K.DrrtgeiG.K..RR.....SVVK.I..PQYMDVKT.PD.......Y.RNIKIV...K.LLS...KTFADGC...N-...PK.....E.-..---...IQDHIDK......VK..VK........NelIRWEC.E.T.RDL............G..LL.KtKKIRRATR..L.L..VA......P....L......S.....LE..IP...VVL..PWIQenitkdvppqeieamtwlvgfwignghesvpsftladdadvnnrfdesanmwgmksipkngqknrvtlvndakqcthnpfstllrllgfyekxcpdfmrterllvrevflaglida...........................................................................................................................mgypalhftfvgvklvtmytpikeaivfvaeplalnvscsheaagsrperylynvnwilhnspgdnpeifwsivgmcssqrkkdslrrerceetidftqceeeennapalddevalNNNAIRF..KVVF.S.G.SREVVKIMC-..-EEG...KN..FLLHNRVI--tp.................................................................................................................................................................................................................................................................................................................................................
A0A2U3D5S9_9BACL/274-372               ............................................................................................................................................................................................................................................CHEADAPILMYNGEI.KRAADIQAGDQLMGSD...S....K.....PRNVL..E..L..H...R.GI..G.R.MVRVIPNK.-----.----............GEPFIVNEGHVLSL.K...sT.P..R...F.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------iknisieeyrkksnyfkrihklwra..........................................................................................................................................................................................................................................................................................................................
A3LP04_PICST/283-730                   ............................................................................................................................................................................................................................................CFAKGTKVLMANGDD.KNIEDIAVGEEVLGKD...G....L.....PREVV..A..L..P...R.GR..E.T.MYEVSEKT.QHRAE.TVFG............TASYTCNATHKLVL.Q....T.N..Q...R.....V.N......I.....T.N.H.V..L.R......G.E..SQ.....TSVT.Y..FQMKTAVA.D-.......G.REIELP...K.LCT...KSFQHSS...HG...RE.....N.A..WKK...AEVFAST......IS..RD........P..IDWTA.E.A.RDI............S..RL.G.YHVRRATR..Q.L..WS......P....V......L.....VE..KE...VLA..PMIAkrgfdesiapymaylvglwvgdgysdratfsidiqdveiherikdfashagltpriacykksrdatislhnsetrgknvrqnlntgnllwsllaeicgkkenemlfksvp......................................................................................................................................sflrsesiavreyfisglvdsdghvkrdeadkcysatvktiypavrdglvsvarslgiqtsvsveeakevnsvkhqesyaiymanssaldsvlskcaaprkraeepvcvnrEPHPYTF..HMVE.K.E.EDDFYGITLS..EDSD...HQ..FLLSNLALVH...................................................................................................................................................................................................................................................................................................................................................
A8BML4_GIAIC/5-439                     .......................................................................................................................................................................................................................................lakeq------KVRLYLGGL.KNVEQLMKGDVLMGDD...G....N.....PRTIS..A..V..H...S.SM..S.K.TYTITYSS.YLD--.-VKD............DRSFVCGDDAVLIL.I....P.D..G...N.....R.E......V.....N.R.I.I..N.T......G.A..DN.....QYV-.-..VEFVEPVT.DA.......M.KSISGV...K.LQW...KVFAQAD...DA...LS.....Y.V..DRS...LPNFLYE......SK..LS........D.fIKLEP.K.L.QRM............F..KL.V.RPLLPIRF.vD.A..VT......V....I......Q.....DE..TK...TDV..DILKnmdirptdlpwlcglylitgicidersfrfhlkelnsniagevkrifrclnsyyeiqfdeasenytirfqgasetndffkrfmiqfgmydartkryvkdslnpqvy...............................................................................................................................................lesfsrirgpflagildgssgyglsdinhglecyirgisspatrevvadlarscslsavvdqsdnntlilaggmlfrvpcvstipkdfpglvsltsypnpdgssvlLGMPMPF..SIKE.S.G.TRECYFLDI-..QEPN...KR..CLLSDYTVVH...................................................................................................................................................................................................................................................................................................................................................
A0A0D2H4V5_9EURO/358-833               ............................................................................................................................................................................................................................................CFAAGTPVMMADGTN.MNIEDITVGDSVMGKD...G....K.....ARVIK..A..L..P...R.GE..E.T.MYEIGIKT.QHQNE.TFR-............EVSYTCNAMHLLVL.Q....T.P..Q...R.....V.N......I.....V.D.H.H..L.E......G.K..MQ.....SSVS.F..FAFDTRQA.AT.......E.DGVNVVrelK.QYT...KSFQHDS...HG...GS.....E.R..ARS..lAEDFAAS......IP..RD........D..FHWAI.E.A.RDI............D..YV.D.VHVREATQ..Q.L..IS......P....V......F.....LQ..NE...TLN..SRLAqkgfdghlapqmayllgswvgnghhadsrmsvdpedaelvdrleeygkmfdleselvtfapgkrtvlgeinvnhsrpansisaalevaknlgfnfhegddlavelrgkgmntsstkglntnn..............................................................................................................vfwdmvlatgvrgssddqlkmvplwlssesfevrehflaglidsqgqvelndreqsatvktvypavceglvrvarslglcvsvstgeekafcvymtatgilesvlskcalssnrtaaptsverKAQPVYF..DVVK.K.P.AAPYYGITLP..DDSD...HQ..FLLGNLMLVH...................................................................................................................................................................................................................................................................................................................................................
G8ZLC3_TORDC/1-463                     ............................................................................................................................................................................................................................................MFEQGTKIMMANGQA.KDIQDIAINSYVLCAD...G....T.....IDRVT..S..I..S...Q.DV..Q.T.TYQILQKT.KHRAN.EGEPgredpmrrqvfhRLGFKCTVAHKLPL.R....T.A..S...K.....P.T......L.....E.N.S.F..K.R......N.N..--.....FKVK.W..KNMEEHLT.FD.......G.RIVSLP...K.THH...KDFPMTS...EG...EF.....R.-..---...ARSFMAE......KE..AEh......gR.yLEFSI.Q.V.RDL............D..LL.E.AQIRVNSF..L.R..FS......P....V......V.....TG..RG...ILS..EFLTgqkhlitpyvldmawllglwlgdgttkepeisvdsfdtclmegliercktwglfptykdepiplrakhtrlyfgqepdgnrrnrnlrkdnpfwnavinlkfkrdldgekqvpsf...............................................................................................................................mwtedievreaflaglidsdgyvvkrnegpdafkasiqtiypsimngivhvsrslgiastvttrsartetiegrkvnchftydchiagrtplqkvlsyccsghkkrpvpkviirEPIYFGF..NEEK.R.G.LQPVFGITT-..-EQG...KK..ILLDNKLVAH...................................................................................................................................................................................................................................................................................................................................................
A0A167X1Y2_9PEZI/262-747               ............................................................................................................................................................................................................................................CFAAGTPVMMADGSI.QAIETINIGDQVMGKD...G....T.....PRGVV..G..L..P...R.GT..E.T.MYHVSVKT.QHRNE.NAR-............DASFSCNASHLLVV.V....T.P..Q...H.....I.R......V.....T.N.H.T..I.R......G.K..KQ.....TSVT.W..FDWHVTQA.ED.......G.RSIRLV...K.LFT...KSWDHQT...HG...GE.....K.S..AAA..lADAFKDT......LR..TK........D..FEWTI.E.A.RDV............S..LL.G.SHVRKATQ..Q.M..LN......P....V......Y.....LE..VE...RLS..SLLDgygyktfapqmayllgfwvgdgyydraafsidsrdtaikdqfreygslfdlevdtreykkyeysssprqtrkalgelqvnvtknltdsppmlkkgftaigdetiflrpstsfagtgkrkplntgnvfwe.................................................................................................mvnatgvrgpdgqhakiipdflahesfevrehflaglidsdghvkpdepsatiktiypaicdgivkiarslgvrvsvcvesakivrgvshktsyavymsdpdnsgvlvsilsgcslerkkfnipihierKAQSIYF..DIKE.Q.P.AAQYYGITLA..DDTD...HQ..FLLGNMLLVH...................................................................................................................................................................................................................................................................................................................................................
G0WFK1_NAUDC/1-463                     ............................................................................................................................................................................................................................................MFEESTAIIMANNSI.EKIGDIKCNSYVRCED...G....S.....DSRVT..S..V..A...K.AT..Q.T.VYEIVQRT.KHRAN.EGEPgrsdplrkkvfqRIQLKCTAAHELNL.M....V.P..I...K.....A.T......I.....E.N.S.F..K.R......Q.K..--.....YSVR.W..TQFEKFQT.LD.......G.RVIMIP...K.NHH...KDFPMDS...DG...EK.....A.-..AKL...MKDDLNL......LY..GN........R..FIFNL.Q.L.RDL............D..YL.D.GQTRAAVS..L.R..YC......P....I......L.....TG..NG...ILS..EFLTgqphlitsatlsmawllglwlgdgttkepeitvdsfdqtlmeslkeqgylwglypyykdeavplrakhvrlyygagpsnkrkvrnlrrdnpfwntvkglkfkreddghkqlpef...............................................................................................................................mwnedveireaflaglidadgyvlkekradktyvvtiqtiyhsimegvvniarslgmwatvttrsartstiigrqvtcqftydisisgttplqsvlaycrsghkrreapkhvsrEPIYFKF..TEKV.I.G.QSNVVGLTI-..ENHK...QN..ILLANKV---aa.................................................................................................................................................................................................................................................................................................................................................
S4TRC9_9CAUD/34-122                    ............................................................................................................................................................................................................................................CLKINTKIIMFDGSI.KNVQDVVVGDLLMGPD...S....T.....PRRVL..S..L..G...R.GR..E.M.MYEVTPAK.G----.----............-DSYTVNESHILSL.R....T.T..T...G.....T.R......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------nktwpdntvfdipl.....................................................................................................................................................................................................................................................................................................................................
A0A2T9YGN6_9FUNG/596-1085              ............................................................................................................................................................................................................................................-FGKGTKVILFDGQV.KSIENIEIGDKLIGDD...G....E.....SRIVT..H..K..T...T.GK..S.P.LFRIIPESlFNNAP.KGMKra........dwDNGFVVNPNHALVI.S....F.P..Q...Y.....P.Q......I.....S.K.I.S..S.K......-.Q..NT.....ITVL.Y..IDLHFDSG.LN.......-.--TFIP...K.VLN...KSFNIADfadEN...GK.....A.A..ELK...VQRITKK......LS..KD........-..-----.-.-.-NY............I..RT.D.NNINRRTY..T.V..Y-......-....-......V.....TS..KH...SLK..SFILefeysreaavlsaksfinniksvywevsaidyinccnkynfirdisymtrtpikllrpnqeftnlqsyalnigfgkefslemsflagiflssidknildnhtnvyfkignsdldresnywdkliekikdilkkldi..................................................................................dyviekcesiytlsvdkqnpglinflnqfkikdinpmhmqslfsklypsllheniqtrnnfimgviaicgidtqlangkscvllsqvysnsnkisenellgvvhklstsigllsnsfidsssnslvliilpksnkniMDSSYKF..YIKHdQ.E.NARYFGVSVS..GNND...-R..FLLND-----gtv................................................................................................................................................................................................................................................................................................................................................
A0A2T9YGN6_9FUNG/1895-2001             ..........................................................................................................................................................................................................................................sw--DRGTKVLMADGND.KNVEDVVVGDLLMQDS...G....L....iPRVVL..K..T..C...S.DS..I.E.LIRVKFES.NE---.----............MEGFSCTPNHILVV.S...lT.E..D...T.....Y.N......L.....V.E.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ssdkitlsyythslvrqqrefiigy..........................................................................................................................................................................................................................................................................................................................
A7TIB9_VANPO/1-463                     ............................................................................................................................................................................................................................................MFEEGTRIIMADGTS.KDISEIIPNDFIMCED...G....S.....AAKVT..E..V..S...Q.DN..Q.T.TYQIVHNT.KHRAN.EGDAarkdplrkeiyqRLELNCTVAHELSL.R....T.P..A...T.....V.N......L.....E.N.S.F..R.T......N.H..--.....YKVR.W..RNLEETLT.VD.......G.RMICIP...K.NHH...KDFPMTP...EG...EL.....S.-..---...ARAFMAE......ME..AEn......gE.yFEFNL.Q.V.RDL............D..LL.S.PQIRVTSF..L.H..FN......P....I......I.....KG..NG...ILS..EFLTgekhlittgvlqmawllglwigdgttkepeitvdshdtelmkglhecgktwglyptykdekiplrakhvrlyygkeapenrkyrhfrkhnpfwnavtclkfkrdgdgakqiptf...............................................................................................................................mwsedvevreafmaglidadgyvvkrkegpdsfkvaiqtiypsimngvinisrslginatvttrsakpsiiagrkvncqftfdcniagraplqsilsyctsghkrrdrpvliarEPSYFGF..LEEK.R.D.KHEVYGIKI-..-NSH...KS..ILLENKMAV-p..................................................................................................................................................................................................................................................................................................................................................
A0A1G4MEZ8_LACFM/12-541                ..........................................................................................................................................................................................................................................li---TGTKIFLSDGRL.IPVEEIKVGARLMSLD...G....S.....DARVS..S..I..H...S.SV..D.D.ILQINQTS.CHTAH.LRDEnra.....ppwgLIELGCSKRQRMKL.R....T.K..Q...R.....V.K......R.....I.T.R.K..P.E......-.-..RC.....SIIE.I..TQLREHVT.ED.......G.RTIQTL...R.TTS...KQFPPSC...SS...--.....-.-..-QT...IEEYIES......CK..VP........NgfITWES.E.L.DDL............K..YL.N.KELRASTR..L.I..LC......P....L......A.....VE..IP...MLL..PWLEskfnrgitdkeleamawllgfwignghrrgakfslrsgdhdvndyleacgtlwgmtlrivlrdpengykadgylhtfdgevrnwnrnnplvkvleglrfyqngrldgkkaipsfmkteqrlvreafmaglidsdgfiniqdhclrvkist......................................................isplirdgilsvgrsmglnvtvhfcpekqnlngyhesdtwvfhlfggsnhgtlwsilcrcscerkrnppiqfvrkrdvaefetddeedsdvsleealgewveapsnndkgllarssaggrkvseiiseddqfeqggdessefdledddnnlHFAFIPF..KTSQ.V.G.TAQVFGITFS..EDSN...IK.pFLTEQQV---mc.................................................................................................................................................................................................................................................................................................................................................
N1J5L1_BLUG1/1500-1624                 ............................................................................................................................................................................................................................................CLALGTLLLQFDGSK.IAVEDVQEGDLLLGPD...G....G.....PRCAF..N..I..V...R.GR..D.R.LYRIKMGI.N----.----............QEDLVVTSNHILVL.H....R.P..I...V.....S.Q......S.....S.S.P.E..T.E......I.L..SD.....RNAN.F..DNKLTSAD.EK.......-.TRYEVV...E.MTA...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------aefaaldyndrke......................................................................................................................................................................................................................................................................................................................................
A0A0A7LLQ8_9BACT/244-331               ............................................................................................................................................................................................................................................CLGKGTKVLMFDGTL.RNVEDVQAGELLMGDD...S....T.....PRRVL..N..I..A...R.GR..E.N.MYWVRQNK.-----.----............GEAYRVNESHILSL.K....R.S..R...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------tegphrhgdvlnitvk...................................................................................................................................................................................................................................................................................................................................
J4U3C4_SACK1/1-464                     ...........................................................................................................................................................................................................................................m-LSENTTILMANGEI.KDIANLTANSYVMCAD...G....S.....AARVV..S..V..T...Q.GY..Q.K.IYNIQQKT.KHRAF.EGEPgkldprrrtvyqRLDFQCTAGHKLSV.R....V.P..T...K.....P.L......L.....E.K.N.G..-.R......N.A..TK.....YKVR.W..RNLQQSQT.LD.......G.RIITIP...K.NHH...KTFPMTV...EG...EF.....A.-..---...AKRFIEE......ME..RSk......gE.yFNFDI.E.V.RDL............D..YL.D.AQLRISSC..I.R..FS......P....V......V.....TG..NG...VLS..KFLTgrndlvtpavksmawmlglwlgdgttkepeisvdsldpklmeslrehaktwglyltvcddhiplrakhvrlhygdgpgenrktrnlrknnpfwkavttlkfkrdfdgekqipdf...............................................................................................................................mygehvevreaflaglidsdgyvvkkgegpesykiaiqtvyssimdgivhisrslgmsatvttrsareetiegrkvqcqftydcnvaggttlqnvlsycrsghktrevppavkrEPVYFGF..TDDF.Q.G.ESTVYGLSI-..-EGH...KN..FLLGNKI---evk................................................................................................................................................................................................................................................................................................................................................
A0A255Z8B3_9FLAO/232-328               ............................................................................................................................................................................................................................................CLGKGTKVLMFDGNL.KNVEDIVEGDLLMGDD...S....T.....PRRVL..S..I..A...R.GR..E.K.MYWVHQNK.-----.----............AISYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egphkkgdilnitvkdyieksdkf...........................................................................................................................................................................................................................................................................................................................
R9TND4_9CAUD/87-211                    ............................................................................................................................................................................................................................................CLAIGTMVRMFDGSL.KRVEDIVVGDKVMGPD...S....K.....PRNVL..N..I..C...R.GF..D.D.MYTVHQKY.AD---.----............--DYTVNSSHILSL.R....KiP..S...A.....I.S......D.....E.T.K.T..P.D......G.K..RI.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------yryhpnepeilnigvseylsratskkfrhvfkgwrtgw.............................................................................................................................................................................................................................................................................................................
C1H7Q2_PARBA/1525-1605                 ............................................................................................................................................................................................................................................CLAKGTLLLRYDGTK.VEVENVREGDLLLGPD...G....G.....PRRAF..N..I..V...G.GR..D.R.LYRIKMDG.-----.---G............KEDLVVTPNHILVL.H....R.E..K...R.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dgvdkvy............................................................................................................................................................................................................................................................................................................................................
A0A0L0G3W8_9EUKA/49-159                ............................................................................................................................................................................................................................................CMAPDTLVKMCSGVL.QRIDKVVVGDLLLCPD...I....R.....PRRVL..N..K..V...R.GI..D.Q.MYTIHQAD.S----.----............-DPYVVTGDHKLVL.Y....N.V..K...T.....E.S......I.....V.V.C.T..A.E......K.S..TT.....ST--.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------vlsyhdgyacktcsdgtiqyara............................................................................................................................................................................................................................................................................................................................
A0A0J9XBH9_GEOCN/191-601               ............................................................................................................................................................................................................................................CFSLDTAFATPDGRN.IVNSDLCVGDKLLGPD...G....L.....PRTVL..S..M..K...E.GE..K.E.LYEIKYLT.KRANG.LE--............KDKFTCTGGHLLCL.R....I.D..T...P.....V.D......A.....P.C.I.D..R.N......R.N..NY.....FVKH.Y..IGNSERMC.ST.......K.AMFTTV...E.EAR...AYYEAAN...KT...PV.....E.F..EMT...VENYLA-......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------apqsirrkarlyrastllfdapeidltigqtseeevawliglwlgdgdsnstrftmhsssdseiltrvtdiatkmglatvigeyadreaiwvnlstqsgppkymteasnvlkenpfylklselglindkhvpsvlqkhtvsvrhaiiagvfdadgtyakgqfdlefsaktgpklfhsvvwtlrslgfvvhishrisvaagiehkklrmhfngvsaedlpiastrkigssltrawatsqqfsvtpvgvgafrgfevdgdgrillsdfmvah.....................................................................
A0A318ZZU1_9EURO/1524-1635             ............................................................................................................................................................................................................................................CLAKGTQLLRYDGSK.IAVEDVKEGDLLLGPD...G....G.....PRRAF..N..I..V...S.GS..D.P.LYRIKIGG.-H---.----............KEDLVVTPNHILVL.H....R.E..K...G.....S.E......N.....S.H.E.Q..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------dnahpevsaterfdtveltaaefaaldkneq....................................................................................................................................................................................................................................................................................................................
A0A1G4JMS3_9SACH/285-731               ............................................................................................................................................................................................................................................CFAKDTEVLMADASV.KSIQDIEIGDHVMGQD...G....S.....AREVT..A..L..P...R.GR..D.T.MYDVVEHN.ESIDG.AGRDev........skFVDYTCNASHQLVV.R....T.P..R...A.....V.N......F.....A.S.R.L..L.E......G.T..WY.....NEVT.S..LELKNHIT.SD.......G.RLIQLV...Q.PVA...NRYP-AS...EG...TQ.....K.A..TEL...VAAYNKS......ST..KD........Y..IEWAI.E.A.RDL............E..KL.D.AGIREATY..Q.V..AA......P....I......F.....YE..SD...FLA..NYVKessyetqsneshavlayllglwigggmtrraafsvhpeddslmkriekcaeilglcaeynenttsrakavnlynkaarressrqnvntanllwdaivelgfskengk............................................................................................................................................sipsflssdaiavrevflaglvdsngsvaekeeitatvktatsplkegvvrvarslgldvsvstdvsktelesssyavtlsggnvlrsvlskcansqnfrpitesvvrESKKVYF..SVKQ.L.EsEDNYYGITLP..QNSD...HQ..FMLASQAVVH...................................................................................................................................................................................................................................................................................................................................................
A0A1Q5SSI5_9EURO/1524-1603             ............................................................................................................................................................................................................................................CLAKGTRLLRYDGSE.VNVEDVKEGDQLLGPD...G....Q.....PRTAF..N..I..V...S.GE..E.R.LYRIKLGA.S----.----............KEDLVVTPNHILVL.H....R.E..K...R.....A.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rnvya..............................................................................................................................................................................................................................................................................................................................................
C6JQ04_FUSVA/2-124                     ............................................................................................................................................................................................................................................CLEENTRILMADGSQ.KPVREIRIGDMVMCDL...G....E.....PKIVR..N..V..W...Q.GR..E.E.HM------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------mcielkngskiiltdnhpiktatgikraneineddeisivygdkskiasiscieyndrafnldisgnfmiaegia........................................................................................................................................................................................................................................................................
A0A177WDJ3_BATDL/1297-1751             ............................................................................................................................................................................................................................................-----TLVRMANGKT.RVIEDLVPGDCVLGAD...G....S.....ARSIK..A..V..M...E.GK..D.D.MFRIVMHS.EHNMV.SSTDsnip....sawkASGFTCNSRHDLII.T....A.P..L...F.....D.V......V.....T.I.S.R..T.E......L.Q..GH.....VSVK.F..AEVQFSSQ.IA.......G.VGSEIV...ScERH...FLWLSTS...QG...YA.....T.K..DEAfaaAESFAAE......KR..AL........Q.pVVWKV.P.A.QEF............S..IF.A.KACPSKAQ..A.MrmIRtsvsrfP....L......A.....SP..TT...SIR..YYLQqhitnhkindgdvasfgyllgawlcigeqrssvfvlnqnqqsirssietiasrfkmksfiasentgmikltleplqpgvpnlfelvlrqidnllftekhisqtcrd..............................................................................................................................................ilvsqpqsfrthmlsgalnsctqgsdqpstchctvfldfasagaqdamllirdlvwsvglgceisvddssdipngqgrlaacinganiesitcynpdkivddsltqpTNSMISF..TVAS.A.G.HGKYFGFELEplQSSA...PH..FLLD------sf.................................................................................................................................................................................................................................................................................................................................................
Q6FQS3_CANGA/285-698                   ............................................................................................................................................................................................................................................CFAKGTQVLMADGSN.QSIENIKIGDKVMGQD...G....K.....PRNVT..A..L..P...R.GY..D.D.MYNVELDG.-----.--ET............DLSYTCNSNHTLVL.K....T.E..Q...N.....V.L......L.....A.G.-.-..-.-......-.-..--.....NTVS.Y..FALGALID.ET......nG.RAVEIV...Q.EVQ...ETFESNI...S-...--.....-.-..---...ASDFAAN......IN..RE........P..ISWTL.E.I.RDI............D..YL.S.ERVRMFTK..Q.S..VN......P....V......L.....LE..TP...TLA..KQLEsnestatnlayllgtwiaskattagtisvpttkadllskvksalsslsidyssesinsvstyrrtqsiplmengkhvgnanitaeqeieetmevlslnvtnhss...................................................................................................................................................klfhdlalsminqdgsrsipsaftheqlcvresfvagildmqgcniengveidssinglaklsrslglrcnkssnllklsgnmsnisaqstnnwtstednssayKAQLMDF..SVQK.L.P.KDNYYGVTLD..DDSD...HQ..FLLSNLVLVH...................................................................................................................................................................................................................................................................................................................................................
A0A0N9R2V4_CEV01/649-739               ............................................................................................................................................................................................................................................CHIKDTPIMLSNGKI.KMVQNITLEDKLMGDD...S....T.....PRNVL..A..L..G...N.GI..E.K.MYRIEQIK.GD---.----............--DYIVNESHILSL.K....M.T..K...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------agkkgdkhqtilgrryfkg................................................................................................................................................................................................................................................................................................................................
B8FA79_DESAL/3543-3591                 ............................................................................................................................................................................................................................................CFAQGTPVLMADGKE.KPIELVGAGDNVMGFD...G....K.....PDRVR..R..-..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ktkrrspslr.........................................................................................................................................................................................................................................................................................................................................
A0A1V2LD80_CYBFA/284-778               ............................................................................................................................................................................................................................................CFRKGTDVMMANGQD.KVIEQVEVGDQVMGSD...G....L.....PREVV..G..L..P...R.GN..S.T.MYAVSQSV.ESPS-.--LD............KIEFVVSEDHLLVL.K....T.K..Q...N.....V.T......I.....S.R.-.-..-.-......N.D..DC.....FQVV.H..YEMEDG--.--.......-.----FV...R.ERT...ESFDIKS...NG...GE.....T.Q..AKA..lADAYAKG......ID..TN........A.vFDWTV.T.A.KDFfegsyvnstgskR..EI.A.ERVKDAST..Q.M..IQ......P....V......L.....LE..SG...NFA..SKLNnvsikgsasdmayllgawvgnghidtssyslacdntdfakkitecaaklglgathhvfherhapaspmsvasevssdfemddcsmlsdddssatesvevsgkssyrshasaldmsllkgdmtvtihgadvtqlc......................................................................................etfglrnnadgsyeksvplslatddievrehfiaglidsdgsvkhvtnenviledelasgniscathavvntiydgvaqglvkvarslgiaasintkdatgvnqiylggeallpvlskcsteekrvefdsenftrKAVPMKF..TLDE.L.P.NEDYYGITLA..KETD...HM..FMLSNMVLVH...................................................................................................................................................................................................................................................................................................................................................
A0A345J3R8_9PROT/205-303               ............................................................................................................................................................................................................................................CLGRGTKVLMYDGTL.KNVEDIKVGDQLMGDD...S....T.....PRNVL..S..L..A...R.GK..E.Q.MYWIRQNK.-----.----............AIDYRVNESHILSL.K....R.S..R...S.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egshkngeilniglkeyleksdkfks.........................................................................................................................................................................................................................................................................................................................
A0A372RW14_9GLOM/638-1022              ............................................................................................................................................................................................................................................CFGKGTPILMYDGSV.RAVETIQTGDQVMGDD...S....T.....PRNVS..G..V..T...S.GK..G.L.LYKIIPIN.NSSA-.----............-QPFVCNDAHILVL.R....I.T..S...S.....P.Y......I.....Q.H.Q.K..R.K......G.Q..--.....FCLN.Y..FIYDNNTN.LV.......K.KTNIFY...K.YPT...SQFQNKY...HA...KR.....A.A..IKS...LEMLNSD......KI..PN........L..FYQSV.N.SnADL............K..IVrG.DFIWQPSV..T.Q..FL......N....C......S.....SE..VQ...SAA..NMFTpnkvrfsvregtfakiieriigspitsniikfyawligywigtdfvmsntrsgddnqdivaslfgelgilrrkdipeimmye..............................................................................................................................................................................................didlvrlpllagiidskglyipqedvielsltdvcnaknfvkisrscglqasipdpqnkcilhkasiissvlfrsnckindhkYDQLWRF..QIKE.L.G.VGEYFGFVV-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
G8JWX2_ERECY/284-671                   ............................................................................................................................................................................................................................................CFGEGTEVLMADGSI.KAIENVKIGEYVMGQH...G....Q.....SQEVM..A..L..P...R.GR..E.V.MYTVKDVS.S----.----............KHAYVCNASHKLVV.E....T.P..S...S.....I.K......V.....S.S.Q.S..-.-......-.G..GI.....LSVK.Y..FGMCYEHT.ED.......G.RVIEQC...K.QFT...KSFTCIE...E-...--.....-.-..---...LQQFCSQ......QP..TE........N..FKWTV.E.A.RDV............E..NM.D.PAVREATF..Q.L..VC......P....I......L.....YE..GH...QLA..QYLAtqknglpseaatilayflglwsgnqsneievtaevfsrlqgavellglhvkrqqgvsksirlslknsimadviakfgftnagektipsf................................................................................................................................................................................lrsesitsrecflaglvdaagsvneatgdlaavislprsslegaskvagslgleiklepgflkicggsalqsvlsicgtvavekpehvvrKPKHLKF..IVEK.M.T.EDNYFGITLP..EDSD...RV..FLLNNQVLVH...................................................................................................................................................................................................................................................................................................................................................
A0A437MC52_9PROT/38-115                ............................................................................................................................................................................................................................................CLARGTPVIMFDGRV.VPVEDVVVGDLLMGPD...S....R.....ARRVT..S..L..A...R.GR..E.E.MFRITPLR.-----.---G............GDPYTVNRSHVLSL.R....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------mtggslht...........................................................................................................................................................................................................................................................................................................................................
A0A1G4KM81_9SACH/10-538                ...........................................................................................................................................................................................................................................g-FVKGTKIMMASGER.KSVDGIKVGDFVMKED...G....T.....PVQVV..A..T..P...S.KV..T.D.TITIHQAT.NHTAH.LKDPtrs.....ppwgVFGFTCAKRQSLKF.E....T.Y..Q...-.....V.K......K.....D.S.Y.R..S.N......G.K..RV.....ISI-.-..HQLTATQT.RD.......G.REIVVV...K.NKD...KLYKHAG...D-...EE.....A.A..NEY...ISKVMGP......YP..YR........I..IDWEC.E.V.GDL............D..YL.T.GGPRTSTD..L.S..FY......P....L......N.....FE..NP...VLL..PWLEnhfsravstkeiegmswllgfwvgdgyrrgpifalhnedndvngrlrrngalwgmdliikkvgpesskkatgylhtytgtlrnlyhkspicevlsglgfwengrrgaakrvpmflstdqvivreaflaglidsdgccriqnnclrakivt.......................................................alppvrdaisaigrslglnvtvyfyherihklgyhesdawtfnlfggpnleilqsilnrcscerkrdppiqyekaseefesqedrssrirkemlaeedseegnddtddtedallseidemslveakdlkvetpdtyfdgqqgdehkdivlNPNRVRF..TTED.C.G.EKEVFGLIC-..-STK...TN..LLTGDQIVV-g..................................................................................................................................................................................................................................................................................................................................................
U9W5T1_9CYAN/226-319                   ............................................................................................................................................................................................................................................CLGKGTRVVMFDGTL.KAVENVAVGDLLMGPD...S....K.....PRKVL..S..L..A...R.GR..E.M.MYWVRQKR.-----.----............AIDYRVNESHILSL.K....Y.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------sgdngtikhgdifnvsvrgyldks...........................................................................................................................................................................................................................................................................................................................
A0A126PB81_9BACT/246-324               ............................................................................................................................................................................................................................................CLGKGTKVLMFDGTL.RNVEDVQIGELLMGDD...S....T.....PRRVK..S..I..A...R.GR..E.N.MYWVRQNK.GD---.----............--DYRVNESHILSL.K....R.S..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rtegphrh...........................................................................................................................................................................................................................................................................................................................................
E1F2U6_GIAIA/5-439                     .......................................................................................................................................................................................................................................lakeq------KVRLYLGGL.KNVEQLVRGDVLMGDD...G....N.....PRTIS..A..V..H...S.SM..S.K.TYTITYSSyLDVT-.---D............DRSFVCGDDAVLIL.I....P.D..G...N.....R.E......M.....N.R.I.I..N.T......G.A..EN.....QYV-.-..VEFVEPVT.DA.......M.KSISGV...K.LQW...KVFAQAD...DA...LS.....Y.V..DRS...LPNFLYE......SK..LS........D.fIKLDP.K.L.QRM............F..KL.V.RPLLPIRF..VdA..VT......V....I......Q.....DE..TK...TDV..DILKnmdirptdlpwlcglylitgicidersfrfhlkelnsniagevkrifrclnsyydiqfdeasenytirfqgasetndffkrfmiqfgmydartkryvkdslnpqvy...............................................................................................................................................lesfsrirgpflagildgssgyglsdinhglecyirgisspatrevvadlarscslsavvdqsdnntlilaggmlfrvpcvstipkdfpglvsltsypnpdgssvlLGMPMPF..SIKE.S.G.TRECYFLDI-..QEPN...KR..CLLSDYTVVH...................................................................................................................................................................................................................................................................................................................................................
A0A0N9R0K9_CEV01/529-934               ............................................................................................................................................................................................................................................CFDPETPIMMWSGEI.KLAKNIIIGDILIDDL...G....N.....PTKVR..T..T..C...F.GV..K.N.MYDIIPDK.S----.---N............FIKHRVTDNHILTL.Y....I.R..Q...H....kI.I......I.....L.C.N.K..K.D......R.E..ER.....YNVK.F..FNRETNKI.QQ.......-.------...-.---...KSFKSYD...E-...--.....-.-..---...VENYIHS......FN..DD........N.tIDITI.E.-.-DY............L..KL.D.NYTKKHLV..LyK..TN......S....I......K.....WE..TK...KVEmdPYLLgmwlgdglscgtgfalnyktdfelldywkmwaetnealinkderykykicskknkeaydkgfcnrveeaplkkylkkynlinnkhipndyivndknirlkl.........................................................................................................................................................lagiidtdghvrdngreiricqgpknykiiddihkiaislgfscnvkegisqwtdkktnnkkyssykeiritgnniheiptllprkklhkytdktlimrnnSFMSSPF..ILKE.T.G.VGKYVGWQL-..EDKK...GR..FLLDGGLVVH...................................................................................................................................................................................................................................................................................................................................................
A0A2I7R1S6_9CAUD/377-498               ...........................................................................................................................................................................................................................................s-FCAGTPILMYDFTT.KNVEDVIKGDLVMGDD...G....S.....PRTVL..G..S..H...S.GT..D.M.MYKVTQQD.-----.----............GVSYVTNSRHILSL.R....A.G..F...D.....T.N......V.....K.G.K.D..R.N......S.S..RR.....CSVN.Y..KKGQIVNI.SV.......T.DYLKLP...K.LA-...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kralkgykgvl........................................................................................................................................................................................................................................................................................................................................
A0A411BAQ8_9CAUD/87-212                ............................................................................................................................................................................................................................................CLAIGTMVRMFDGSL.KRVEDIVVGDKVMGPD...S....K.....PRNVL..S..I..C...R.GF..D.D.MYTVHQKY.AD---.----............--DYTVNSSHILSL.R...kV.P..S...A.....I.S......D.....E.T.K.T..P.D......G.K..RI.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------yryypndpeilnigvseylsratskkfrhvfkgwrtgwd............................................................................................................................................................................................................................................................................................................
R5PFQ2_9BACT/260-341                   ............................................................................................................................................................................................................................................CLAKGTMVLMYDGTF.KKVEEVAVGDKLMGID...S....T.....PRNVL..A..L..G...H.GV..D.E.MYTVHQQD.-----.----............GSSYTVNSEHILSL.K....T.E..N...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------gdivdipike.........................................................................................................................................................................................................................................................................................................................................
A0A317XTZ4_9BASI/279-707               ............................................................................................................................................................................................................................................CFARGTKVMMANGLT.NAIENVRVGDQVMGKN...G....Q.....PREVV..A..L..P...R.GH..E.N.MYEVVQTS.QARTK.NDLV...........gQLSFVCNATHKLVL.K....T.F..A...H.....I.T......V.....S.D.H.M..L.R......N.K..GH.....TSVV.F..FEKKQVAA.PDaakraprD.QKIDMV...Q.LVT...RSWQHVT...HG...GR.....D.A..ARA..kAEAFVAS......LP..TR........D..IEWTL.E.A.RYV............D..TI.D.QDVRAATV..Q.M..VA......P....V......L.....FE..DH...TLA..RCLAqapglplnasddyklgwllglwtgdgystanessldsdktevqartlsfasdlqpatddscsflaetikscgvcgpdgtkavpawlsresirvrey...................................................................................................................................................................flaglidsnghvkraaagrqasahiqtiyravaegvvavgrslglrvsvswepehtayfvnltdeepvdnvlasllskcavqdkqmaapasrsvrrKPTSFSF..DLKK.L.P.ADDFFGITLP..ADSD...HQ..FLLANNALVH...................................................................................................................................................................................................................................................................................................................................................
A0A0J9X536_GEOCN/284-719               ............................................................................................................................................................................................................................................CFSKGTKVFMADGTQ.NSIEDIEVGDEVLGPD...S....K.....PRSVV..D..L..P...R.GT..D.D.MFVVSEET.QHEAD.SEVH...........dSRSFTCNASHQIVV.Q....T.P..R...N.....I.R......V.....T.E.H.E..L.C......G.K..KQ.....SSVV.T..FVKKDLQV.N-.......G.RVIDMV...S.AEV...KNFQHSA...L-...-P.....N.A..AEL...AREYADS......LP..RD........P..IDWVI.E.A.RDY............E..LM.E.QDVRNATV..Q.R..SS......P....I......L.....IE..NN...AID..AFLItqgyeghgaelsylmglsagdaysksavfsiheedvqlhkriadygnaldldctivkhqdelensislrsrevcgnglgrhlntnnpffaalkhfglsdsknvpe.................................................................................................................................................flvtekiayrehflaglvdsdgyvkkepmpcatiktihesvrdgviavarslgirasvdttkstaiqngpakeyslnlsgdclasvlskctldskqvpapstvtrEGESFSF..NVAK.T.E.PAEYFGLTLS..GDSD...HL..FLLANGVVVH...................................................................................................................................................................................................................................................................................................................................................
K9YRK7_DACSA/214-315                   ............................................................................................................................................................................................................................................CLGKGTKVVMFDGTL.KAVENIQVNDQLMGPD...S....K.....PRKVL..S..L..A...R.GR..E.M.MYWVCQKR.-----.----............GVDYRVNESHILSL.K....A.S..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------gsegrrvhgevvnisvqdyltksqkfqqrhk....................................................................................................................................................................................................................................................................................................................
A0A2I1GLX1_9GLOM/408-602               ............................................................................................................................................................................................................................................CFAKGTKILMYDGTH.QNVEELNVGNQIMGDD...D....N.....PRTIQ..S..T..T...K.GE..G.I.MYRIIPND.KGPAK.----............--FFECNDQHILVL.K....F.A..A...E.....P.Y......M.....R.S.E.E..I.P......IiN..RS.....PRIR.L..FWYEYDAQ.NN.......-.---MIV...K.KND...SFYYGPG...EDypkKE.....V.A..KRA..aIREMARR......PNlvSS........D..FIWEI.P.I.KDF............L..TA.S.DEIQRSC-..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lmfkpnqvifksvqgrfrvilskilgvs.......................................................................................................................................................................................................................................................................................................................
A1ZUM1_9BACT/19-89                     ...........................................................................................................................................................................................................................................g-FVAGTQILMKDGSS.KNIEDIKDGEEVMSPD...G....S.....ERVLK..V..I..QpslH.MR..R.N.LYHIANQNgQ----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------kvenfmfvdsqv.......................................................................................................................................................................................................................................................................................................................................
A0A0C7N7Q2_9SACH/10-529                ...........................................................................................................................................................................................................................................g-FVAGTKFMMADGEQ.RAIENISVGDKLMKDD...G....T.....AVEII..A..V..P...C.QV..T.D.TVKIRQAS.NHTAH.LKDPtrs.....ppcgLFEFACASRQSLKF.A....T.F..Q...-.....V.K......K.....D.S.R.R..S.N......G.N..RV.....IGI-.-..HQMAVGKT.KD.......G.REIALV...K.NKD...KIFRHDG...DD...YA.....-.A..NKY...IAETMAP......YP..DK........L..IFWDC.E.V.GDL............E..CL.T.AAPRTSTG..L.S..FY......P....I......Y.....FE..NP...VLL..SWLEnhferavtmkalegmawllgfwvgngykrgpifalhsedhdisgrlkrnaklwgmelvikkvgpsggknatgylhtysgtvrnlyqkspicevlsglkfwengrrgeakrvpkflstdqkivreaflaglidadgstriqdnlir................................................................akivtvlppvrdainaiarslglnvtvyfyhermhklgyhesdawtfnlfggtnqetlqsilnrcscerkrnppiqkdrnedveefedqegqksagindmlseedynnpddssvvsddeetalfeidavdtyfekhqgfndedinlNPNRFRF..IMES.N.G.EQEVFGLVCS..DE--...CK..LLMSDQIVV-g..................................................................................................................................................................................................................................................................................................................................................
L1KI73_9ACTN/223-281                   ............................................................................................................................................................................................................................................CFLAGIDVLMADGDT.RDIEDIEVGDEVLAAD...G....D.....TVVVM..G..N..-...-.--..-.-.--------.-----.----............--------------.-....-.-..-...-.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------spfiqhartynltveglht................................................................................................................................................................................................................................................................................................................................
A0A0J6WV84_9FIRM/33-158                ............................................................................................................................................................................................................................................CHAIGQKLLLANGKI.KKVEDISSNDMLMGDD...G....N.....PRKVL..N..I..I...H.GT..G.R.LYRIIPIK.G----.----............-NPFIVDENHMLTLiR....T.P..Q...D.....N.H......P.....KcP.S.R..A.R......G.R..EI.....IDVT.V..KEWLSWSK.TK.......K.HLYKL-...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------lrssaienfsnnnyhyd..................................................................................................................................................................................................................................................................................................................................
A0A1S5V145_MIMIV/737-1126              ............................................................................................................................................................................................................................................CLHPDTDVMMFDGRI.KKAKEIVKDDMLMGDD...S....E.....PRYVL..E..T..C...K.GE..D.E.MYKIVPMK.-----.----............GEPYIVNGSHILCL.K....S.S..G...Y.....K.-......-.....-.-.-.-..-.-......-.-..--.....-SVC.W..AGDKKNMY.QA.......-.MWMENH...V.NRS...KSFNVKK...YG...TK.....E.K..AEQ..aAREFLET......VK..SD........K.gKILHI.S.V.DDY............L..KK.P.SHWRINYY..T.Y..HV......G....Vd....fI.....EQ..EV...DVD..PYIIghwlgdgtsastsftsadqeivdyyekyfnntgisvkkckeyrydistgskkggkyknwylnalnkynlinnkhipeeyllnsrqvrlavl............................................................................................................................................................................aglidsdgsncknrgidiiqknerladdivylarslgfwcdkkqctktctngkngpvtgtyyriyiygndfselpllleykrphpeekthklDHLISSF..KIEK.L.G.KGKYCGFEL-..-DGN...HR..FLLGDFTVTH...................................................................................................................................................................................................................................................................................................................................................
A0A2T9ZE01_9FUNG/1894-2011             ............................................................................................................................................................................................................................................CFALGTKILMADGSE.KAVEDVVSGDTLMQDS...G...pV.....PRTVL..K..T..C...S.GS..S.L.LIKVCFES.PS---.---I............LEGFLCTPNHILVI.S....L.S..E...S.....-.S......V.....Q.Y.S.E..E.N......G.E..FS.....ASFY.T..KKLER---.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------ksltfdektdvfevaelda................................................................................................................................................................................................................................................................................................................................
H2APW1_KAZAF/284-774                   ............................................................................................................................................................................................................................................CFAKGTKVLMADGSD.RAIEDISINEKVMGKD...G....T.....PRTVI..G..L..P...R.GR..E.T.MYQVRHMTsKRSSD.EAFG............SMDYVCSANHKLVL.R....T.P..Q...R.....V.I......L.....D.S.Y.E..L.N......N.Q..KY.....TTVT.Y..FTLENTRY.GQ.......-.----IV...K.RMT...KSFQHPA...SE...ID.....G.Q..STR..nARTFAAT......ID..RA........P..IDWDI.E.A.RDY............E..KL.G.YHVKEASY..Q.L..IN......P....V......F.....QE..SG...IFA..AKLNnfgfakkiapemawllgfwvgagdmeqfsfsiagtetelishivkcanlvgltitsteicnsfkrdqgyeeaklagmakgipeeagvvvfeddkdgqpaenvlvaldkssvqpfdihstpsesknnlllsles.........................................................................................edkgaffnklvdtlhlrvkssnangssyvknvpldlssddivireqflaglldsrkcstdfityspkismgvirlarslgikaavndgnsdygsvrgdslppkykiqlggtaihgvyqysfykgfpsvepferKGIPFFF..TLQE.K.P.EDDYYGITLP..DATD...KQ..YLLSSLALVH...................................................................................................................................................................................................................................................................................................................................................
A0A1E1GE23_9CAUD/386-498               ............................................................................................................................................................................................................................................CESKDTPILMHNGLI.KMIQDVEVGDLVMGDD...G....S.....PREVL..G..L..S...R.GR..D.V.MYRVDQTD.GD---.----............--SYTVNSKHVLAL.R....A.G..Y...D.....T.N......Y.....D.G.G.T..R.S......K.S..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------rrcgvdfkkgdyvnisvseylklpftarr......................................................................................................................................................................................................................................................................................................................
C5M9I6_CANTT/244-713                   ............................................................................................................................................................................................................................................CFTKGTQVMMADGAD.KSIESIEVGDKVMGKD...G....M.....PREVV..G..L..P...R.GY..D.D.MYKVRQLSsTRRNA.KSEG............LMDFTVSADHKLIL.K....T.K..Q...D.....V.K......I.....A.T.R.K..I.G......G.N..TY.....TGVT.F..YVLEKTKT.G-.......-.--IELV...K.AKT...KVFGHHI...HG...QN.....G.A..EEK...AATFAAG......ID..SK........E.yIDWII.E.A.RDY............V..QV.D.EIVKTSTT..Q.M..IN......P....V......H.....FE..SG...KLG..NWLHehkqnkslapqlgyllgtwagignvkssaftmnskddvklatrimnyssklgmtcsstesgelnvaeneeeffnnlgaekdeagdftfdeftdamdeltinvhgaaaskknnllwnalkslg...............................................................................................................frakstdivksipqhiavddivvresliaglvdaagnvetksngsieavvrtsfrhvarglakiahslgiessinikdthidaagvrqefacivnltgaplagvlskcalarnqtpvvkftrDPVLFNF..DLIK.S.A.KENYYGITLA..EETD...HQ..FLLSNMALVH...................................................................................................................................................................................................................................................................................................................................................
C5DTQ4_ZYGRC/1-463                     ............................................................................................................................................................................................................................................MLEEGTKLLMANGQI.KDVGKLDVGEMVMCED...G....S.....SAKVT..S..V..A...R.DV..Q.T.TYQILQKT.KHRAN.EGEAaekdplrreihhRLGFQCSVAHELAL.R....T.S..M...K.....P.S......V.....E.N.C.F..K.R......N.H..--.....FKVC.W..KNLEDTLT.LD.......G.RIIKIP...K.THH...KDFPMTP...EG...QL.....A.-..---...AKGFLDE......KE..NSt......gR.fAEYNV.Q.V.RDL............D..IL.E.AQVRVNSF..L.R..FN......P....L......L.....EG..NG...VLS..EFLTgqkglnspavltmawllglwigdgttkepeisvdshdtglmegliergkiwglypeykdeqiplrakhvklfygsecdghrrnrhlrknnpfwncvvnlkfkreldgekqipsf...............................................................................................................................mwtedlevreaflaglidsdgyvskrknpldsfkvsiqtvypsimggivhitrslgmpvtvttrsaktativgrtvschftydchlagrtpmqkvlsycrsghkvktepeyverSPIYFGF..NEEK.R.G.SNNVVGVTT-..-NSD...KR..ILLDNKIVIH...................................................................................................................................................................................................................................................................................................................................................
J7RZB8_KAZNA/1-458                     ............................................................................................................................................................................................................................................MFEEGTELILATGEN.IPIHDVVTNLWIKCTN...G....K.....FARVK..S..V..R...K.DI..Q.T.TYNLSQIT.KHRPE.NSENir.......efpRLELNCTLGHSLPL.A....I.M..V...Q.....P.R......L.....E.K.Y.S..K.M......-.-..KK.....YAVR.Y..QTLTETIT.YD.......G.RCITVP...K.FQN...KYFPMTV...EG...KN.....L.-..---...ANSFLKL......SK..SQl.....pqY..LNFDI.E.L.RDL............D..YL.Q.TCIRSDCL..L.K..CH......P....V......I.....EG..NG...VLS..KYLTgqtelvtpstiamawmlglwigdgttkqpeisvdikdvalldnllkigekwglqpsykdgriplrakhvklfygnpivgkryrhlttsnpfwktvsglgfksrddgskqvpef................................................................................................................................lwhddveireaflaglidadgyvkpgtssdnrfavaiqtiyvsvmkgivniarslgikvsvtakparknvilgrlvscehtyecqlvggsplqnvlsycksghkhktkplevsrDPIYFRF..RESK.R.G.PNWAYTIGIE..RETN...HNepLLLGN-----kmaa...............................................................................................................................................................................................................................................................................................................................................
A0A1V8TSS6_9PEZI/1542-1678             ............................................................................................................................................................................................................................................CLAYGTRLLRHDGSE.VKVEDVGEGDELMGPD...G....T.....CRRAF..N..I..V...K.GD..E.P.LYRMKLGS.-----.---G............LEDLVVTSNHILSL.H....R.E..A...P.....R.R......S.....S.S.T.D..A.E.....cD.T..GV.....VQYD.Y..VEMT----.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------aahfaslttgqrarhqlfkaaelssskhdtrysienisle...........................................................................................................................................................................................................................................................................................................
A0A431TXW0_9BACT/240-336               ............................................................................................................................................................................................................................................CLGKGTKVLMYDGTL.RNVEDVREGELLMGDD...S....T.....PRRVL..G..I..A...R.GR..E.R.MYWVRQNH.-----.----............AEDYRVNESHILSL.K....R.S..R...N.....-.-......-.....-.-.-.-..-.-......-.-..--.....----.-..--------.--.......-.------...-.---...-------...--...--.....-.-..---...-------......--..--........-..-----.-.-.---............-..--.-.--------..-.-..--......-....-......-.....--..--...---..----...................................................................................................................................................................................................................................................................................................................................................................-------..----.-.-.----------..----...--..----------egphrhgevlnitvrewlqksdkf...........................................................................................................................................................................................................................................................................................................................
A0A1G4JPN0_9SACH/284-666               ............................................................................................................................................................................................................................................CFAKGTEVLMADGSV.RPIESIRVGETVLGKD...G....Q.....PRQVT..A..L..P...R.GQ..Q.D.MFLVQDQE.QD---.-VFE............INEYKCNASHKLVV.R....T.A..R...D.....V.K......I.....E.G.Q.-..-.-......-.-..--.....-EVL.Y..NELAYVER.N-.......G.RVLELV...Q.QAR...KPMQ---...--...--.....-.-..---...---FASQ......IP..TE........P..IEWAI.E.A.GDY............E..LV.S.ESIRKSTV..Q.L..VS......P....I......L.....VE..KT...TIA..DYLKangfdqsmaadslayfiglwcgegsnmdsankqleqglleraqdldlhcefenqqmtvlgkqangkglstesilskalielkfldienqkt............................................................................................................................................................................vpsflrsdatsvresflaglidadgkvanqaceiflnqtsllagaaavvkslgmtakksvsnamsiesssalqsvlarslsssvakptsvvrAVTEFGF..NLEK.L.E.EDQYYGITLQ..DTSD...HQ..FLLSNQVVVH...................................................................................................................................................................................................................................................................................................................................................
#=GC SS_cons                           ............................................................................................................................................................................................................................................CEETT-EEEBTTS-E.EEGGG--TT-EEEBTT...S....S.....EEEEE..E..-..-...E.EE..E.E.EEEEEE-S.SSBHH.SSSTSSS......-B--SEEEEETT-EEEE.E....E.E..-...E.....E.E......E.....E.E.E.E..E.S......T.E..EE.....EEEE.E..EEEEEEE-.TT.......S.-EEEEE...E.EEE...EEEE-GG...GT...TH.....H.H..HHH...HHHHHTS......-S..SS........E..EEEEE.E.G.GGG............G..GS.-.HHHHHH-E..E.E..E-......-....B......-.....--..B-...HHH..HHHHTSSSSSSTTHHHHHHHHHHHHHHHBETTSSEEEEESSSHHHHHHHHHHHHHTTEEEEEESTSSTTSEEEEEEEESS--TTTT---SSTTSHHHHHHHHTTSEETTEE---.......................................................................................................................................GGGGGS-HHHHHHHHHHHHHHHEEEE-TTSSEEEEEES-HHHHHHHHHHHHHTT-EEEEEEEE--ECCCTSC-SEEEEEEEE-THHHHHHHTT--STTT-----SSS-----EEE-E..EEEE.E.E.EEEEEEEEEE..TTS-...SE..EEBTTSBEEE...................................................................................................................................................................................................................................................................................................................................................
#=GC seq_cons                          ............................................................................................................................................................................................................................................ChucGTpllMhDGoh.+slE-lplGDhlMGsD...G....s.....PRpVh..s..l..s...c.Gp..-.p.hYclp.pp.t.......................sasssssHhLsL.+....p.s..p...t...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
//
DBGET integrated database retrieval system