GenomeNet

Database: Pfam
Entry: IL10
LinkDB: IL10
Original site: IL10 
#=GF ID   IL10
#=GF AC   PF00726.18
#=GF DE   Interleukin 10
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_885 (release 2.1)
#=GF GA   24.20 24.20;
#=GF TC   24.20 24.20;
#=GF NC   24.10 24.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Interleukin
#=GF DR   INTERPRO; IPR020443;
#=GF DR   SCOP; 1ilk; fa;
#=GF DC   This family is a subset of the SCOP family
#=GF DR   HOMSTRAD; il10;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF SQ   495
#=GS A0A2Y9JYW0_ENHLU/20-171   AC A0A2Y9JYW0.1
#=GS A0A3B4GMU4_9CICH/5-177    AC A0A3B4GMU4.1
#=GS A0A2K6RPG6_RHIRO/5-174    AC A0A2K6RPG6.1
#=GS A0A452QVR3_URSAM/39-169   AC A0A452QVR3.1
#=GS A0A3B5AN22_9TELE/9-184    AC A0A3B5AN22.1
#=GS G3CKP9_EBVG/7-167         AC G3CKP9.1
#=GS I6N8I3_ANAPL/1-173        AC I6N8I3.1
#=GS IL10_FELCA/5-174          AC P55029.2
#=GS A0A2Y9IT98_ENHLU/46-169   AC A0A2Y9IT98.1
#=GS A0A3Q2CF35_CYPVA/8-171    AC A0A3Q2CF35.1
#=GS A0A2U4CQF1_TURTR/14-174   AC A0A2U4CQF1.1
#=GS A0A091JQ23_EGRGA/58-168   AC A0A091JQ23.1
#=GS M3YEY4_MUSPF/47-216       AC M3YEY4.1
#=GS W5P975_SHEEP/16-174       AC W5P975.1
#=GS A0A340YAQ8_LIPVE/4-177    AC A0A340YAQ8.1
#=GS A0A3Q1JK05_ANATE/6-177    AC A0A3Q1JK05.1
#=GS W5N385_LEPOC/9-175        AC W5N385.1
#=GS H2MLV0_ORYLA/43-160       AC H2MLV0.2
#=GS A0A0D9RR66_CHLSB/20-175   AC A0A0D9RR66.1
#=GS G3GZS9_CRIGR/16-172       AC G3GZS9.1
#=GS A0A1U7S3B0_ALLSI/121-269  AC A0A1U7S3B0.1
#=GS IL10_SHEEP/6-175          AC Q29408.1
#=GS H2NHZ6_PONAB/37-132       AC H2NHZ6.1
#=GS A0A2K5UWL0_MACFA/20-175   AC A0A2K5UWL0.1
#=GS A0A340XWS6_LIPVE/73-168   AC A0A340XWS6.1
#=GS F6RPU5_HORSE/38-205       AC F6RPU5.2
#=GS G1MGI7_AILME/59-209       AC G1MGI7.1
#=GS A0A2K6RT36_RHIRO/20-175   AC A0A2K6RT36.1
#=GS H0V4J0_CAVPO/18-175       AC H0V4J0.1
#=GS A0A2U3X5H9_ODORO/5-174    AC A0A2U3X5H9.1
#=GS IL10_CERAT/5-174          AC P46651.1
#=GS A0A2K6DLJ2_MACNE/5-174    AC A0A2K6DLJ2.1
#=GS A0A3Q7RCN0_VULVU/15-182   AC A0A3Q7RCN0.1
#=GS F7HHY3_MACMU/13-182       AC F7HHY3.2
#=GS A0A383Z962_BALAS/2-177    AC A0A383Z962.1
#=GS A0A3B3YNY4_9TELE/4-174    AC A0A3B3YNY4.1
#=GS U3K658_FICAL/57-168       AC U3K658.1
#=GS F1PZ65_CANLF/5-175        AC F1PZ65.1
#=GS A0A2U3ZZZ3_TURTR/13-139   AC A0A2U3ZZZ3.1
#=GS Q6H8Q2_SHEEP/6-175        AC Q6H8Q2.1
#=GS G3X1H5_SARHA/9-171        AC G3X1H5.1
#=GS A0A2Y9EDY1_PHYMC/15-172   AC A0A2Y9EDY1.1
#=GS R0M2Y7_ANAPL/5-175        AC R0M2Y7.1
#=GS A0A2K5C9P3_AOTNA/5-174    AC A0A2K5C9P3.1
#=GS F6Z3D2_ORNAN/8-177        AC F6Z3D2.1
#=GS A0A091FKG9_9AVES/58-168   AC A0A091FKG9.1
#=GS A0A3Q7W2D6_URSAR/39-169   AC A0A3Q7W2D6.1
#=GS W5NUV9_SHEEP/15-169       AC W5NUV9.1
#=GS F1SEZ2_PIG/18-171         AC F1SEZ2.2
#=GS A0A2R9ADA9_PANPA/6-168    AC A0A2R9ADA9.1
#=GS A0A2U3XRS9_LEPWE/5-174    AC A0A2U3XRS9.1
#=GS A0A2K6S2Z1_SAIBB/36-203   AC A0A2K6S2Z1.1
#=GS A0A093GNK0_DRYPU/58-168   AC A0A093GNK0.1
#=GS A0A3B5RAD3_XIPMA/8-157    AC A0A3B5RAD3.1
#=GS A0A3B5Q179_XIPMA/24-164   AC A0A3B5Q179.1
#=GS G1MGI2_AILME/22-176       AC G1MGI2.1
#=GS G3TLC9_LOXAF/25-175       AC G3TLC9.1
#=GS A0A2Y9ENA1_PHYMC/9-182    AC A0A2Y9ENA1.1
#=GS A0A286YEX3_HUMAN/1-74     AC A0A286YEX3.1
#=GS A0A2J8QVT6_PANTR/3-173    AC A0A2J8QVT6.1
#=GS A0A340YH52_LIPVE/17-179   AC A0A340YH52.1
#=GS A0A3Q1FPW7_9TELE/6-177    AC A0A3Q1FPW7.1
#=GS G3REF8_GORGO/5-174        AC G3REF8.1
#=GS F1MCS4_BOVIN/6-175        AC F1MCS4.1
#=GS H2N3X1_PONAB/54-207       AC H2N3X1.1
#=GS A0A091EN15_CORBR/55-168   AC A0A091EN15.1
#=GS A0A2K6EGZ8_PROCO/19-145   AC A0A2K6EGZ8.1
#=GS A0A493TP28_ANAPP/51-168   AC A0A493TP28.1
#=GS A0A384BM88_URSMA/22-176   AC A0A384BM88.1
#=GS A0A3Q3AU44_KRYMA/6-178    AC A0A3Q3AU44.1
#=GS A0A3P8V1L0_CYNSE/9-142    AC A0A3P8V1L0.1
#=GS A0A091VT78_OPIHO/51-168   AC A0A091VT78.1
#=GS A0A0B4Q6D8_9GAMA/5-172    AC A0A0B4Q6D8.1
#=GS A0A4D9DZU1_9SAUR/2-173    AC A0A4D9DZU1.1
#=GS A0A087QQC3_APTFO/52-168   AC A0A087QQC3.1
#=GS G3N5D8_GASAC/13-169       AC G3N5D8.1
#=GS A0A099ZMI4_TINGU/48-168   AC A0A099ZMI4.1
#=GS A0A2K5XS41_MANLE/3-173    AC A0A2K5XS41.1
#=GS A0A2I0LZX4_COLLI/3-173    AC A0A2I0LZX4.1
#=GS A0A2K5R5Z3_CEBCA/20-175   AC A0A2K5R5Z3.1
#=GS A0A2K6B6S6_MACNE/20-175   AC A0A2K6B6S6.1
#=GS E1C5G0_CHICK/5-175        AC E1C5G0.5
#=GS E2R898_CANLF/21-140       AC E2R898.1
#=GS A0A226MP41_CALSU/53-168   AC A0A226MP41.1
#=GS G5BP21_HETGA/5-174        AC G5BP21.1
#=GS A0A1S2ZQX3_ERIEU/5-174    AC A0A1S2ZQX3.1
#=GS H0WP44_OTOGA/12-171       AC H0WP44.1
#=GS F1AXI3_ORFV/12-183        AC F1AXI3.1
#=GS K7F6T8_PELSI/1-157        AC K7F6T8.1
#=GS F7CQQ3_XENTR/6-173        AC F7CQQ3.1
#=GS A0A087YF61_POEFO/4-174    AC A0A087YF61.1
#=GS W5N387_LEPOC/9-175        AC W5N387.1
#=GS A0A093HKS1_STRCA/57-167   AC A0A093HKS1.1
#=GS A0A093Q2H2_9PASS/40-168   AC A0A093Q2H2.1
#=GS A0A1U7RRW5_ALLSI/19-176   AC A0A1U7RRW5.1
#=GS A0A2Y9Q1M4_DELLE/12-182   AC A0A2Y9Q1M4.1
#=GS A0A1A6GKU9_NEOLE/7-181    AC A0A1A6GKU9.1
#=GS A0A3Q1AYN3_AMPOC/1-177    AC A0A3Q1AYN3.1
#=GS A0A4D9DT35_9SAUR/1-130    AC A0A4D9DT35.1
#=GS G5BP20_HETGA/20-171       AC G5BP20.1
#=GS A0A383Z997_BALAS/5-174    AC A0A383Z997.1
#=GS A0A2Y9JUC2_ENHLU/5-174    AC A0A2Y9JUC2.1
#=GS F6WZC9_CALJA/22-175       AC F6WZC9.2
#=GS A0A401NMP0_SCYTO/1-112    AC A0A401NMP0.1
#=GS IL20_MOUSE/24-176         AC Q9JKV9.1
#=GS A0A452Q846_URSAM/20-171   AC A0A452Q846.1
#=GS A0A3B4TAV5_SERDU/2-166    AC A0A3B4TAV5.1
#=GS A0A2K6USW7_SAIBB/5-174    AC A0A2K6USW7.1
#=GS A0A3P9N7T6_POERE/36-197   AC A0A3P9N7T6.1
#=GS A0A2I3SAH3_PANTR/41-211   AC A0A2I3SAH3.1
#=GS IL24_MOUSE/14-180         AC Q925S4.1
#=GS A0A151MAP9_ALLMI/1-89     AC A0A151MAP9.1
#=GS A0A2K6V1Z6_SAIBB/5-169    AC A0A2K6V1Z6.1
#=GS A0A096MXN1_PAPAN/52-207   AC A0A096MXN1.2
#=GS A0A3B3V9L1_9TELE/8-171    AC A0A3B3V9L1.1
#=GS A0A3Q1JK10_ANATE/7-170    AC A0A3Q1JK10.1
#=GS A0A452Q8E1_URSAM/38-211   AC A0A452Q8E1.1
#=GS A0A3Q1GI11_9TELE/9-173    AC A0A3Q1GI11.1
#=GS A0A383Z9Z7_BALAS/19-174   AC A0A383Z9Z7.1
#=GS A0A3Q1MMM3_BOVIN/36-153   AC A0A3Q1MMM3.1
#=GS G3QNU7_GORGO/40-211       AC G3QNU7.1
#=GS A0A2Y9PVQ9_DELLE/12-183   AC A0A2Y9PVQ9.1
#=GS A0A384BL48_URSMA/21-171   AC A0A384BL48.1
#=GS A0A3B4WVV4_SERLL/6-177    AC A0A3B4WVV4.1
#=GS A0A2K6G868_PROCO/40-169   AC A0A2K6G868.1
#=GS A0A3P8SDM6_AMPPE/1-177    AC A0A3P8SDM6.1
#=GS U3J6W5_ANAPP/1-173        AC U3J6W5.2
#=GS IL20_HUMAN/20-175         AC Q9NYY1.2
#=GS IL20_HUMAN/20-175         DR PDB; 4DOH C; 25-175;
#=GS IL20_HUMAN/20-175         DR PDB; 4DOH A; 25-175;
#=GS I3M7U8_ICTTR/5-174        AC I3M7U8.1
#=GS H0YS58_TAEGU/6-170        AC H0YS58.1
#=GS D2H945_AILME/37-169       AC D2H945.1
#=GS A0A1L8H745_XENLA/3-169    AC A0A1L8H745.1
#=GS A0A3B3DWZ4_ORYME/2-166    AC A0A3B3DWZ4.1
#=GS G3R6F4_GORGO/6-168        AC G3R6F4.1
#=GS A0A0D9RR19_CHLSB/5-174    AC A0A0D9RR19.1
#=GS M7BDI3_CHEMY/526-650      AC M7BDI3.1
#=GS G1T734_RABIT/9-176        AC G1T734.1
#=GS A0A452FGW3_CAPHI/24-196   AC A0A452FGW3.1
#=GS G1PXI6_MYOLU/5-174        AC G1PXI6.1
#=GS A0A2K6B713_MACNE/50-207   AC A0A2K6B713.1
#=GS A0A2I0LZX3_COLLI/18-175   AC A0A2I0LZX3.1
#=GS G1MXH5_MELGA/5-175        AC G1MXH5.1
#=GS A0A452HQS2_9SAUR/19-161   AC A0A452HQS2.1
#=GS H3CPB0_TETNG/5-177        AC H3CPB0.1
#=GS A0A3B5KG68_TAKRU/86-220   AC A0A3B5KG68.1
#=GS A0A452EY26_CAPHI/6-175    AC A0A452EY26.1
#=GS Q9ICJ0_SCMVC/12-184       AC Q9ICJ0.1
#=GS A0A2R8ZE59_PANPA/5-174    AC A0A2R8ZE59.1
#=GS A0A3M0JG23_HIRRU/10-175   AC A0A3M0JG23.1
#=GS A0A2I3GRH2_NOMLE/5-174    AC A0A2I3GRH2.1
#=GS A0A2Y9EEH7_PHYMC/22-174   AC A0A2Y9EEH7.1
#=GS IL10_PANTR/5-174          AC A2T6Z6.1
#=GS A0A2Y9DJ85_TRIMA/23-174   AC A0A2Y9DJ85.1
#=GS H2N3X2_PONAB/20-175       AC H2N3X2.1
#=GS A0A2U3X0Q0_ODORO/11-183   AC A0A2U3X0Q0.1
#=GS I3KT27_ORENI/11-171       AC I3KT27.1
#=GS A0A2K6A8E1_MANLE/20-175   AC A0A2K6A8E1.1
#=GS A0A340YH38_LIPVE/18-171   AC A0A340YH38.1
#=GS A0A287BFZ9_PIG/11-169     AC A0A287BFZ9.1
#=GS H9GD92_ANOCA/8-178        AC H9GD92.1
#=GS IL10_HUMAN/5-174          AC P22301.1
#=GS IL10_HUMAN/5-174          DR PDB; 2ILK A; 6-156;
#=GS IL10_HUMAN/5-174          DR PDB; 2H24 A; 18-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1LK3 A; 21-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1ILK A; 10-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1J7V L; 11-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1LK3 B; 21-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1Y6K L; 12-156;
#=GS IL10_HUMAN/5-174          DR PDB; 1INR A; 18-156;
#=GS K7F6U7_PELSI/4-151        AC K7F6U7.1
#=GS A0A3Q2V2N1_HAPBU/5-177    AC A0A3Q2V2N1.1
#=GS IL10_CALJA/5-174          AC Q0Z972.1
#=GS A0A3B4TAT3_SERDU/6-164    AC A0A3B4TAT3.1
#=GS A0A226NI05_CALSU/1-171    AC A0A226NI05.1
#=GS IL19_HUMAN/3-173          AC Q9UHD0.2
#=GS IL19_HUMAN/3-173          DR PDB; 1N1F A; 4-155;
#=GS A0A3P8SDB4_AMPPE/6-173    AC A0A3P8SDB4.1
#=GS A0A3Q0D6J5_MESAU/45-219   AC A0A3Q0D6J5.1
#=GS A0A0D9QWD9_CHLSB/5-169    AC A0A0D9QWD9.1
#=GS A0A3Q7UK34_URSAR/10-183   AC A0A3Q7UK34.1
#=GS A0A2K5YIE7_MANLE/5-174    AC A0A2K5YIE7.1
#=GS H3A3C0_LATCH/29-176       AC H3A3C0.1
#=GS H0VDI4_CAVPO/20-172       AC H0VDI4.1
#=GS A0A0A0AM67_CHAVO/59-168   AC A0A0A0AM67.1
#=GS A0A3B4C0D9_PYGNA/7-176    AC A0A3B4C0D9.1
#=GS A0A2K5HYL6_COLAP/9-173    AC A0A2K5HYL6.1
#=GS M3YET8_MUSPF/20-176       AC M3YET8.1
#=GS G3S310_GORGO/2-173        AC G3S310.1
#=GS A0A2K6K4C9_RHIBE/46-209   AC A0A2K6K4C9.1
#=GS IL10_PIG/5-170            AC Q29055.1
#=GS A0A3Q0T4E0_AMPCI/6-171    AC A0A3Q0T4E0.1
#=GS A0A3P9AU56_9CICH/12-172   AC A0A3P9AU56.1
#=GS I3LT64_PIG/11-181         AC I3LT64.2
#=GS L9JBK5_TUPCH/5-174        AC L9JBK5.1
#=GS G1QTG6_NOMLE/6-168        AC G1QTG6.2
#=GS A0A2K6CPI7_MACNE/5-169    AC A0A2K6CPI7.1
#=GS A0A2K5NHJ1_CERAT/14-173   AC A0A2K5NHJ1.1
#=GS A0A2I3LV89_PAPAN/6-169    AC A0A2I3LV89.1
#=GS G1NDA5_MELGA/52-168       AC G1NDA5.1
#=GS U3JCS1_FICAL/26-175       AC U3JCS1.1
#=GS A0A2K6CGK7_MACNE/40-209   AC A0A2K6CGK7.1
#=GS A0A452C4H7_BALAS/18-174   AC A0A452C4H7.1
#=GS A0A2U3XRP2_LEPWE/20-176   AC A0A2U3XRP2.1
#=GS IL26_HUMAN/6-168          AC Q9NPH9.1
#=GS A0A087WQD7_MOUSE/24-180   AC A0A087WQD7.1
#=GS A0A3Q4H2N1_NEOBR/5-177    AC A0A3Q4H2N1.1
#=GS W5P9B3_SHEEP/54-206       AC W5P9B3.1
#=GS IL10_MOUSE/5-174          AC P18893.2
#=GS IL10_MOUSE/5-174          DR PDB; 4X51 B; 18-156;
#=GS IL10_MOUSE/5-174          DR PDB; 4X51 A; 18-156;
#=GS A0A2K5MK59_CERAT/5-169    AC A0A2K5MK59.1
#=GS A0A2U4CQJ2_TURTR/59-169   AC A0A2U4CQJ2.1
#=GS A0A3Q7SLT1_VULVU/51-169   AC A0A3Q7SLT1.1
#=GS H3A6W1_LATCH/7-182        AC H3A6W1.1
#=GS A0A1S3QNL4_SALSA/1-94     AC A0A1S3QNL4.1
#=GS H0WP49_OTOGA/43-205       AC H0WP49.1
#=GS Q7SX60_TETNG/5-171        AC Q7SX60.1
#=GS A0A2U3X0P6_ODORO/20-176   AC A0A2U3X0P6.1
#=GS A0A3B5A3I5_9TELE/8-169    AC A0A3B5A3I5.1
#=GS A0A3M0KA29_HIRRU/43-143   AC A0A3M0KA29.1
#=GS A0A3B4TAF4_SERDU/6-177    AC A0A3B4TAF4.1
#=GS H0YS51_TAEGU/20-175       AC H0YS51.1
#=GS A0A3Q7TJG4_URSAR/21-171   AC A0A3Q7TJG4.1
#=GS A0A0X9Y7I4_9GAMA/10-170   AC A0A0X9Y7I4.1
#=GS A0A3P9AUR3_9CICH/5-177    AC A0A3P9AUR3.1
#=GS H2N3X4_PONAB/5-174        AC H2N3X4.1
#=GS A0A091CLJ3_FUKDA/1-138    AC A0A091CLJ3.1
#=GS A0A2K6L8U2_RHIBE/5-169    AC A0A2K6L8U2.1
#=GS A0A2Y9PR16_DELLE/11-183   AC A0A2Y9PR16.1
#=GS A0A2K6MZD3_RHIBE/5-174    AC A0A2K6MZD3.1
#=GS A0A384BL61_URSMA/5-174    AC A0A384BL61.1
#=GS H2MLV6_ORYLA/6-177        AC H2MLV6.2
#=GS A0A401SGD7_CHIPU/2-128    AC A0A401SGD7.1
#=GS A0A2K5JNU8_COLAP/5-169    AC A0A2K5JNU8.1
#=GS H0Z8K8_TAEGU/52-168       AC H0Z8K8.1
#=GS F7HHX8_MACMU/20-175       AC F7HHX8.1
#=GS G3X1M9_SARHA/7-177        AC G3X1M9.1
#=GS E2R7F8_CANLF/25-172       AC E2R7F8.1
#=GS F7AQ09_ORNAN/9-174        AC F7AQ09.1
#=GS F6UG76_MONDO/25-175       AC F6UG76.1
#=GS IL10_HORSE/5-174          AC Q28374.1
#=GS A0A2U9BGH7_SCOMX/55-174   AC A0A2U9BGH7.1
#=GS H0WP46_OTOGA/14-175       AC H0WP46.1
#=GS F6XX01_HORSE/76-245       AC F6XX01.2
#=GS A0A3Q7RAT1_VULVU/5-175    AC A0A3Q7RAT1.1
#=GS A0A384BLZ7_URSMA/10-183   AC A0A384BLZ7.1
#=GS A0A151MAR4_ALLMI/17-176   AC A0A151MAR4.1
#=GS M3WDI9_FELCA/36-169       AC M3WDI9.1
#=GS M3ZNG3_XIPMA/4-174        AC M3ZNG3.1
#=GS IL10_RABIT/5-174          AC Q9TSJ4.1
#=GS A0A498MSP0_LABRO/513-642  AC A0A498MSP0.1
#=GS M3YES0_MUSPF/18-183       AC M3YES0.1
#=GS F7HZ89_CALJA/49-204       AC F7HZ89.2
#=GS G7NVB0_MACFA/5-174        AC G7NVB0.1
#=GS A0A3Q0D7I2_MESAU/17-171   AC A0A3Q0D7I2.1
#=GS A0A3B3XBA4_9TELE/4-159    AC A0A3B3XBA4.1
#=GS F7FUZ0_MACMU/6-169        AC F7FUZ0.1
#=GS A0A3Q2HKM3_HORSE/15-158   AC A0A3Q2HKM3.1
#=GS G1QJ75_NOMLE/12-175       AC G1QJ75.1
#=GS A0A3F2YKG4_SHEVT/7-167    AC A0A3F2YKG4.1
#=GS A0A3Q7SM58_VULVU/20-175   AC A0A3Q7SM58.1
#=GS A0A2R9A7S0_PANPA/20-175   AC A0A2R9A7S0.1
#=GS IL10_MACNE/5-174          AC P51497.1
#=GS IL10_CANLF/5-177          AC P48411.1
#=GS A0A402EJI5_9SAUR/8-176    AC A0A402EJI5.1
#=GS F1SEZ1_PIG/21-168         AC F1SEZ1.2
#=GS E1BKN5_BOVIN/13-175       AC E1BKN5.2
#=GS A0A337S6M0_FELCA/20-138   AC A0A337S6M0.1
#=GS G3TMF8_LOXAF/5-174        AC G3TMF8.1
#=GS A0A2K5H9U6_COLAP/20-175   AC A0A2K5H9U6.1
#=GS A0A3Q2HJG7_HORSE/81-247   AC A0A3Q2HJG7.1
#=GS F6PQV8_ORNAN/9-169        AC F6PQV8.1
#=GS D3ZFI7_RAT/21-172         AC D3ZFI7.3
#=GS H2Q105_PANTR/5-174        AC H2Q105.1
#=GS G1QJ45_NOMLE/41-211       AC G1QJ45.3
#=GS A0A1S3P8J8_SALSA/6-158    AC A0A1S3P8J8.1
#=GS F7B070_CALJA/5-169        AC F7B070.2
#=GS A0A2K5NVU9_CERAT/20-175   AC A0A2K5NVU9.1
#=GS A0A3Q4HFY8_NEOBR/12-172   AC A0A3Q4HFY8.1
#=GS A0A2I4APV4_9TELE/81-253   AC A0A2I4APV4.1
#=GS A0A2K5EIU0_AOTNA/5-169    AC A0A2K5EIU0.1
#=GS R0L4A3_ANAPL/52-168       AC R0L4A3.1
#=GS A0A2R8ZZP4_PANPA/7-162    AC A0A2R8ZZP4.1
#=GS A0A2Y9Q0Q3_DELLE/18-171   AC A0A2Y9Q0Q3.1
#=GS E2R7E9_CANLF/20-175       AC E2R7E9.1
#=GS A0A096NBL5_PAPAN/20-175   AC A0A096NBL5.1
#=GS A0A2Y9DJ64_TRIMA/18-168   AC A0A2Y9DJ64.1
#=GS A0A2I4APV8_9TELE/6-178    AC A0A2I4APV8.1
#=GS A0A1U7TLM7_TARSY/67-228   AC A0A1U7TLM7.2
#=GS A0A2J8QVU7_PANTR/20-175   AC A0A2J8QVU7.1
#=GS G1SDF0_RABIT/12-169       AC G1SDF0.1
#=GS A0A3P9N7Q2_POERE/52-222   AC A0A3P9N7Q2.1
#=GS A0A3Q3VWD8_MOLML/6-176    AC A0A3Q3VWD8.1
#=GS A0A2K6K4A3_RHIBE/8-173    AC A0A2K6K4A3.1
#=GS G1PXI7_MYOLU/13-171       AC G1PXI7.1
#=GS A0A3Q0SXV4_AMPCI/6-156    AC A0A3Q0SXV4.1
#=GS F6NNV9_DANRE/20-184       AC F6NNV9.1
#=GS A0A2U3XRQ7_LEPWE/12-186   AC A0A2U3XRQ7.1
#=GS G1MGH7_AILME/34-207       AC G1MGH7.1
#=GS M3YEW2_MUSPF/20-171       AC M3YEW2.1
#=GS A0A2I3MAF0_PAPAN/25-194   AC A0A2I3MAF0.1
#=GS IL10H_EBVB9/7-167         AC P03180.1
#=GS IL10H_EBVB9/7-167         DR PDB; 1Y6N L; 12-156;
#=GS IL10H_EBVB9/7-167         DR PDB; 1Y6M L; 12-156;
#=GS IL10H_EBVB9/7-167         DR PDB; 1VLK A; 12-156;
#=GS H2Q6F4_PANTR/6-168        AC H2Q6F4.1
#=GS A0A3P8XA83_ESOLU/71-219   AC A0A3P8XA83.1
#=GS A0A3P9A3Q1_ESOLU/4-178    AC A0A3P9A3Q1.1
#=GS A0A3P8NTJ9_ASTCA/5-177    AC A0A3P8NTJ9.1
#=GS A0A340YFH1_LIPVE/5-174    AC A0A340YFH1.1
#=GS G8XT09_9BETA/4-175        AC G8XT09.1
#=GS A0A2U3XRN1_LEPWE/21-171   AC A0A2U3XRN1.1
#=GS G1T727_RABIT/23-172       AC G1T727.1
#=GS A0A087QPN1_APTFO/2-173    AC A0A087QPN1.1
#=GS A0A2K6F5B3_PROCO/50-220   AC A0A2K6F5B3.1
#=GS A0A286X9X1_CAVPO/36-153   AC A0A286X9X1.1
#=GS A0A2Y9Q0P3_DELLE/32-189   AC A0A2Y9Q0P3.1
#=GS H2SEY4_TAKRU/6-159        AC H2SEY4.2
#=GS A0A3Q1B1S8_AMPOC/5-173    AC A0A3Q1B1S8.1
#=GS A0A1S2ZQY1_ERIEU/22-173   AC A0A1S2ZQY1.1
#=GS W5KIM7_ASTMX/44-197       AC W5KIM7.2
#=GS A0A093G3V7_DRYPU/1-166    AC A0A093G3V7.1
#=GS A0A2R9B3D8_PANPA/3-173    AC A0A2R9B3D8.1
#=GS IL10_CHICK/1-171          AC Q6A2H4.2
#=GS A0A1U7R2X3_MESAU/17-172   AC A0A1U7R2X3.1
#=GS A0A091CNQ2_FUKDA/5-174    AC A0A091CNQ2.1
#=GS H0VDI2_CAVPO/5-174        AC H0VDI2.1
#=GS Q5EFQ8_DANRE/6-175        AC Q5EFQ8.2
#=GS A0A401SGE9_CHIPU/31-200   AC A0A401SGE9.1
#=GS M7AZ52_CHEMY/2-173        AC M7AZ52.1
#=GS A0A0A0MQ14_FELCA/5-174    AC A0A0A0MQ14.1
#=GS H0XVQ9_OTOGA/6-169        AC H0XVQ9.1
#=GS A0A2K5S3C9_CEBCA/5-174    AC A0A2K5S3C9.1
#=GS A0A2D1AF31_9GAMA/34-196   AC A0A2D1AF31.1
#=GS G1MGJ4_AILME/5-174        AC G1MGJ4.1
#=GS A0A3B5AN60_9TELE/64-166   AC A0A3B5AN60.1
#=GS A0A2K6CGL1_MACNE/3-173    AC A0A2K6CGL1.1
#=GS A0A452HGB5_9SAUR/28-123   AC A0A452HGB5.1
#=GS A0A3Q0D2E5_MESAU/5-169    AC A0A3Q0D2E5.1
#=GS A0A2K6S329_SAIBB/5-173    AC A0A2K6S329.1
#=GS F6UHB0_MONDO/6-170        AC F6UHB0.1
#=GS A0A1S3F834_DIPOR/5-174    AC A0A1S3F834.1
#=GS A0A3B4WT03_SERLL/4-170    AC A0A3B4WT03.1
#=GS A0A1U7S5S6_ALLSI/5-173    AC A0A1U7S5S6.1
#=GS Q6TVJ3_ORFSA/6-183        AC Q6TVJ3.1
#=GS A0A2U3X0Z3_ODORO/21-171   AC A0A2U3X0Z3.1
#=GS A0A3B3ZBA4_9GOBI/8-180    AC A0A3B3ZBA4.1
#=GS K7GEX7_PELSI/57-167       AC K7GEX7.1
#=GS U3J7J1_ANAPP/5-175        AC U3J7J1.1
#=GS A0A226PYE4_COLVI/1-171    AC A0A226PYE4.1
#=GS A0A2K5S2W6_CEBCA/6-169    AC A0A2K5S2W6.1
#=GS G3X1C2_SARHA/24-174       AC G3X1C2.1
#=GS A0A060YRF1_ONCMY/65-164   AC A0A060YRF1.1
#=GS A0A2Y9EEH6_PHYMC/5-174    AC A0A2Y9EEH6.1
#=GS G3RBT0_GORGO/20-175       AC G3RBT0.1
#=GS A0A452Q7Y8_URSAM/5-174    AC A0A452Q7Y8.1
#=GS A0A3B4GN67_9CICH/12-160   AC A0A3B4GN67.1
#=GS A0A2Y9PUU1_DELLE/5-174    AC A0A2Y9PUU1.1
#=GS G1PXI8_MYOLU/10-174       AC G1PXI8.1
#=GS A0A2K5MM70_CERAT/5-174    AC A0A2K5MM70.1
#=GS A0A3Q3FBB0_9LABR/5-177    AC A0A3Q3FBB0.1
#=GS G1NYG4_MYOLU/11-167       AC G1NYG4.1
#=GS A0A2K6F2M2_PROCO/5-174    AC A0A2K6F2M2.1
#=GS A0A4D9ED44_9SAUR/217-308  AC A0A4D9ED44.1
#=GS A0A068EGM0_9POXV/3-172    AC A0A068EGM0.1
#=GS A0A3Q7RBZ0_VULVU/25-171   AC A0A3Q7RBZ0.1
#=GS A0A452Q8D9_URSAM/30-202   AC A0A452Q8D9.1
#=GS A0A2K5CHZ3_AOTNA/40-210   AC A0A2K5CHZ3.1
#=GS F7HHY0_MACMU/3-173        AC F7HHY0.1
#=GS A0A2Y9DIE0_TRIMA/5-174    AC A0A2Y9DIE0.1
#=GS E1BCI0_BOVIN/20-170       AC E1BCI0.2
#=GS A0A2Y9JXT5_ENHLU/20-176   AC A0A2Y9JXT5.1
#=GS A0A2K5SIF5_CEBCA/55-211   AC A0A2K5SIF5.1
#=GS A0A1L8H749_XENLA/2-173    AC A0A1L8H749.1
#=GS I3RLF3_ANHV1/7-163        AC I3RLF3.1
#=GS A0A383Z9A0_BALAS/13-171   AC A0A383Z9A0.1
#=GS A0A1S3LFA1_SALSA/1-173    AC A0A1S3LFA1.1
#=GS A0A2K6UBE9_SAIBB/32-204   AC A0A2K6UBE9.1
#=GS W5N369_LEPOC/6-177        AC W5N369.1
#=GS A0A1U7QIX2_MESAU/5-174    AC A0A1U7QIX2.1
#=GS A0A3Q2V2E0_HAPBU/12-172   AC A0A3Q2V2E0.1
#=GS A0A3B3DUQ1_ORYME/6-177    AC A0A3B3DUQ1.1
#=GS A0A3P8V1L5_CYNSE/13-178   AC A0A3P8V1L5.1
#=GS A0A3Q1MVU8_BOVIN/6-156    AC A0A3Q1MVU8.1
#=GS A0A3Q2CF46_CYPVA/5-178    AC A0A3Q2CF46.1
#=GS I3M4J5_ICTTR/19-171       AC I3M4J5.1
#=GS M3W5Z2_FELCA/20-171       AC M3W5Z2.1
#=GS W5P8Y9_SHEEP/16-172       AC W5P8Y9.1
#=GS A0A2D0PJY5_ICTPU/48-218   AC A0A2D0PJY5.1
#=GS A0A2K5SIF2_CEBCA/17-173   AC A0A2K5SIF2.1
#=GS U3JCS4_FICAL/12-178       AC U3JCS4.1
#=GS A0A218UJX2_9PASE/6-171    AC A0A218UJX2.1
#=GS A0A3Q3LQH8_9TELE/58-229   AC A0A3Q3LQH8.1
#=GS Q6TV62_9POXV/21-185       AC Q6TV62.1
#=GS A0A2K6MR47_RHIBE/20-175   AC A0A2K6MR47.1
#=GS A0A2Y9JTL2_ENHLU/20-183   AC A0A2Y9JTL2.1
#=GS A0A3B3RN78_9TELE/7-171    AC A0A3B3RN78.1
#=GS I3KT29_ORENI/6-178        AC I3KT29.1
#=GS IL10_MACFA/5-174          AC P79338.1
#=GS A0A2U3XRM4_LEPWE/21-136   AC A0A2U3XRM4.1
#=GS M3WJJ2_FELCA/12-176       AC M3WJJ2.1
#=GS IL10_RAT/5-174            AC P29456.1
#=GS A0A2D0TB63_ICTPU/4-176    AC A0A2D0TB63.1
#=GS A0A1U7QSF7_MESAU/23-176   AC A0A1U7QSF7.1
#=GS G1MXI5_MELGA/13-175       AC G1MXI5.1
#=GS A0A3Q7VED4_URSAR/22-176   AC A0A3Q7VED4.1
#=GS F7HHV8_MACMU/50-207       AC F7HHV8.2
#=GS IL10_VULVU/5-175          AC Q25BC1.1
#=GS IL10H_EHV2/5-175          AC P68678.1
#=GS A0A2R9B3D3_PANPA/43-213   AC A0A2R9B3D3.1
#=GS L5JXR2_PTEAL/9-175        AC L5JXR2.1
#=GS IL10_CAVPO/5-174          AC Q9Z1Y5.1
#=GS A0A3Q4ANB6_MOLML/11-169   AC A0A3Q4ANB6.1
#=GS A0A2U3X0N5_ODORO/20-140   AC A0A2U3X0N5.1
#=GS A0A2R8MR56_CALJA/18-173   AC A0A2R8MR56.1
#=GS A0A1L8GUJ8_XENLA/6-173    AC A0A1L8GUJ8.1
#=GS I3M7X1_ICTTR/14-175       AC I3M7X1.2
#=GS G8XUH0_9BETA/9-179        AC G8XUH0.1
#=GS M3WJJ3_FELCA/18-191       AC M3WJJ3.3
#=GS A0A2U9BGB5_SCOMX/6-177    AC A0A2U9BGB5.1
#=GS A0A3P8UYN6_CYNSE/33-200   AC A0A3P8UYN6.1
#=GS A0A087YF42_POEFO/9-172    AC A0A087YF42.2
#=GS H2N3X3_PONAB/54-210       AC H2N3X3.1
#=GS A0A2Y9E3Q5_TRIMA/11-169   AC A0A2Y9E3Q5.1
#=GS Q9J4U5_9BETA/15-188       AC Q9J4U5.1
#=GS A0A1S3A2V5_ERIEU/57-170   AC A0A1S3A2V5.1
#=GS A0A452G6X4_CAPHI/56-167   AC A0A452G6X4.1
#=GS A0A096MZK1_PAPAN/5-174    AC A0A096MZK1.1
#=GS A0A1A6GM16_NEOLE/5-174    AC A0A1A6GM16.1
#=GS W5N377_LEPOC/14-172       AC W5N377.1
#=GS A0A452ECT1_CAPHI/16-174   AC A0A452ECT1.1
#=GS A0A3Q3ASP3_KRYMA/10-173   AC A0A3Q3ASP3.1
#=GS A0A2K5NHU2_CERAT/48-206   AC A0A2K5NHU2.1
#=GS A0A2K5K5I4_COLAP/5-174    AC A0A2K5K5I4.1
#=GS A0A0D9RR41_CHLSB/3-173    AC A0A0D9RR41.1
#=GS IL10H_HCMVA/8-173         AC P17150.2
#=GS IL10H_HCMVA/8-173         DR PDB; 1LQS L; 8-156;
#=GS IL10H_HCMVA/8-173         DR PDB; 1LQS M; 8-156;
#=GS A0A2Y9EQB7_PHYMC/11-169   AC A0A2Y9EQB7.1
#=GS A0A452H999_9SAUR/2-173    AC A0A452H999.1
#=GS G7NUQ4_MACFA/3-173        AC G7NUQ4.1
#=GS IL19_MOUSE/22-171         AC Q8CJ70.1
#=GS G3X0Q7_SARHA/6-172        AC G3X0Q7.1
#=GS IL10H_EBVA8/7-167         AC P0C6Z6.1
#=GS A0A3Q1GHL7_9TELE/9-173    AC A0A3Q1GHL7.1
#=GS L5JYH4_PTEAL/5-174        AC L5JYH4.1
#=GS A0A087QPN0_APTFO/8-175    AC A0A087QPN0.1
#=GS A0A1U8C8Q7_MESAU/44-218   AC A0A1U8C8Q7.2
#=GS A0A1U7TLL5_TARSY/5-174    AC A0A1U7TLL5.1
#=GS I3LZ75_ICTTR/10-170       AC I3LZ75.1
#=GS A0A452Q880_URSAM/22-176   AC A0A452Q880.1
#=GS IL10_BOVIN/5-174          AC P43480.2
#=GS A0A2R9B4Z7_PANPA/41-211   AC A0A2R9B4Z7.1
#=GS F1SEZ0_PIG/31-201         AC F1SEZ0.2
#=GS A0A3Q3FBR2_9LABR/7-161    AC A0A3Q3FBR2.1
#=GS A0A3L8Q5D4_CHLGU/11-157   AC A0A3L8Q5D4.1
#=GS F6XL14_HORSE/42-208       AC F6XL14.2
#=GS A0A2K5XPY6_MANLE/49-206   AC A0A2K5XPY6.1
#=GS A0A2U3Y8L8_LEPWE/21-169   AC A0A2U3Y8L8.1
#=GS A0A2K5W336_MACFA/40-209   AC A0A2K5W336.1
#=GS A1BLZ3_9GAMA/14-181       AC A1BLZ3.1
#=GS H9GD87_ANOCA/1-170        AC H9GD87.2
#=GS L5JW63_PTEAL/1-138        AC L5JW63.1
#=GS A0A1U7TBW8_TARSY/14-175   AC A0A1U7TBW8.1
#=GS A0A3Q3LE84_9TELE/8-170    AC A0A3Q3LE84.1
#=GS A0A3L8SRW2_CHLGU/52-168   AC A0A3L8SRW2.1
#=GS A0A3P8NT29_ASTCA/12-172   AC A0A3P8NT29.1
#=GS A0A3Q7U8C0_URSAR/5-174    AC A0A3Q7U8C0.1
#=GS A0A3Q3W2K0_MOLML/6-169    AC A0A3Q3W2K0.1
#=GS A0A0R4J1N5_MOUSE/63-219   AC A0A0R4J1N5.1
#=GS A0A1U7T7W5_TARSY/19-172   AC A0A1U7T7W5.1
#=GS K7F6U1_PELSI/16-174       AC K7F6U1.1
#=GS A0A2K5UB53_MACFA/39-207   AC A0A2K5UB53.1
#=GS F6PN11_CANLF/13-180       AC F6PN11.1
#=GS A0A091UYL7_NIPNI/58-168   AC A0A091UYL7.1
#=GS A0A3B1K4Q0_ASTMX/7-177    AC A0A3B1K4Q0.1
#=GS A0A1L8HER6_XENLA/3-167    AC A0A1L8HER6.1
#=GS A0A3B3HF71_ORYLA/17-160   AC A0A3B3HF71.1
#=GS A0A3B3U9H2_9TELE/4-174    AC A0A3B3U9H2.1
#=GS A0A384BIT0_URSMA/39-169   AC A0A384BIT0.1
#=GS A0A2K6SM35_SAIBB/21-175   AC A0A2K6SM35.1
#=GS G3TLC8_LOXAF/18-170       AC G3TLC8.1
#=GS A0A2K5YSX4_MANLE/6-169    AC A0A2K5YSX4.1
#=GS A0A2K6QQV7_RHIRO/8-173    AC A0A2K6QQV7.1
#=GS A0A2U3UZL1_TURTR/5-174    AC A0A2U3UZL1.1
#=GS Q9Q5L1_CHV12/10-167       AC Q9Q5L1.1
#=GS H0WP43_OTOGA/5-174        AC H0WP43.1
#=GS A0A0D9RR76_CHLSB/47-206   AC A0A0D9RR76.1
#=GS A0A1A6GL30_NEOLE/18-172   AC A0A1A6GL30.1
#=GS A0A1S3FA89_DIPOR/9-175    AC A0A1S3FA89.1
#=GS A0A0Q3TEF7_AMAAE/35-156   AC A0A0Q3TEF7.1
#=GS G3N5D6_GASAC/16-170       AC G3N5D6.1
#=GS A0A2I4APV9_9TELE/11-170   AC A0A2I4APV9.1
#=GS A0A3L8RU67_CHLGU/16-175   AC A0A3L8RU67.1
#=GS A0A3Q0SY57_AMPCI/5-177    AC A0A3Q0SY57.1
#=GS A0A2Y9ND25_DELLE/38-169   AC A0A2Y9ND25.1
#=GS A0A2K5V5V2_MACFA/6-169    AC A0A2K5V5V2.1
#=GS G3HB01_CRIGR/5-174        AC G3HB01.1
#=GS A0A091JAF4_CALAN/50-168   AC A0A091JAF4.1
#=GS A0A151MAR5_ALLMI/35-208   AC A0A151MAR5.1
#=GS Q2THG5_MOUSE/34-154       AC Q2THG5.1
#=GS A0A091CQR5_FUKDA/12-175   AC A0A091CQR5.1
#=GS D4A2T8_RAT/24-176         AC D4A2T8.2
#=GS A0A2K5CFM5_AOTNA/21-175   AC A0A2K5CFM5.1
#=GS A0A493TC31_ANAPP/1-137    AC A0A493TC31.1
#=GS IL10_MACMU/5-174          AC P51496.1
#=GS A0A3Q1M9H7_BOVIN/8-169    AC A0A3Q1M9H7.1
#=GS A0A3B3YNU8_9TELE/36-200   AC A0A3B3YNU8.1
#=GS A0A2K5C7Y7_AOTNA/31-204   AC A0A2K5C7Y7.1
#=GS A0A1S3F8A7_DIPOR/21-171   AC A0A1S3F8A7.1
#=GS IL10H_HCMVM/8-174         AC F5HC71.1
A0A2Y9JYW0_ENHLU/20-171              .........................................................vhtrglrrclismdi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHIEETFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TP..E.T..LH.SI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LQRC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKLLGELDV.FLAWID-----knh.....................
A0A3B4GMU4_9CICH/5-177               .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..CSP.MCNN..R..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...N...Y.F..S.C...K....-...K...Y...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
A0A2K6RPG6_RHIRO/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.HSEN..S..CTRF..P.G.N.VPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A452QVR3_URSAM/39-169              .................................fqavdtlyvkaawlkatipedhiknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....A....Q....V....C....R.....EI..H...----...FVEELHS.L.RQ..Q.MNRC.....I...S...C.A..S.S...A....R...E...M...K...A...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAIRELDI.LLSWIKQFL--es......................
A0A3B5AN22_9TELE/9-184               ........................................................malrcvllsvlvvswf------.--.----.-L.C.T..D..STP.TCNN..Q..CCRF..V.E.G.FPVR.LKKLREDYSQIR.D.F.Y.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACHTMDNVLNFYLSTV.L.P.K..A.....M....SevteD....T....R....D.....LR..P...HMES...IQQIFDE.L.KS..D.VIKC.....R...K...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDL.LFNYIETYLA-s.......................
G3CKP9_EBVG/7-167                    ........................................................................VTLQCL.VL.L---.--.-.-..-..-YL.APEC..G..GTDQ..C.D.N.FPQM.LRDLRDAFSRVK.T.F.F.Q.T.K.D.E.V..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....E.....AK..D...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...I.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTI........................
I6N8I3_ANAPL/1-173                   .....................................................................mrt---CCV.AL.LLLL.AA.S.TqpA..RCL.LTDP..S..CLHL..S.D.L.LPAK.LKELRMKFEEIK.D.Y.F.Q.S.Q.DdE.L..S..I..Q..LL..SS..D.L..LE.EF..K.GNF.GCQSVLEMMRFYMEEV.L.P.S..A.....L....R....S....S....E....H.....HQ..Q...SVGD...LGNLLLS.L.KA..M.MRRC.....H...R...F.L..T.C...E....K...R...S...K...T...I...K...Q...I.K...E...TFEKM.N.E....N.G.I....YKAMGEFDI.FINYIEEYL--lm......................
IL10_FELCA/5-174                     .......................................................................a-LLCFL.VF.LAGV.GA.S.R..H..QST.LSED..N..CTHF..S.V.S.LPHM.LRELRAAFGKVK.T.F.F.Q.T.K.D.E.L..H..S..I..LL..TR..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....E....D....P....D.....IK..Q...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...V...V...E...Q...V.K...S...TFSKL.Q.E....K.G.V....YKAMGEFDI.FINYIEAYMTM........................
A0A2Y9IT98_ENHLU/46-169              ........................................yikaawlkatipedriknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....V....Q....V....C....R.....EI..H...----...FVEELHS.L.RQ..L.LSRC.....I...S...C.A..S.S...A....R...E...M...K...T...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAINELDI.LLSWIKQFL--es......................
A0A3Q2CF35_CYPVA/8-171               ................................................slctllllgflnrpvesrtlhvdg------.--.----.--.-.-..-..---.----..-..----..C.S.A.RV-H.FHELRKYFSDIK.SdA.I.S.G.D.D.E.I..G..V..K..LL..DT..S.M..IK.NV..Q.EGQ.TCCFLRLLLRFYVERV.F.N.N..Y.....E....S....S....Q....P....H.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...N.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...T...KFDML.QiR....Q.G.A....QKAVGELDI.VLDLLE-----rlap....................
A0A2U4CQF1_TURTR/14-174              ...................................................vfcvfwtpsarlktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTS.LQAIRSGFSEIQ.D.-.R.Q.P.K.D.E.I..I..DlrI..LR..KT..Q.P..LQ.DT..K.PAG.QCCLLRHILRLYLDRV.F.K.N..X.....Q....T....P....D....H....R.....IL..Q...KISG...LANSFLT.I.KK..D.LCLC.....H...A...H.M..T.C...P....S...G...E...E...A...M...E...KysqL.M...S...HYEEL.Q.P....QaA.V....VKALGELDI.LLSWME-----md......................
A0A091JQ23_EGRGA/58-168              ....................kdlikntrllkkttkilfmtncsvrdqllsfymknvfsrlgvgsdklyiisa------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...----FQV.L.QA..N.MNAC.....L...P...C.A..P.T...T....R...L...T...S...A...V...K...K...L.K...K...TFLKL.G.E....N.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
M3YEY4_MUSPF/47-216                  .......................................................................a-LLCCL.VL.LAGV.GA.S.R..H..QSA.LSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..G..S..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....E.....VK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
W5P975_SHEEP/16-174                  ......................................................lfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQGIRSGFSEIR.D.S.V.Q.A.K.D.E.I..I..DirI..LR..KT..Q.F..LQ.GT..K.PAD.QCCLLHHILRLYLDRV.F.K.N..Y.....Q....P....P....D....H....H.....IF..R...KVSR...LANSLLT.I.KK..D.LQLC.....H...A...H.M..S.C...P....C...G...E...E...A...K...EkysQ...I.L...S...HFEEL.PpQ....A.A.V....VKALGELDI.LLRWME-----ev......................
A0A340YAQ8_LIPVE/4-177               ............................................lpclslillfwsqgpgaqgqefqfgpcq------.--.----.--.-.-..-..---.----..-..----..-.-.V.EGVV.LQELWEAFQAMK.D.I.V.Q.A.Q.D.N.I..T..S..V.qLL..RK..E.V..LQ.NV..S.EAE.SCYLIHALLEFYLNTV.F.K.N..Y.....H....H....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.MS..K.LQPS.....QekeM...F.S..V.R...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENFY--qv......................
A0A3Q1JK05_ANATE/6-177               .....................................................................hll---CVL.GL.LSFL.ST.T.-..W..CTP.MCNN..Q..CCRF..V.E.R.FPVR.LRKLREDYLHIR.D.F.Y.E.A.N.N.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACHAMNSLLDFYLSTV.L.P.T..Ama.gvT....E....D....N....K....D.....LK..P...HVES...IQQIFDE.L.KR..D.VTKC.....R...N...Y.F..S.C...K....-...K...P...F...D...I...K...N...L.N...S...SYTQM.E.S....K.G.L....YKAMGELDL.LFNYIETYLA-s.......................
W5N385_LEPOC/9-175                   ...........................................cllstvllavsipsaaghrlhlgscaini------.--.----.--.-.-..-..---.----..-..----..-.-.-.---Q.VHELREYFNEIRqT.I.V.R.E.D.D.H.M..G..V..R..LL..ME..Q.T..MN.-V..Q.PAE.SCCFLRHLLRFYVENV.F.S.H..Y.....S....A....S....S....A....Q.....VR..R...RTSS...LANSFLS.I.KR..D.LRQC.....H...T...H.K..H.Cq.cE....E...E...T...Q..lK...I...K...T...I.Q...T...AFDKM.N.I....KvA.S....VKAIGELDF.LLDWLEKF---hh......................
H2MLV0_ORYLA/43-160                  .............................................................qisgdtetgvk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..IL..DK..S.L..MK.DV..Q.DQT.-CCFLRLLLRFYVERV.F.N.N..F.....S....P....S....E....P....H.....QL..R...CSSA...VANAFVS.I.RR..D.MQKC.....H...C...H.C..-.A...E....E...T...H...R...Q...I...D...S...M.H...T...AFDKL.Q.I....QlA.A....QKAVGELDT.VLDWLEA----lg......................
A0A0D9RR66_CHLSB/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.R.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.ElQ....A.A.V....VKALGELDI.LLQWME-----et......................
G3GZS9_CRIGR/16-172                  ..................................................vlcsvhthslrrclisvdrsli------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.----EKSFPEIK.R.A.L.Q.T.N.D.T.F..P..N..V..TI..LS..T.LenLK.SI..Q.PVD.VCCVTSRLLTFYRDRV.F.K.D..H.....Q....E....T....S....P....E.....VM..R...QISS...IANSFLY.M.QK..T.LEQC.....Q...V...H.N..Q.C...Hc.sqE...A...T...N...A...T...R...T...I.H...D...NYDQL.E.A....SsA.A....LKSLGELDI.FLAWID-----enhq....................
A0A1U7S3B0_ALLSI/121-269             ...................................................................knfrh------.--.----.--.-.-..-..---.----..-..----..C.C.E.INMH.FHELRHNFAAVK.E.M.L.Q.S.Q.D.K.N..T..D..VrfLP..KS..Y.S..LQ.DI..E.PVD.RCCFLRHLMRFYLANV.F.K.H..C.....E....E....S....S....F....L.....VK..R...KVSS...IANNFLH.I.KR..D.LRLC.....H...D...A.G..M.C...H....C...T...E...D...V...KqkyT...R...I.L...S...RFEEM.D.I....QsA.A....IKALGELDI.LLDWM------dkt.....................
IL10_SHEEP/6-175                     .......................................................................a-VLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CTHF..P.A.S.LPHM.LRDVRAAFGKVK.T.F.F.Q.M.K.D.Q.L..N..S..M..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...R...VFNML.Q.E....R.G.V....YKAMSEFDI.FINYIESYMTT........................
H2NHZ6_PONAB/37-132                  .......................................tlsqavdalyikaawlkatipedriknirllkk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...-----KT.K.KQ..F.MKNC.....Q...QeqlL.I..S.C...A....SsarE...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKK----lle.....................
A0A2K5UWL0_MACFA/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....L....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A340XWS6_LIPVE/73-168              ................................................................klfmkncr------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----FQELLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EI..H...----...FVEDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...KFYEI.G.K....K.G.I....YKAVSELDI.LLSWIKQFL--es......................
F6RPU5_HORSE/38-205                  ................................................lilllwsqrpgvqgqefqfgscrv------.--.----.--.-.-..-..---.----..-..----..-.-.-.EGVV.LQELWAAFRAVK.D.V.V.Q.A.Q.D.N.I..T..G..V.rLL..RK..E.V..LQ.NV..S.DAE.SCYLSQALLKFYLDTV.F.K.N..Y.....H....G....K....A....A....Ef...rIL..K...SFST...LANNFIA.I.TS..R.LRPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...EFKQL.DiE....A.A.L....TKAFGEVDI.LLTWMEKF---yq......................
G1MGI7_AILME/59-209                  ...........................................................rarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.LHHIEEAFQEIK.K.T.I.Q.A.K.D.P.F..Q..NvtI..LS..TS..E.T..LH.RI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LRQC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...S...NYDQL.E.A...pS.A.A....IKSLGELDV.FLAWID-----knh.....................
A0A2K6RT36_RHIRO/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.D.G.N..T..D..IriLR..RT..E.S..LQ.DT..K.PGD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LQLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
H0V4J0_CAVPO/18-175                  .....................................................lwtpssglkilhlgscviv------.--.----.--.-.-..-..---.----..-..----..-.-.-.--TN.LQEIQSEFSEIR.D.S.V.Q.A.S.D.R.N..T..DfrI..LR..ST..G.S..LQ.DT..E.PSD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....S....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LQLC.....H...T...Y.M..A.C...H....C...G...Q...E...A...A...EthrQ...I.L...S...HFEQL.E.P....QaA.A....VKVLGELDI.LLRWME-----et......................
A0A2U3X5H9_ODORO/5-174               .......................................................................s-LLCCL.VL.LVGV.GA.S.R..H..QSA.LSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..M..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
IL10_CERAT/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDVFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A2K6DLJ2_MACNE/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A3Q7RCN0_VULVU/15-182              ..................................................lilllrsqgpgvqgqefrfgpc------.--.----.--.-.-..-..---.----..-..----..-.R.V.QGVA.LRELREAFWTVK.D.T.V.Q.A.K.D.N.I..T..G..V.rLL..RK..E.V..LQ.DV..S.DAE.SCYLIRALLTFYLNTV.F.K.NylD.....E....A....A....D....V....R.....IR..R...SFST...LANNFFV.I.AS..K.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---ye......................
F7HHY3_MACMU/13-182                  ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViR...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWI------aknhe...................
A0A383Z962_BALAS/2-177               ..........................................................aalpclslillfws------.--.----.--.-.R..G..PGV.QGQE..F..QFGP..C.Q.V.EGVV.LQELWEAFQAMK.D.I.V.Q.A.Q.D.N.I..T..S..V.qLL..RK..E.V..LQ.NV..S.EAE.SCHLIHALLKFYLNTV.F.K.N..Y.....R....D....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.VS..K.LQAS.....QekeM...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENF---yql.....................
A0A3B3YNY4_9TELE/4-174               .......................................................................q-LLSVL.VL.LSSV.FS.A.C..C..SPV.CH-D..Q..CCRF..V.E.E.FPVR.VQRLREDYRRIR.G.F.Y.E.S.N.D.D.F..D..N..A..LL..DQ..S.V..ED.AF..K.SQF.ACEAMNSILEFYLSTV.L.P.T..A.....V....A....Sv.tiD....T....S.....LK..I...HVES...IQQIFDE.L.KR..D.VHRC.....R...K...V.F..K.C...K....-...K...P...F...D...I...R...S...L.N...S...TYTEM.E.S....K.G.V....YKAMGELDQ.LFNYIETYLA-s.......................
U3K658_FICAL/57-168                  ..................................................pkdlikttrllkkttkmlfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQLLSFYVKNV.F.S.R..L.....E....V....G....-....-....-.....-R..D...KLYF...-ISAFQV.L.QA..N.MDAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...R...K...L.Q...R...MFLKL.G.D....Q.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
F1PZ65_CANLF/5-175                   ......................................................................al-LCCCL.VL.LAGV.GA.S.R..H..QST.LPED..D..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.SYL.GCQALSEMIQFYLEEV.M.P.R..A.....E....N....H....D....P....D.....IK..N...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A2U3ZZZ3_TURTR/13-139              ....................................................................fppq------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...RISS...IANSFLH.M.QK..S.LQRC.....Qe.qR...L.C..H.C...R....Q...E...A..tN...A...T...R...I...I.H...D...NYHQL.E.V....R.SaA....IKSLGELDV.LLAWID-----knh.....................
Q6H8Q2_SHEEP/6-175                   .......................................................................a-VLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CTHF..P.A.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..N..S..M..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...R...VFNML.Q.E....R.G.V....YKAMSEFDI.FINYIESYMTT........................
G3X1H5_SARHA/9-171                   ............................................................iviftlfispil------.--.----.--.-.-..-..--L.VQQN..N..CMDV..C.T.Y.VVFN.IYEIRNEFSEIR.G.F.V.Q.A.E.D.EhW..D..N..R..IL..KN..SeA..LQ.DI..K.PTE.RCCFFRHLLRFYLDKV.F.K.N..Y.....Q....P....S....S....P....H.....IR..R...KVSS...IANSFLG.I.KK..E.LRLC.....H...D...Q.M..T.C...H....C...G...E...E...A...K...E...K...Y.M...Q...ILSHF.E.E....K.A.V....IKALGELDI.LLRWIE-----rtk.....................
A0A2Y9EDY1_PHYMC/15-172              .....................................................fflcsahagglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRRMEESFRGIK.N.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...KTSS...IANSFLY.M.QK..T.LQRC.....Q...E...Q.R..L.C...H....C...R...Q...E...A...I...N...AtriI.H...D...TYDQL.E.V....R.SaA....IKSLGELDI.LLAWIEK----nhq.....................
R0M2Y7_ANAPL/5-175                   .......................................................hlllclysvtcwlslmp------.--.----.--.-.-..-..---.AAEN..K..IFHF.gP.C.R.ISMS.VTEIRSGFTAIK.A.N.I.Q.A.R.D.P.I..R..T..LsiLS..HP..Q.S..LH.KV..K.SSD.RCCIIHNLFNFYMDKV.F.K.H..C.....Q....T....E....D....S....Y.....IN..R...KISS...IANSFLS.I.KR..K.LEQC.....H...N...Q.N..K.C...L....C...G...Q...E...S...T...E...K...F.K...Q...ILANY.E.G....L.N.ItsaaIKSLGELDI.LLDWME-----ks......................
A0A2K5C9P3_AOTNA/5-174               .......................................................................a-LLCCL.VF.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.N.LPHM.LRELRVAFSRVK.T.F.F.Q.K.K.D.Q.L..D..S..M..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....VK..E...HVNS...LGEKLKT.F.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...A...Q...V.K...N...AVSKL.Q.E....K.G.I....YKAMSEFDI.FIDYIEAYMTM........................
F6Z3D2_ORNAN/8-177                   ......................................................................ll--LLSL.VC.IFSV.EP.A.W..G..QNS.PSAE..N..CVSL..S.D.T.LPTM.LRELRSTFQTVK.N.Y.F.Q.K.K.D.EdL..D..T..I..LL..KA..N.L..LE.DF..K.SYL.GCQAMLDMIRFYLEEV.M.P.K..A.....Q....-....Q....N....K....E.....IK..H...HVGS...LGNKLQS.L.QH..Q.LKRC.....H...R...F.L..P.C...E....K...R...S...K...A...I...E...E...I.K...E...TYGQL.K.E....K.G.I....YKAMGEFDI.FINYLESYL--mq......................
A0A091FKG9_9AVES/58-168              ...................................................kdlikntrllkkttkilfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQLLSFYVQNV.F.S.H..L.....G....A....E....S....-....-.....DK..L...HIIC...AF---EM.L.QA..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...I.K...K...TFLKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A3Q7W2D6_URSAR/39-169              .................................fqavdtlyvkaawlkatipedhiknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....A....Q....V....C....R.....EI..H...----...FVEELHS.L.RQ..Q.MNRC.....I...S...C.A..S.S...A....R...E...M...K...A...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAIRELDI.LLSWIKQFL--es......................
W5NUV9_SHEEP/15-169                  .........tlslaiakhkqssfaescypvgtlsqavdtlyvkaaslratipedriknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....ET..H...----...FVEDFHS.L.RQ..K.LSRC.....I...S...C.V..S.S...T....R...E...M...K...S...I...T...R...M.K...R...TFYEM.G.K....K.G.I....YKAISELDI.LLSWIKQFL--es......................
F1SEZ2_PIG/18-171                    ......................................................csaharglrrclisidmh------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.--RIEESFRGIK.K.A.I.Q.A.K.D.T.M..Q..N..V..TIlsPS..E.S..LH.SI..K.PLD.ACCMTKNLLAFYVDRV.F.K.D..H.....Q....E....L....D....P....Q.....LL..R...KISS...IANSFLY.M.QK..T.LQQC.....He.qR...L.C..H.C...R....Q...E..aT...N...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDI.FLAWID-----knh.....................
A0A2R9ADA9_PANPA/6-168               ....................ilrcglllvtlslaiakhkqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIK-----klle....................
A0A2U3XRS9_LEPWE/5-174               .......................................................................a-LLCCL.VL.LAGV.GA.S.R..H..QSA.LSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..M..LL..TE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A2K6S2Z1_SAIBB/36-203              .............................................vslwllgtmlilcfvdsrslrkclist------.--.----.--.-.-..-..---.----..-..----..-.-.-.--DM.-HHVEESFQEIK.R.A.I.Q.A.K.D.I.F..P..N..V..TI..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.A....R.SaA....IKSLGELDV.FLAWID-----knhev...................
A0A093GNK0_DRYPU/58-168              ....................kdlikntrllkkttkvlfmtncsvrdqllsfyvkyvfshlgarsdklyvita------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...----FQV.L.QA..N.MSAC.....H...P...C.A..P.S...T....R...L...S...S...A...V...K...N...V.K...K...TFLKL.G.E....K.G.I....HKAIHELDI.LLPWIQAYIQ-t.......................
A0A3B5RAD3_XIPMA/8-157               ...............................................camlllllgflnrpaesrtlhmdgc------.--.----.--.-.-..-..---.----..-..----..-.-.S.ANVH.LHELHRYFSEIK.S.D.A.I.S.A.DgE.I..G..V..K..LL..DA..S.L..MK.NV..Q.EGQ.TCCFVRLLLRFYVERV.F.S.N..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...A...SFDKV.-.-....-.-.-....---------.-----------pytpcvlsvqn.............
A0A3B5Q179_XIPMA/24-164              ...............................................aesrtlhmdgcsanvhlhelhryfs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.E.I.K.S.D.A..V..S..L..IK..KH..R.H..TH.TH..E.GQT.CC-FVRLLLRFYVERV.F.S.N..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...A...SFDKL.QiQ....Q.A.A....QKAVGELGT.VLDWLE-----glg.....................
G1MGI2_AILME/22-176                  ...........................................................saglktlrlgscm------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDI.LLQWME-----emk.....................
G3TLC9_LOXAF/25-175                  ...........................................................weilhlgscvisi------.--.----.--.-.-..-..---.----..-..----..-.-.-.---N.LQKIRNEFSEIR.G.S.M.Q.A.E.DgN.I..D..I..R..IL..RR..S.V.sLQ.DT..V.PSD.QCCLLHRLLRLYLDRV.F.K.T..Y.....R....T....P....D....H....Y.....ML..R...KISS...LANSFLT.I.KK..D.LRLC.....H...D...H.M..T.C...H....C...G...E...E...A...M...E...KysqI.L...S...HFKRL.E.P....Q.AvV....LKALGELDI.LLQWME-----et......................
A0A2Y9ENA1_PHYMC/9-182               .............................................tlpclslillfwsqgpgvqgqefqfgp------.--.----.--.-.-..-..---.----..-..----..C.Q.V.EGVV.LQELWEAFQAMK.D.I.A.Q.A.Q.D.N.I..T..S..V.qLL..RK..E.V..LQ.NV..S.EAE.SCYLIHALLEFYLNTV.F.K.N..Y.....H....D....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.MS..K.LQPS.....QekeM...F.S..I.R...E....S...A...R...R...R...F...L...L...F.R...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENF---yh......................
A0A286YEX3_HUMAN/1-74                ........................................................................------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-------MIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..A...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMS----.-----------........................
A0A2J8QVT6_PANTR/3-173               ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLEFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KVSS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWIN-----knhev...................
A0A340YH52_LIPVE/17-179              ......................................................vfwtpsarlktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITAS.LQAIRSGFSEIQ.D.R.V.Q.P.K.D.E.I..IdlS..I..LR..KT..Q.P..LQ.DT..K.PAG.QCCLLRHILGLYLDRV.F.K.N..X.....Q....T....P....D....H....H.....IL..-...QISG...LANSFLT.I.KK..D.LCLCnxgswH...A...H.M..T.C...P....C...G...E...E...A...M...E...KysqL.M...S...HFEEL.Q.P....QaA.V....VKALGELDI.LLSWME-----em......................
A0A3Q1FPW7_9TELE/6-177               ....................................................lllsvlavlsllciawcnpt------.--.----.--.-.-..-..---.-CNN..D..CCRF..V.E.D.FPVR.LKKLREDYSQIR.G.F.F.E.A.N.D.D.L..D..K..A..LL..DQ..S.V..ED.SF..K.SPF.GCHSVNSVLGFYLSTV.L.P.S..Ala.gvT....E....E....T....K....D.....LI..P...HMES...IQQIFDQ.L.KN..D.VTKC.....R...H...Y.F..S.C...K....T...H...L...-...D...I...R...V...L.N...S...TYTEM.K.D....K.G.L....YKAMGEMNL.LFNYIESYLA-s.......................
G3REF8_GORGO/5-174                   .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..HGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..A...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
F1MCS4_BOVIN/6-175                   .......................................................................a-LLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CIHL..P.T.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..H..S..L..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...R...VFSEL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTT........................
H2N3X1_PONAB/54-207                  ..........................................................efqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.M.Q.A.Q.D.N.I..T..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.VS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DvE....A.A.L....TKALGEVDI.LLTWMQK----fykl....................
A0A091EN15_CORBR/55-168              ................................................svpkdlikttrllkkttkmmfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQLLSFYVKNV.F.C.R..L.....E....V....G....S....-....D.....KL..Y...FI--...--SAFQV.L.QA..N.MDAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...L.K...R...MFLKL.G.D....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A2K6EGZ8_PROCO/19-145              ........................................................svhtrglrrclisvdm------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LQ.SI..K.PLD.ACCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRRC.....Q...E...Q.R..R.C...H....C...R...Q...E...A...T...N...A...-.-...-...-----.-.-....-.-.-....---------.-----------trivhdnyd...............
A0A493TP28_ANAPP/51-168              ............................................slkssvpkdlikntrllkkttkvlfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQVLSFYVKNV.F.S.H..L.....E....V....E....S....E....K.....--..-...--LY...LISAFQV.L.QE..N.MNAC.....L...P...C.A..P.S...T....R...L...T...P...A...V...K...N...I.K...T...TFLKL.G.E....K.G.I....YKAISELDI.LLPWIQAYIQ-t.......................
A0A384BM88_URSMA/22-176              ...........................................................saglktlrlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDI.LLQWME-----emk.....................
A0A3Q3AU44_KRYMA/6-178               ......................................................................vl--LSLL.AV.LSFF.AT.C.R..S..T-L.VCNN..R..CCQF..V.E.D.FPAR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..I..A..LL..DQ..S.V..ED.SF..K.TPF.ACQAINSILGFYLNTV.L.P.T..A.....V....A....G....A....S....DgsariLK..P...HVES...IQQIFDQ.L.KS..D.VTRC.....R...H...Y.F..S.C...K....N...Q...F...-...D...I...N...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDL.LFNYIETYLA-s.......................
A0A3P8V1L0_CYNSE/9-142               ...............................ivlhsllsnvsvirhvlhcsvacetrtytdvftrlhqegqm------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CCFMHLLMRFYIERV.F.S.S..Y.....T....S....P....Q....P....I.....NQ..R...CSSA...LANAFVT.I.KR..D.IHKC.....H...C...H.C..G.-...E....E...T...H...R...K...I...D...S...I.H...A...EFTKL.QvD....T.A.A....RKAMGELNV.VLEWLE-----glg.....................
A0A091VT78_OPIHO/51-168              ...............slkssvpkdlikntrllekttkmlfmtncsvrdqllsfyvknvfshpgvgsdklyii------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...--SAFQV.L.QA..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...L.K...K...TFLKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A0B4Q6D8_9GAMA/5-172               .......................................................................a-LLYCL.FF.VTGV.--.-.-..-..-WA.ESEN..N..CTHF..P.T.S.LPHM.LHELRAAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..NG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....HsgggG....P....D.....IK..E...HVNS...LGEKLKT.L.RV..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
A0A4D9DZU1_9SAUR/2-173               .......................................................................k-LLTAL.IF.LALI.AS.I.K..Q..ASCqLSEE..S..CTKL..V.N.L.LPLR.LKDLRIAFDEIK.D.Y.F.Q.A.K.DdE.L..D..I..L..LL..KE..D.L..LE.DF..K.GYL.GCQSVSDMIRFYLDEV.L.P.K..A.....L....N....S....S....K....H.....TK..R...SVAN...IGIMLLD.L.KQ..T.LKRC.....H...R...F.F..T.C...E....K...R...N...Q...T...L...K...Q...I.K...E...TYDKL.Q.E....K.G.I....YKAMGEFDI.FINYIEEYLM-m.......................
A0A087QQC3_APTFO/52-168              ...........lkssvpkdlikntrllkkttkmlfmtncsvrdqllsfyvknvfshlgvgsdklyfisafqv------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...-------.L.QA..N.MDAC.....L...P...C.G..P.P...A....R...L...T...S...A...V...K...K...L.K...K...TFLKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
G3N5D8_GASAC/13-169                  ....................................................rfllllsplaesrtlslasc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VNVH.IHELRQYYNDIR.LdV.I.E.S.D.T.D.I..G..V..K..LL..DK..S.L..MT.NI..Q.DGQ.TCCFVRLVLRFYIERV.F.S.N..Y.....A....S....S....Q....P....Q.....HQ..R...CSSA...LANAFFS.I.RR..D.IREC.....H...C...-.-..N.C...E....E..dT...Q...R...K...I...D...S...V.I...A...EFNKL.DmN....Q.A.A....KKAVGELDT.VLEW-------lqgl....................
A0A099ZMI4_TINGU/48-168              ..........................................katslkssvpkdlikntrllkkttkmlfms------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCSVRDQLLSFYMKNV.F.T.H..L.....E....A....G....R....E....-.....-K..L...YI--...-TSAFQV.L.QE..N.LSTC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...I.K...R...TFHKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A2K5XS41_MANLE/3-173               ............................................lqcvslwllgtilmlcsvdnhgfrrcli------.--.----.--.-.-..-..---.----..-..----..-.-.-.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
A0A2I0LZX4_COLLI/3-173               .................................................................tcpalll------.-L.LLAA.CA.L.P..A..RCS.APQP..S..CLHF..S.E.L.LPAK.LKELRITFEKIK.D.Y.F.Q.S.K.DdE.L..S..I..Q..LL..SS..E.L..LD.EF..K.GTF.GCQSVSEMMQFYMEEV.L.P.S..A.....M....R....T....S....T....L.....HQ..Q...SMDD...LGNLLRN.L.KA..M.MKRC.....H...R...F.F..T.C...E....K...R...S...K...T...I...K...H...I.K...E...MFDKM.H.E....N.G.I....YKAMGEFDI.FINYVEEYLM-m.......................
A0A2K5R5Z3_CEBCA/20-175              .........................................................tpstglktlhlgkcv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..V.rI..LR..RT..E.S..LQ.DT..K.PAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LWHC.....H...A...H.M..T.ChcgE....G...A...T...K...K...Y...S...Q...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A2K6B6S6_MACNE/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
E1C5G0_CHICK/5-175                   .................................................rvllclcsmtccltmlpaagnti------.--.----.--.-.-..-..---.----..-..-LHF.gP.C.R.ISMS.MSEIRAGFTAIK.T.N.I.Q.A.R.D.P.I..R..T..LsiLS..HP..H.S..LH.RV..Q.PSD.KCCIVHKVFNFYVDKV.F.K.H..C.....Q....T....E....N....S....Y.....IN..R...KISS...IANSFLS.I.KR..K.LEQC.....H...D...E.N..K.C...L....C...G...Q...E...P...T...E...R...F.K...Q...ILVNY.E.GlnvtS.A.A....MKSLGELDI.LLDWME-----ks......................
E2R898_CANLF/21-140                  ..........................................................psaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.V..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....-...-...-.-..-.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------ltpqaavvkalgel..........
A0A226MP41_CALSU/53-168              .................kssvpkdlikntrllkkttkrlfmtncsvrdqllsfymknvfshlgmkseklyvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...--SAFRV.L.QE..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...N...I.K...K...TFLKL.G.D....K.G.V....YKAISELDI.LLPWIQAYIQ-t.......................
G5BP21_HETGA/5-174                   .......................................................................a-LLCCL.VL.LAGV.RA.S.Q..G..MDT.QSKD..S..CTRF..P.A.G.LPHM.LQELRAAFGRVK.T.F.F.Q.T.K.D.P.L..D..N..T..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.K..A.....E....N....H....D....P....D.....IK..Q...HVNS...LGEKLKT.L.RL..Q.LRRC.....H...R...F.L..P.C...E....N...K...S...R...A...V...E...Q...V.K...D...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMT-e.......................
A0A1S2ZQX3_ERIEU/5-174               .......................................................................a-ILYCL.VF.LAAA.GA.S.Q..G..HNT.HSES..S..CMHF..P.A.S.LPHM.LRELRAAFERVK.M.F.F.Q.M.K.D.Q.L..D..N..M..LL..NE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.R..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...D...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
H0WP44_OTOGA/12-171                  .................................................aaalilssvhtrglrkclismdt------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHLEESFQEIK.R.A.I.Q.A.K.D.T.F..Q..N..VtiLS..AS..E.T..LQ.SI..K.PSD.VCCVTKNLLAFYVDRV.F.K.D..H.....R....E....L....N....P....H.....IL..R...KISS...IANSFLY.M.QK..T.LQRC.....Q...E...Q.R..R.C...H....C...R...Q...EatnA...T...R...S...V.H...E...NYDQL.E.V....HsA.A....VKSLGELNV.FLAWI------aknh....................
F1AXI3_ORFV/12-183                   ...................................................iiltytlytnaycveylesee------.--.----.--.-.-..-..--D.KQQC..G..SNGA..S.S.S.SPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..N..S..M..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....VK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...A...Q...V.K...R...VFNML.Q.E....R.G.V....YKAMSEFDI.FINYIESYMTT........................
K7F6T8_PELSI/1-157                   ...................................................................qhasc------.--.----.--.-.-..-..--Q.LSEE..S..CTNL..S.N.Q.LLRQ.LKALRIAFAEIK.D.Y.F.Q.A.K.DdE.L..D..I..L..LL..KD..D.L..LE.DF..K.GYL.GCQSVSDMIRFYLEEV.L.P.K..A.....I....N....S....S....K....D.....VK..R...SVGT...IGNMLLD.L.RK..T.LKRC.....H...R...F.F..I.C...E....K...R...Y...Q...T...L...K...Q...I.K...E...TYDKL.Q.E....K.G.I....YKAMGEFDI.FINYIEEYLM-m.......................
F7CQQ3_XENTR/6-173                   ...............................................................kfcllltlf------.-F.F-TC.KT.V.K..C..QSG.DAEG..N..CSRV..V.N.I.FPAK.LKELRATFQKIK.N.F.F.Q.M.K.D.NaL..E..I..V..LL..QD..D.L..LQ.EF..K.GNL.GCQSVSETIRFYLEEV.L.P.Q..A.....N....H....-....-....-....-.....YK..M...NVSF...LKDKLLD.L.KH..T.LRRC.....H...N...F.L..P.C...E....R...K...S...K...A...I...K...Q...I.K...Q...TYNKM.H.E....Q.G.I....YKAMGEFDI.LIDYIEDYL--ms......................
A0A087YF61_POEFO/4-174               .......................................................................q-LLSVL.VL.LSSV.FS.A.C..C..SPV.CH-D..Q..CCRF..V.E.E.FPVR.VQRLREDYRRIR.G.F.Y.E.S.N.D.D.F..D..N..A..LL..DQ..S.V..ED.AF..K.SQF.ACEAMNSILEFYLSTV.L.P.T..A.....V....A....Sv.tiD....T....S.....LK..I...HVES...IQQIFDE.L.KR..D.VHRC.....R...K...V.F..K.C...K....-...K...P...F...D...I...R...S...L.N...S...TYTEM.E.S....R.G.V....YKAMGELDQ.LFNYIETYLA-s.......................
W5N387_LEPOC/9-175                   ...........................................cllstvllavsipsaaghrlhlgscaini------.--.----.--.-.-..-..---.----..-..----..-.-.-.---Q.VHELREYFNEIRqT.I.V.R.E.D.D.H.M..G..V..R..LL..ME..Q.T..MN.-V..Q.PAE.SCCFLRHLLRFYVENV.F.S.H..Y.....S....A....S....S....A....Q.....VR..R...RTSS...LANSFLS.I.KR..D.LRQC.....H...T...H.K..H.Cq.cE....E...E...T...Q..lK...I...K...T...I.Q...T...AFDKM.N.I....KvA.S....VKAIGELDF.LLDWLEKF---hh......................
A0A093HKS1_STRCA/57-167              ...................pkdlikntrllkkttkmlfmtncsvrdqllsfyvqnvfthlgvggeklyfisa------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...----FQA.L.QE..N.LNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...I.K...R...TFHKL.G.K....K.G.I....YKAIHELDI.LLPWIQAYV--q.......................
A0A093Q2H2_9PASS/40-168              ..................................qvtenlyikatslkssvpkdlikttrllkkstkmlfmt------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCSVRDQLLSFYVKNV.F.S.R..L.....E....A....G....-....-....-.....-R..D...KLNI...IS-AFQV.L.QV..N.MDAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...L.R...R...MFFKL.G.D....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A1U7RRW5_ALLSI/19-176              ......................................................aitfsegrklrfgvcels------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GTS.LQEIKTYFDVIR.G.T.V.Q.D.Q.D.H.V.tD..T..V..LL..KK..I.L..LH.NV..P.ALE.SCCLLRHLLRFYVENV.F.R.H..Y.....Q....A....T....N....P....L.....LR..R...KTSS...LSNSFLS.V.KT..T.LRQC.....H...D...Q.K..K.C...A....C...G...A...E...AnrrL...E...L...L.R...E...EYEKL.DrD....T.A.A....IKALGEMDI.LFNWME-----kak.....................
A0A2Y9Q1M4_DELLE/12-182              .............................................clslillfwsqgpgvrgqefqfgpcqv------.--.----.--.-.-..-..---.----..-..----..-.-.-.EGVV.LQELWEAFQAMK.D.I.V.Q.A.Q.D.S.I..T..G..V.qLL..RK..E.V..LQ.NA..S.EAE.SCYLIHALLEFYLNTV.F.K.N..Y.....R....D....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.VS..K.LQPS.....E...Ke.mF.S..I.S...E....S...A...H...R...R...F...L...L...F.Q...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENF---yqm.....................
A0A1A6GKU9_NEOLE/7-181               .........................................tlsclslillvwnqvpgllahefrfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LSELWEAFRAMK.S.T.V.Q.T.Q.D.G.I..T..S..V.rLL..KS..Q.V..LQ.DV..S.DAE.SCYLVHSLLKFYLNTV.F.K.N..Y.....H....S....K....A....A....K.....FKtsK...SFST...LANNFFV.I.AS..K.LQPS.....Kd.kD...M.L..SsS...E....S...A...H...R...R...F...L...L...F.R...K...AFKQM.NtE....V.A.L....VKAFGEVDI.LLTWMQK----fyql....................
A0A3Q1AYN3_AMPOC/1-177               ...............................................mtlrclllsvpavlsllciawcnpt------.--.----.--.-.-..-..---.-CNN..A..CCRF..V.E.G.FPVR.LKKLREDYSQIR.D.F.F.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACHSVNSVLGFYLSTV.L.P.S..Ala.gvT....E....D....T....K....D.....LI..P...HMES...IQQIFDQ.L.KN..D.VTKC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...R...D...L.N...S...TYTQM.E.G....K.G.L....YKAMGELDL.LFNYIETYLA-s.......................
A0A4D9DT35_9SAUR/1-130               .....................................................................mnv------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-NEIRASFTAIK.A.T.I.Q.A.K.D.A.I..R..T..IsiLS..YP..Y.S..LH.NF..N.SAD.RCCIIHHLLRFYVDKV.F.K.H..C.....E....T....E....D....S....H.....VN..R...KISS...IANSFLS.I.KK..K.FRQC.....N...E...Q.N..V.C...D....C...G...E...E...A...I...E...K...Y.K...Q...ILTN-.-.-....-.-.-....---------.-----------ygqqpqrqrdgisqdkte......
G5BP20_HETGA/20-171                  .......................................................csvhtpalrrcplfvdm------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHLEESFQEIK.R.A.V.Q.T.K.D.T.L..Q..I..IttLS..TV..E.I..LR.SI..K.PTD.VCCVTKNLLEFYMDRV.F.K.D..H.....Q....E....L....K....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRQC....vH..rR...C.H..Y.S...E....E...A...T...H...A...T...R...T...V.H...D...NYDLL.E.I...pS.A.A....IKSLGELDV.FLAWID-----rn......................
A0A383Z997_BALAS/5-174               .......................................................................a-LLCCL.IF.LAGV.AA.S.Q..H..QGT.QSKD..S..CIHF..P.D.S.LPHM.LRELRAAFSNVK.T.F.F.Q.M.N.D.Q.L..D..N..S..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...VFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
A0A2Y9JUC2_ENHLU/5-174               .......................................................................a-LLCCL.VL.LAGV.GA.S.R..H..QSA.LSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..S..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....E.....VK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
F6WZC9_CALJA/22-175                  ..........................................................atglktlhlgkcvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFLEIR.G.S.V.Q.A.K.DgN.I..D..V.rI..LR..RT..E.S..LQ.DT..E.PAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLT.V.KK..D.LRLC.....H...A...H.M..T.ChcgE....G...A...T...K...K...Y...S...Q...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A401NMP0_SCYTO/1-112               ......................................................................qk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.K.D.D.N.F..H..I..T..LL..GA..R.L..DH.GF..K.GRE.GCQFLKEMLNFYLRVV.I.P.A..A.....K....T....Q....Q....K....S.....IN..S...NISK...IGNILSE.L.KE..N.VQIC.....H...R...F.F..N.C...DlcncR...P...S...P...Y...I...E...N...I.Y...K...VYEKK.-.-....-.-.-....---------.-----------kkenkseakrhvg...........
IL20_MOUSE/24-176                    ............................................................glktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-TAN.LQAIQKEFSEIR.D.S.V.Q.A.E.D.TnI..D.iR..I..LR..TT..E.S..LK.DI..K.SLD.RCCFLRHLVRFYLDRV.F.K.V..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLI.I.KK..D.LSVC.....H...S...H.M..A.C...H....C...G...E...E...A...M...E...K...Y.N...QilsHFIEL.ElQ....A.A.V....VKALGELGI.LLRWMEE----ml......................
A0A452Q846_URSAM/20-171              ..........................................................vrarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.IHHIEEAFQEIK.K.T.I.Q.A.K.D.P.F..Q..NvtI..LS..TS..E.T..LH.RI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LRQC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...S...NYDQL.E.A....R.SaA....IKSLGELDV.FLAWID-----rnh.....................
A0A3B4TAV5_SERDU/2-166               ...........................................llgcslslllvlsclsepvesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VNVH.THELRKYYSTIR.S.D.V.V.A.G.DnE.I..G..V..K..LL..DK..S.L..IK.D-..E.GQ-.TCCFLHLLLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...L.H...V...AFIKL.QiN....Q.A.A....QKAMGELDT.VLEWLE-----glg.....................
A0A2K6USW7_SAIBB/5-174               .......................................................................a-LLCCL.VF.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.S.LPHM.LRELRVAFGRVK.T.F.F.Q.K.K.D.Q.L..D..S..T..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.F.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...A...Q...V.K...N...AVSKL.Q.E....K.G.V....YKAMSEFDI.FIDYIEAYMTM........................
A0A3P9N7T6_POERE/36-197              ...............................................vllllllgllngpaesrtlhmdgcs------.--.----.--.-.-..-..---.----..-..----..-.-.-.ANVH.VHELHQYFSEIK.S.D.A.I.S.A.DgE.I..G..V..K..LL..DA..S.L..MK.NV..Q.EGQ.TCCFVRLLLRFYVERV.F.S.S..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...A...NFDKL.QiQ....Q.A.A....QKAVGELGT.VLDWLE-----qlg.....................
A0A2I3SAH3_PANTR/41-211              ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLEFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KVSS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWIN-----knhev...................
IL24_MOUSE/14-180                    ...................................................illlwnqvpglegqefrsgsc------.--.----.--.-.-..-..---.----..-..----..-.Q.V.TGVV.LPELWEAFWTVK.N.T.V.Q.T.Q.D.D.I..T..S..I.rLL..KP..Q.V..LR.NV..S.GAE.SCYLAHSLLKFYLNTV.F.K.N..Y.....H....S....K....I....A....K.....FKvlR...SFST...LANNFIV.I.MS..Q.LQPSk...dN...S...M.L..P.I...S....E..sA...H...Q...R...F...L...L...F.R...R...AFKQL.DtE....V.A.L....VKAFGEVDI.LLTWMQK----fyh.....................
A0A151MAP9_ALLMI/1-89                ........................................................................------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-------MIQFYLEEV.L.P.K..A.....E....G....S....D....Q....S.....IE..R...HVDT...IGNKLLD.L.RH..T.LKRC.....H...R...F.L..P.C...E....K...R...S...Q...T...V...K...Q...I.K...E...TYKTL.H.K....K.G.M....YKAMGEFDI.FIDYIEEYLM-m.......................
A0A2K6V1Z6_SAIBB/5-169               ...................cilrcglllvtlslaiakhrqssftkscyprrtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..N.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..H...F---...-VEDFHS.L.RQ..K.WSHC.....I...S...C.A..S.S...P....R...E...M...K...S...I...T...R...I.K...R...IFYGI.G.K....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A096MXN1_PAPAN/52-207              ........................................................gqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.S.Q.D.N.I..R..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.AS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
A0A3B3V9L1_9TELE/8-171               ..............................................cavllllllgflngpaesrtlhmdgc------.--.----.--.-.-..-..---.----..-..----..-.-.S.ANVH.LHELHQYFSEIK.S.V.A.I.S.A.DgE.I..G..V..K..LL..DA..S.L..MK.NV..Q.EGQ.TCCFVRLLLRFYVERV.F.G.N..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...A...NFDKL.QiQ....Q.A.A....QKAVGELGT.VLDWLE-----glg.....................
A0A3Q1JK10_ANATE/7-170               .....................................................................yyl---CLL.VL.LSCL.NE.P.A..E..SRT.----..-..-LHL..D.S.C.SVHVhTYELRKYYSDLR.S.D.V.I.A.G.DtE.I..G..V..K..LL..DR..S.L..MK.DV..Q.QGQ.TCCFLRLLLRFYVERV.F.S.N..Y.....A....S....D....Q....P....Q.....QQ..R...CSSA...LANAFVG.I.RR..D.IHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...L.H...A...EFIKL.QiN....Q.A.A....QKAMGELDT.VLEWLE-----glg.....................
A0A452Q8E1_URSAM/38-211              ..........................................llclnlilllwsqapgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFSAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DAE.SCYLIRALLKFYLTTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.VS..K.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
A0A3Q1GI11_9TELE/9-173               ........................................................vsllllllicltepve------.--.----.--.-.-..-..---.---S..G..TLHL..N.ScS.VNVH.MHELRKYYTDIR.S.N.A.I.S.E.DsE.I..G..V..K..LL..DK..S.L..MK.DL..Q.EGQ.TCCFIRLVLRFYVERV.F.S.N..Y.....A....S....S....H....P....Q.....QQ..R...CSSA...LANAFIS.I.RR..D.IHKC.....H...C...L.C..E.-...E....E...T...Q...R...K...M...D...S...V.H...A...EFIKL.QiS....Q.A.A....QKAVGELDT.VLEWLEE----qktq....................
A0A383Z9Z7_BALAS/19-174              ........................................................wtpsarvktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITAS.LQAIRSGFSEIR.N.S.X.Q.P.K.D.E.I..I..D..LriLR..KT..Q.P..LQ.DT..K.PAG.QCCLLCHILRLYLDKV.F.K.N..Y.....Q....T....P....D....H....R.....IL..Q...KISS...LANXL-T.I.KK..D.LWLC.....H...A...H.M..T.C...S....C...G...E...E...A...M...E...KygqL.M...S...HFQEL.Q.P....QaA.V....VKALGELDI.LLSWME-----em......................
A0A3Q1MMM3_BOVIN/36-153              ..................................................ttnlqgirsgfseirdsvpadq------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CCLLHHILRLYLDRV.F.K.N..Y.....Q....P....P....D....H....H.....IF..R...KVSR...LANSLLT.I.KK..D.LQLC.....H...A...H.M..S.C...P....C...G...E...E...A...K...EkysQ...I.L...S...HFEEL.P.P....Q.AvV....VKALGELDI.LLQWME-----ea......................
G3QNU7_GORGO/40-211                  .....................................................klqcvslwllgtimilcsv------.--.----.--.-.-..-..---.--EN..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELNV.FLAWIN-----knhev...................
A0A2Y9PVQ9_DELLE/12-183              .............................................clslillfwsqgpgvrgqefqfgpcqv------.--.----.--.-.-..-..---.----..-..----..-.-.-.EGVV.LQELWEAFQAMK.D.I.V.Q.A.Q.D.S.I..T..G..V.qLL..RK..E.V..LQ.NA..S.EAE.SCYLIHALLEFYLNTV.F.K.N..Y.....R....D....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.VS..K.LQPS.....QekeM...F.S..I.S...E....S...A...H...R...R...F...L...L...F.Q...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENF---yqm.....................
A0A384BL48_URSMA/21-171              ...........................................................rarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.IHHIEEAFQEIK.K.T.I.Q.A.K.D.P.F..Q..NvtI..LS..TS..E.T..LH.RI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LRQC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...S...NYDQL.E.A....R.SaA....IKSLGELDV.FLAWID-----rnh.....................
A0A3B4WVV4_SERLL/6-177               .......................................................................l-LLSTL.VL.LSLL.ST.S.W..C..-SP.MCNN..Q..CCRF..V.E.G.FPVR.LKKLREDYSQIR.D.F.Y.E.A.N.N.D.L..E..T..A..LL..DQ..S.V..ED.SF..K.SPF.GCHAMNSILDFYLSTV.L.P.T..A.....M....A....E....TtediR....D.....LK..P...HMES...IQQIFDE.L.KN..D.VTKC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...R...N...L.N...S...TYTQM.E.S....K.G.L....YKAMGELDL.LFNYIEVYLA-s.......................
A0A2K6G868_PROCO/40-169              ..................................qavdtlyikaawlkatipedriknirllnkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EI..H...----...FVEDFHS.L.RQ..K.LSCW.....I...S...C.D..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYKI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A3P8SDM6_AMPPE/1-177               ...............................................mtlrclllsvpavlsllciawcnpt------.--.----.--.-.-..-..---.-CNN..A..CCRF..V.E.G.FPVR.LKKLREDYSQIR.D.F.F.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACHSVNSVLGFYLSTV.L.P.S..Ala.gvT....E....D....T....K....D.....LI..P...HMES...IQQIFDQ.L.KN..D.VTKC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...R...D...L.N...S...TYTQM.E.G....K.G.L....YKAMGELDL.LFNYIETYLA-s.......................
U3J6W5_ANAPP/1-173                   .....................................................................mrt---CCV.AL.LLLL.AA.S.TqpA..RCL.LTDP..S..CLHL..S.D.L.LPAK.LKELRMKFEEIK.D.Y.F.Q.S.Q.DdE.L..S..I..Q..LL..SS..D.L..LE.EF..K.GNF.GCQSVLEMMRFYMEEV.L.P.S..A.....L....R....S....S....E....H.....HQ..Q...SVGD...LGNLLLS.L.KA..M.MRRC.....H...R...F.L..T.C...E....K...R...S...K...T...I...K...Q...I.K...E...TFEKM.N.E....N.G.I....YKAMGEFDI.FINYIEEYL--lm......................
IL20_HUMAN/20-175                    ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...S...HFEKL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
#=GR IL20_HUMAN/20-175         SS    ........................................................XXXXX-EEEEETTEEE------.--.----.--.-.-..-..---.----..-..----..-.-.-.-EE-.HHHHHHHHHCCH.H.H.H.H.H.T.---.T..T..-.-S..S-..ST..T.-..ST.TS..-.HHH.HHHHHHHHHHHHHHHT.C.C.C..-.....-....-....S....-....H....H.....HH..H...HHHH...HHHHHHH.H.HH..H.HHHH.....H...H...T.T..-.S---H....H...H...H...H...H...H...H...H...H.H...H...HHHHS.-.H....HHH.H....HHHHCTHHH.HHHHHH-----C-......................
I3M7U8_ICTTR/5-174                   ........................................................................VLLYCL.VL.LAGM.GT.S.R..G..ENT.QSEE..T..CTHF..P.G.G.LPHM.LRELRAAFGKVK.I.F.F.Q.T.K.D.Q.L..D..D..M..LL..SE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.Q..A.....E....N....H....S....P....D.....VK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...Q...Q...V.K...D...AFSKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMT-a.......................
H0YS58_TAEGU/6-170                   .......................................................pilllllllgtaparal------.--.----.--.-.-..-..---.---P..S..CLHF..P.E.L.LPAK.LKELRLKFEEIK.D.Y.F.Q.S.K.D.EdL..S..I..Q..LL..SS..D.L..LE.EI..K.GRL.GCQSVSEMMGFYMEEV.L.P.S..A.....I....R....T....S....T....E.....HQ..H...SMGD...LGNLLLG.L.RA..M.MRRC.....H...R...F.F..T.C...E....E...R...S...R...S...M...E...H...I.K...E...TFSRM.D.K....N.G.I....YKAMGEFDN.FINYIEKYLTM........................
D2H945_AILME/37-169                  ..................................................tlfqavdtlyvkaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.H.I..K..N..I..LL..LK..K.K..TK.KL..F.-MK.NCRFREQLLSFFMEDV.F.G.Q..L.....Q....V....Q....V....C....R.....EI..H...----...FVEELHS.L.RQ..Q.MNRC.....I...S...C.A..S.S...A....R...E...M...K...A...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAIRELDI.LLCWIKQFL--es......................
A0A1L8H745_XENLA/3-169               ..................................................................fclllt-----L.FF.F-TC.KT.V.R..C..QSG.DAEG..S..CHRV..V.N.I.FPAK.LKELRATFQKLK.N.F.F.Q.M.K.DnN.L..E..T..V..LL..QN..D.L..LQ.EF..K.GNM.GCRSVSETIRFYLEDV.L.P.Q..A.....N....H....-....-....-....-.....YK..M...NVNF...LQDKLLD.L.KH..T.LRRC.....H...N...F.L..P.C...E....R...K...S...K...A...I...K...E...I.K...Q...TYNKM.R.E....Q.G.L....YKAMGEFDI.LIDYIEEYL--ms......................
A0A3B3DWZ4_ORYME/2-166               .....................................................mllgclvslllilgkaaes------.--.----.--.-.-..-..-RT.LHAD..S..----..-.C.S.FNVH.THELRKYYSDVR.S.H.A.I.S.G.DtE.I..G..V..K..IL..DK..S.L..IK.NV..Q.EGQ.TCCFLRLLLRFYVERV.F.S.H..F.....S....P....S....E....P....H.....QL..R...CSSA...LANAFVS.I.RR..D.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...Q...I...D...S...M.H...T...EFDKL.Q.I....QeA.A....QKAVGELNT.VLDWLE-----glg.....................
G3R6F4_GORGO/6-168                   ....................ilrcglllvtlslaiakhkqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIK-----klle....................
A0A0D9RR19_CHLSB/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
M7BDI3_CHEMY/526-650                 ...................................nlyvkattfkasipkdliknrrllkkttknlfmkncs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.---VRDQLLSFYVKNV.F.G.G..L.....D....F....G....-....-....-.....--..S...EKVY...LASAFQA.L.QE..N.LNNC.....L...P...C.A..P.S...T....R...I...T...T...A...V...K...K...I.K...K...TFDKL.G.E....K.G.I....YKAISELDI.LLPWIQTYI--et......................
G1T734_RABIT/9-176                   ............................................................gflcavfhllwa------.--.----.-P.S.T..G..LRT.LQLG..S..CV--..-.-.-.VTTD.LQEIQSVFSELR.H.S.V.Q.A.K.D.D.I..T..D..IriLR..RT..E.S..LQ.DT..K.PKG.RCCLLRRLLRLYMERV.F.N.N..Y.....P....A....P....D....H....Q.....TL..R...KISR...LANSLLT.I.KK..D.LRLC.....H...A...N.K..K.C...H....C...G...K...E...A...M...E...KynqI.L...R...QFEQL.E.P....QaA.V....VKALGELDI.LLQWME-----etv.....................
A0A452FGW3_CAPHI/24-196              .........................................lpclslmlllwspgpwvqgqefqfgpcqvdg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--IV.LQKLWQAFWAMK.D.I.V.Q.A.Q.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.ETE.SCHLLHALLRFYVNTV.F.K.N..Y.....H....D....K....A....V....Ef...gIL..K...SFST...LANNFFV.I.VS..K.LQAS.....Qe.kM...F.S..T.R...E....S...A...R...R...R...F...L...L...F.Y...R...AFKQL.DrE....A.A.V....TKAFGEMDI.LLRWMEKF---nql.....................
G1PXI6_MYOLU/5-174                   .......................................................................a-LLCCL.VF.LAGM.GA.S.P..A..QGT.PSEN..S..CTHF..S.T.S.LPHM.LRELRAAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..NG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....S....Q....G....P....D.....IK..E...PVSS...LGEKLKT.L.RL..Q.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A2K6B713_MACNE/50-207              ......................................................vqgqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.S.Q.D.N.I..R..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.AS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
A0A2I0LZX3_COLLI/18-175              ......................................................nlmptagnrifhfgpcrv------.--.----.--.-.-..-..---.----..-..----..-.-.-.-SMS.VAEIRSGFTAIK.A.N.I.I.T.R.D.P.I..R..T..LsiLS..YP..H.S..LH.KV..K.SSD.RCCIAHHLSNFYVEKV.F.R.H..C.....K....T....E....D....S....Y.....VN..R...KISS...IANSFLS.V.KR..T.LAHC.....H...E...Q.N..K.C...M....C...G...Q...E...S...T...E...K...F.K...Q...ILANY.E.A....L.D.VtsaaIKSLGELDI.LLDWME-----ks......................
G1MXH5_MELGA/5-175                   .....................................................................mqt---CCQ.AL.LLLL.AA.C.T..L..PAH.CLEP..T..CLHF..S.E.L.LPIQ.LRELRVKFEEIK.D.Y.F.Q.S.R.DdE.L..N..I..Q..LL..NS..E.L..LD.EF..K.GNF.GCQSVSEMLRFYTDEV.L.P.R..A.....M....K....T....S....T....S.....HQ..E...SMGD...LGNMLLG.L.KM..T.MKRC.....H...H...F.F..T.C...E....R...R...S...K...V...I...K...Q...I.K...E...TFEKM.D.E....N.G.I....YKAMGEFDI.FINYIEEYL--lm......................
A0A452HQS2_9SAUR/19-161              ......................................................klsaslkrlhlghcvisv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---N.IHEIRHSFAAIK.E.M.I.Q.S.K.D.E.R..T..D..IriLH..KS..Y.S..LQ.DT..E.PMD.RCCFLRHLLRFYLATV.F.S.H..C.....K....A....S....S....P....L.....VS..R...KVSS...IANAFLS.I.KK..E.LRLC.....V...I..sM.C..H.C...G....E...D...V...K..hK...C...G...Q...I.L...S...QYE--.-.-....-.-.-....---------.-----------kvnhsllsdvana...........
H3CPB0_TETNG/5-177                   ......................................................................tl--LSVL.LL.L-SS.SC.A.V..W..CAT.LCNN..R..CCSF..L.E.G.FPAR.LKVLRENYSNIR.E.Y.Y.E.A.N.D.D.L..D..L..V..LI..DQ..S.I..VE.SF..K.TPF.ACHVMDGILKLYLDSV.L.P.R..A.....L....AsvtvE....T....R....D.....LQ..P...HVES...IQQILDQ.L.KT..E.VNNC.....K...H...F.F..A.C...K....N...Q...F...D...M...N...T...L...T.S...A...YTQQM.Q.E....K.G.L....FKAMGELDL.LFNYIEMYMS-s.......................
A0A3B5KG68_TAKRU/86-220              ...........................................................hvsicslralslq------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.E.A.N.D.D.L..D..I..V..LL..DQ..S.I..VD.TF..K.TPF.ACHLMDGILRFYLDSV.L.P.R..Ala.tvT....A....E....T....R....N.....LK..P...HVES...IQQIFDQ.L.KI..E.VTNC.....K...H...Y.F..A.C...K....N...R...F...D...-...I...N...V...L.N...S...TYTKM.E.D....K.G.L....YKAMGELDL.LFNYIENYLA-s.......................
A0A452EY26_CAPHI/6-175               .......................................................................a-LLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CTHF..P.A.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..N..S..M..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...R...VFNML.Q.E....R.G.V....YKAMSEFDI.FINYIESYMTT........................
Q9ICJ0_SCMVC/12-184                  ......................................................................at--AVCL.VA.IVVA.VA.A.K..G..RDS.KPSP..A..CDPM..H.G.A.LAGI.FKELRTTYRSVR.E.T.L.Q.T.K.D.T.V..Y..Y..V.sLF..HE..Q.L..LQ.EM..L.SPV.GCRVTNELMQHYLDGV.L.P.R..A.....F....H....C....G....Y....Dn...tTL..N...ALHF...LSSSLST.L.YQ..H.MLKC.....P...-...A.L..A.C...T....G...Q...T...P...A...W...T...Q...F.L...D...TEHKL.D.P...wK.G.T....VKATAEMDL.LLNYLETFL--lq......................
A0A2R8ZE59_PANPA/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..V...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A3M0JG23_HIRRU/10-175              .................................................................lpvllll------.-L.LPGT.AP.A.R..-..---.-AQP..S..CPHF..P.E.L.LPAK.LKELRVKFEEIK.D.Y.F.Q.S.K.D.EdL..S..V..Q..LL..SS..D.L..LE.EF..K.GSL.GCRSVSEMMGFYMEEV.L.P.S..A.....M....R....S....S....A....Q.....HQ..H...SVGD...LGNLLLS.L.RA..M.MRRC.....H...R...F.F..T.C...E....E...S...S...R...S...M...K...N...I.K...E...TFTRM.N.K....N.G.I....YKAMGEFDI.FINYIEKYLTM........................
A0A2I3GRH2_NOMLE/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QAT.QSEN..S..CTHF..P.G.S.LPNM.LRELRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..E...HVNS...LGEKLKA.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A2Y9EEH7_PHYMC/22-174              ..........................................................sarlktlhlgscmi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-TSS.LQAIQSGFSEIQ.D.-.R.Q.P.K.D.E.I..I..DlrI..LR..KT..Q.P..LQ.DT..K.PAG.QCCLLHHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....R.....IL..Q...KISG...LANSFLT.I.KK..D.LWLC.....H...V...H.M..A.C...P....C...G...E...E...A...M...E...KysqL.M...S...HFKEL.Q.P...pA.A.V....VKALGELDI.LLSWME-----em......................
IL10_PANTR/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALXEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..V...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A2Y9DJ85_TRIMA/23-174              ...........................................................vgwktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-STE.LQKIRNEFSEIW.G.S.V.Q.A.E.D.RnI..D..I..R..IL..SS..V.S..LQ.DT..K.PSG.RCCFLRHLQRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLT.V.KR..D.LRLC.....H...D...H.M..T.C...H....C...G...E...E...A...M...E...K...Y.S...E...ILSHF.K.ElepwA.A.V....VEALGELDI.LLQWTE-----et......................
H2N3X2_PONAB/20-175                  ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSELR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...K...K...Y.SqtlS...HFEEL.E.P...qA.A.V....VKALGELDI.LLQWME-----et......................
A0A2U3X0Q0_ODORO/11-183              .........................................lclslvlllwsqvpgvqgqefqfgpcrvegv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---A.LQELWEAFRAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DTE.SCYLLRALLKFYLNTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.AS..K.LQPS.....QekeM...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
I3KT27_ORENI/11-171                  ................................................fllllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....E.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QaN....R.A.A....QKAVGELGT.VLEWLEA----l.......................
A0A2K6A8E1_MANLE/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.AAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A340YH38_LIPVE/18-171              ........................................................csaharglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRRIEESFQGIK.N.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LQRC.....Qe.qR...L.C..H.C...R....Q...E...A..tN...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.LLAWID-----knh.....................
A0A287BFZ9_PIG/11-169                ......llfvtlslaiarrkqssfaescyprgtlsqavdtlyvkaarlkatipedrikniqllkkktkklfm------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.--K.NCRFQEQLLSFFMEDV.F.G.R..L.....Q....L....Q....A....C....K.....ET..D...FV--...--EDFHS.L.RQ..K.LSRC.....I...S...C.A..S.S...P....R...E...M...K...S...I...T...R...M.K...R...IFYGI.G.N....K.G.I....YKAISELDI.LLSWIKQFL--es......................
H9GD92_ANOCA/8-178                   .....................................................................gaf---SCL.VL.VAFL.FA.-.K..T..VVA.EGRR..L..SLGQ..C.E.L.NSVS.FRELRDNFDAIK.E.N.V.Q.T.Q.DiR.T..D..V..I..LL..KE..S.V..LR.EV..P.MSE.SCCLLRHLLRFYVESI.F.K.H..Y.....E....P....T....S....N....L.....LR..R...KTST...LANAFLS.I.KA..K.LREC.....H...N...Q.N..K.C...S....C...G...E...E...T...N...R...R...F.KlvlD...EYQKL.D.K...tT.A.A....IKSLGEMDV.LFAWMEG----f.......................
IL10_HUMAN/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..A...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
#=GR IL10_HUMAN/5-174          SS    .......................................................................X-XXXXX.XX.XXXX.XX.X.X..X..XXX.XXXX..T..TTST..T.T.T.HHHH.HHHHHHHHHHHH.H.H.H.H.H.H.S.S.-..-..S..-..SS..-H..H.H..HH.HH..H.STT.HHHHHHHHHHHHHHTH.H.H.H..H.....H....C....H....-....G....G.....GH..H...HHHH...HHHHHHH.H.HH..H.HHHS.....T...T...T.S..G.G...G....-...-...-...H...H...H...H...H...H.H...H...HHHHT.T.H....H.H.H....HHHHHTHHH.HHHHHHHHHHH........................
K7F6U7_PELSI/4-151                   .....................................................................nrl---SCL.VL.LPFV.F-.-.-..G..GVL.MTES..R..RLRFgaC.E.L.SGVS.FQELRDYFGAIR.G.A.T.Q.T.Q.D.R.M.tD..V..V..LL..KR..V.A..LQ.GV..P.ISE.SCCLLRHLLRFYVESV.F.R.H..Y.....E....A....T....S....S....L.....LR..R...RTSR...LSNSFLS.I.KG..K.LRYC.....H...D...Q.K..K.C...S....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------cgeestsrfqlireeyekv.....
A0A3Q2V2N1_HAPBU/5-177               .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..CSP.MCNN..R..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
IL10_CALJA/5-174                     .......................................................................a-LLCCL.VF.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.S.LPHM.LRELRVAFSRVK.T.F.F.Q.K.K.D.Q.L..D..S..M..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.F.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...V...Q...V.K...N...AVSKL.Q.E....K.G.I....YKAMSEFDI.FIDYIEAYMTM........................
A0A3B4TAT3_SERDU/6-164               .......cslslllvlsclsepvesrtlhldscsvnvhthelrkyystirsdvvslkncfnltcvclhqegq------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.TCCFLHLLLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...L.H...V...AFIKL.QiN....Q.A.A....QKAMGELDT.VLEWLE-----glg.....................
A0A226NI05_CALSU/1-171               .....................................................................mqt---CCQ.AL.LLLL.AA.C.S..L..PAH.CSEP..G..CLHF..S.E.L.LPAR.IRELRVKFEEIK.D.Y.F.Q.S.R.DdE.L..N..I..Q..LL..SS..E.L..LD.EF..K.GTF.GCQSVSEMLRFYTDEV.L.P.R..A.....M....R....T....S....T....S.....HQ..K...SMDD...LGNMLLG.L.KS..M.MRRC.....H...R...F.F..T.C...E....K...R...S...K...A...I...K...Q...I.K...E...TFEKM.D.E....S.G.I....YKAMGEFDI.FINYIEEYL--lm......................
IL19_HUMAN/3-173                     ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....HaA.A....IKSLGELDV.FLAWIN-----knhev...................
#=GR IL19_HUMAN/3-173          SS    ....................................................XXXXXXXXXXXXXXXXXXX-------.--.----.--.-.-..-..---.----..G..GGGS..T.T.T.TSBH.-HHHHHHHHHHH.H.H.H.H.T.T.-.S.-..T..T..-..-T..TG..G.GGSSS.--..S.HHH.HHHHHHHHHHHHHHTH.H.H.H..-.....-....-....-....-....H....H.....HH..H...HHHH...HHHHHHH.H.HH..H.HHHH.....-...-...-.-..-.-...-....-...-...H...HHHHH...H...H...H...H.H...H...HHHHS.-.H....HHH.H....HHHHHTHHH.HHHHHH-----HHS--...................
A0A3P8SDB4_AMPPE/6-173               ..............................................lgcsvslllllicltepvesrilhld------.--.----.--.-.-..-..---.----..-..---S..C.S.V.NVH-.MHELRKYYSGIR.S.N.A.I.S.E.DsE.I..G..V..K..LL..DK..S.L..MK.DV..Q.EGQ.MCCFMRLVLRFYVERV.F.S.N..Y.....A....S....S....H....P....Q.....QQ..R...CSSA...LANSFVS.I.RR..E.IHKC.....H...C...L.C..-.E...E....E...T...Q...R...K...I...D...S...V.H...A...EFIKL.QiS....Q.A.A....QKAVGELDT.VLEWLEGQ---ktq.....................
A0A3Q0D6J5_MESAU/45-219              ........................................tlsclsllllvwnqvpglhghefrfgpcrveg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--VV.LSELWEAFWAVK.N.T.L.Q.T.Q.D.N.I..T..S..V.qLL..KP..Q.V..LQ.DV..S.DAE.SCYLVHSLLKFYLNTV.F.K.N..Y.....H....N....K....I....A....K.....VKilK...SFSS...LANNFIV.I.VS..K.LQPS.....Ke.kD...M.L..S.I...S....E...R..aH...R...R...F...L...L...F.R...R...TFKQMgT.E....A.A.L....VKAVGEVDI.LLTWMQK----fyql....................
A0A0D9QWD9_CHLSB/5-169               ..................cilrcwllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A3Q7UK34_URSAR/10-183              ..........................................llclnlilllwsqapgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFSAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DAE.SCYLIRALLKFYLTTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.VS..K.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
A0A2K5YIE7_MANLE/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
H3A3C0_LATCH/29-176                  ......................hfgacrlfvhfhdlkenfadikhtivsipvllsirrvlrvegprnskfgd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.SCCFLRHLLKFYVEKV.F.K.Q..Y.....P....T....V....D....G....N.....IR..T...KTSS...LANSFLS.I.KT..E.LRKC.....H...E...R.N..M.Cq.cG....E...E...S..rQ...K...I...E...A...I.L...H...AYKNM.D.V....NaA.A....TKAIGELDI.LLEWMEKY---h.......................
H0VDI4_CAVPO/20-172                  ..........................................................vythgfrrclisvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MNQLEESFQEIK.R.A.I.Q.T.K.D.T.F..Q..N..ItiLS..TV..E.T..LQ.SI..K.PVD.VCCVTKNLLEFYMRRV.F.K.D..H.....Q....E....L....K....P....Q.....IL..R...RISS...IANSFLY.M.QK..T.LKQC.....Q...E...Q.R..G.C...Q....C...S...E...E...A...T...N...A...T.R...I...VHDNY.D.Q....L.G.IpsaaIKSLGELNI.FIAWIEK----nhq.....................
A0A0A0AM67_CHAVO/59-168              .....................dlikntrllkkttkmlfmtncsvrdqllsfyvknvfshlgvgsdklyvisa------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...----FQV.L.QA..N.LNAC.....L...P...C.A..P.S...A....R...L...T...S...A...V...K...N...L.K...K...TFLKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A3B4C0D9_PYGNA/7-176               ...............................................................llpslltvl------.--.L--V.ED.T.Q..S..RRV.NCID..S..CCTF..V.E.S.FPLR.LNRLRSSYEKIR.D.Y.Y.E.E.K.D.E.L..D..R..A..LL..NK..T.I..LQkSF..N.SPY.GCHAMNDVLHFYLDTV.L.P.T..A.....I....N....E....N....T...rS.....FK..T...PIDE...IGNIFQE.L.KR..D.LIKC.....R...N...Y.L..G.C...Q....-...K...P...F...E...I...S...S...I.R...D...SYQQM.K.K....K.G.M....YKAMGELDM.LFNYFEKYLA-s.......................
A0A2K5HYL6_COLAP/9-173               .........................................................gllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
M3YET8_MUSPF/20-176                  .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.IidT..R..I..LR..KT..E.S..LQ.DT..K.PTD.QCCLLRHVLRLYLDRV.F.K.N..F.....K....T....P....D....H....R.....IL..R...KTSS...LANSFLT.V.KK..E.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...T...E...KysqI.L...S...HFEEL.T.P....QaA.A....VKALGELDI.LLQWME-----emk.....................
G3S310_GORGO/2-173                   .....................................................klqcvslwllgtimilcsv------.--.----.--.-.-..-..---.--EN..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELNV.FLAWIN-----knhev...................
A0A2K6K4C9_RHIBE/46-209              .........................................................wllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDI.FLAWI------aknhe...................
IL10_PIG/5-170                       .......................................................................a-LLYCL.IF.LAGV.AA.S.-..-..--I.KSEN..S..CIHF..P.T.S.LPHM.LRELRAAFGPVK.S.F.F.Q.T.K.D.Q.M..G..D..L..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEDV.M.P.K..A.....E....S....D....G....E....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...Q...F.L..P.C...E....N...K...S...K...A...V...E...E...V.K...S...AFSKL.Q.E....R.G.V....YKAMGEFDI.FINYIEAYMTM........................
A0A3Q0T4E0_AMPCI/6-171               .............................................scsacllllllsclsepaasrtlhlds------.--.----.--.-.-..-..---.----..-..----..C.-.S.VSVH.THELRKYYSDIR.S.NaI.S.G.D.D.E.I..E..I..K..LL..DR..S.L..MK.NV..Q.EGQ.TCCFLRLVLRFYVERV.F.T.N..Y.....A....S....S....E....P....Q.....HQ..R...CSSA...LANAFVS.I.RR..N.IHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QvN....K.A.A....QKAVGELDT.VLEWMEA----lg......................
A0A3P9AU56_9CICH/12-172              .................................................llllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QaN....R.A.A....QKAVGELDT.VLEWLEA----lg......................
I3LT64_PIG/11-181                    ...........................................clglilllwsqgpgvqgqefqfgpcrveg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--IV.LQELWEAFWDMK.D.V.V.Q.A.Q.D.N.I..T..N..V.rLL..RK..E.V..LQ.NV..S.EAE.SCYLIHSLLKFYLNTI.F.K.N..Y.....R....E....K....A....V....Kf...rIL..R...SFST...LANNFVV.I.MS..K.LQPS.....Qe.nE...M.F..PiS...E....N...A...R...R...R...F...L...L...F.Q...R...EFKQL.DrE....V.A.L....TKAFGEMDI.LLTWMETF---yq......................
L9JBK5_TUPCH/5-174                   .......................................................................a-LLYCL.VF.LAGV.RA.S.P..A..QGI.QSED..S..CTYF..P.A.N.LPNM.LRELRAAFGRVK.T.F.F.Q.T.S.D.Q.L..D..N..M..LL..SE..S.L..LK.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....S....P....D.....VK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFDKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
G1QTG6_NOMLE/6-168                   ....................ilrcglllvtlslaiakhrqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....N.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIK-----klle....................
A0A2K6CPI7_MACNE/5-169               ...................cilrcwllsvtlslaiakhrqssftktchprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2K5NHJ1_CERAT/14-173              ..................................................ilmlcsvdnhgfrrclisidmd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.--HIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
A0A2I3LV89_PAPAN/6-169               ...................ilrcgllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
G1NDA5_MELGA/52-168                  ................lkssvpkdlikntrllkkttkmlfmtncnvrdqllsfymknvfshlgieseklyvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...--SAFRV.L.QE..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...N...I.K...K...TFLKL.G.E....K.G.V....YKAINELDI.LLPWIQAYIQ-t.......................
U3JCS1_FICAL/26-175                  ..........................................................kifhfgacrvflst------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-AEIRAGFTAIK.A.D.V.Q.S.R.D.P.I..R..S..LsiLS..HP..H.S..LH.KV..K.SSD.RCCITHQLFTFYVDKV.F.K.H..C.....R....T....E....D....S....F.....VN..R...KISS...IANSFLS.A.RR..K.LGQC.....R...E...Q.N..N.C...V....C...G...E...E...S...K...E...K...F.K...Q...ILANY.E.GlnvtS.A.A....MKSLGELDI.LLDWME-----ks......................
A0A2K6CGK7_MACNE/40-209              ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...V...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWI------aknhe...................
A0A452C4H7_BALAS/18-174              ..laiarhkqssfaascylrgtlsqavdmlyvkaarlkatipedhvkkvqllkkktkkqfilsylxkngrfq------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-----EQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....N.....KI..H...----...FVEDFHS.L.RQ..K.LSHC.....F...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...KFYEI.G.K....K.G.I....YKAISELDI.LLSWIKQFL--es......................
A0A2U3XRP2_LEPWE/20-176              .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRSGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHILRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LWLC.....H...A...Q.M..T.C...P....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELNI.LLQWME-----emk.....................
IL26_HUMAN/6-168                     ....................ilrcglllvtlslaiakhkqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIK-----klle....................
A0A087WQD7_MOUSE/24-180              .............................................................legqefrfgsc------.--.----.--.-.-..-..---.----..-..----..-.Q.V.TGVV.LPELWEAFWTVK.N.T.V.Q.T.Q.D.D.I..T..S..I.rLL..KP..Q.V..LR.NV..S.GAE.SCYLAHSLLKFYLNTV.F.K.N..Y.....H....S....K....I....A....K.....FKvlR...SFST...LANNFIV.I.MS..Q.LQPSk...dN...S...M.L..P.I...S....E..sA...H...Q...R...F...L...L...F.R...R...AFKQL.DtE....V.A.L....VKAFGEVDI.LLTWMQK----fyh.....................
A0A3Q4H2N1_NEOBR/5-177               .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..SSP.MCNN..R..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
W5P9B3_SHEEP/54-206                  .............................................................efqfgpcqvdg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--IV.LQKLWQAFWAMK.D.I.V.Q.A.Q.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.ETE.SCHLLHALLRFYVNTV.F.K.N..Y.....H....D....K....A....V....Ef...gIL..K...SFST...LANNFFV.I.VS..K.LQAS.....Qe.kM...F.S..T.R...E....S...A...R...R...R...F...L...L...F.Y...R...AFKQL.DrE....A.A.V....TKAFGEMDI.LLRWMEKF---nql.....................
IL10_MOUSE/5-174                     .......................................................................a-LLCCL.LL.LTGM.RI.S.R..G..QYS.REDN..N..CTHF..P.V.G.QSHM.LLELRTAFSQVK.T.F.F.Q.T.K.D.Q.L..D..N..I..LL..TD..S.L..MQ.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.Q..A.....E....K....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RM..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...DFNKL.Q.D....Q.G.V....YKAMNEFDI.FINCIEAYMMI........................
#=GR IL10_MOUSE/5-174          SS    .......................................................................X-XXXXX.XX.XXXX.XX.X.X..X..XXX.XXXX..X..XXXX..X.X.-.-HHH.HHHHHHHHHTTH.H.H.H.H.T.T.-.-.-..S..S..-..SS..-H..H.H..HH.HH..H.STT.HHHHHHHHHHHHHHTH.H.H.H..H.....H....H....C....-....G....G.....GH..H...HHHH...HHHHHHH.H.HH..H.HHHS.....T...T...T.S..G.G...G....-...-...-...H...H...H...H...H...H.H...H...HHHHH.T.H....H.H.H....HHHHHTHHH.HHHHHHHHHHH........................
A0A2K5MK59_CERAT/5-169               ..................cilrcwllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2U4CQJ2_TURTR/59-169              ....................................................drvkkvqllkkktkklfmkn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CRLQEQLLSFFMEDV.F.G.K..L.....Q....L....Q....V....C....K.....EI..-...---H...FVEDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...N...R...M.K...R...KFYEI.G.K....K.G.I....YKAVSELAI.LLSWVKQFL--es......................
A0A3Q7SLT1_VULVU/51-169              ............................................wlkatipedriknvrllrkktknlfmkn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....K....V....C....R.....--..-...EI-R...FVEELHS.L.RQ..Q.LSRC.....I...S...C.A..S.S...A....R...E...M...K...T...I...T...R...M.K...S...TFYGL.G.N....K.G.I....YKAISELNI.LLSWIKQFL--es......................
H3A6W1_LATCH/7-182                   ......................................................................aa--LCLL.VI.IFNTeNA.F.C..R..AEH.SAED..G..CLLF..A.N.A.FPGM.LKELRIAFKKIQ.E.F.F.Q.T.K.DdN.I..D..I..A..LL..DE..D.L..LY.GF..K.DHF.GCQLLKEMLKFYLEEV.L.P.K..A.....Q....D....K....DldiqP....T.....IQ..T...AVSH...IGEMLFN.L.KQ..K.ITLC.....Q...N...F.F..A.C...S....N...K...S...R...A...V...K...R...I.K...E...TYNKL.Q.E....K.G.V....YKAMGELDI.FIDYIEDYL--ia......................
A0A1S3QNL4_SALSA/1-94                .....................................................................mds------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-------ILKFYLDTV.L.P.T..A.....M....Nn.rtQ....N....N....H.....FK..S...PIDS...IGNIFHE.L.KK..E.IVLC.....R...N...Y.F..S.C...K....K...-...P...F...D...I...N...E...F.I...S...SYKKM.Q.D....K.G.L....YKAMGELDL.LFNYIEEYL--vs......................
H0WP49_OTOGA/43-205                  ....................................................sqlpgaqgqefrfgscrvkg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--VA.LQELWKAFWAVK.D.T.V.Q.A.Q.D.N.V..T..S..V.rLL..RR..E.V..LQ.DI..S.DAE.SCHLIHALLKFYLNTV.F.K.N..Y.....H....K....K....I....V....E.....FR..T...TVKSfstLANSFLV.I.KS..Q.LQPS.....E...E...N.E..M.SsirE....S...A...H...R...R...F...L...L...V.Q...R...AFKQL.DiE....A.A.L....TKAFGEVDI.LLSWMEKF---yq......................
Q7SX60_TETNG/5-171                   .....................................................................psi----CL.LF.LALC.CL.T.E..-..-EA.QSQT..L..LVDS..C.-.S.ISAD.LQEMHQHHSNIR.L.N.A.I.T.E.DeE.I..G..V..K..LL..SK..R.L..ME.DV..Q.DGQ.RCCFLRLVLQFYIDKV.F.P.S..Y.....L....S....S....H....P....Q.....NQ..S...SSSS...LANTFIIiV.RK..QmIQKC.....H...C...L.C..E.Q...E....-...T...Q...K...K...V...D...S...L.L...D...AFNKL.EaS....K.A.V....LKAVGELDT.VLQWL------qlfd....................
A0A2U3X0P6_ODORO/20-176              ........................................................tpsaglktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-NTN.LQEMRSGFSEIR.D.S.V.Q.A.K.D.E.I..V..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...L....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P...qA.A.V....VKALGELDI.LLQWME-----emk.....................
A0A3B5A3I5_9TELE/8-169               ...........gcsvslllllvcltepvesrtlhldscsvnvhmhelrkyysdirsnavmfgrcciltfvyl------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.-F..Q.EGQ.RCCFLRLLLRFYVERV.F.S.N..Y.....A....S....S....Q....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...L.-..C.E...E....D...T...Q...R...K...I...D...S...V.H...A...EFDKL.Q.V...gQ.A.A....QKAVGELDT.VLEWLEG----qrtq....................
A0A3M0KA29_HIRRU/43-143              ..........................................................kktlgclitncsvr------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-----DQLLSFYMKNV.F.S.R..L.....E....V....G....S....-....D.....KL..Y...FI--...--SAFQV.L.QA..N.MDAC.....L...P...C.P..P.S...T....R...L...T...S...A...V...K...K...L.R...R...MFIKL.G.D....Q.G.I....YKAIHELDI.LLPWIQAYIQ-ti......................
A0A3B4TAF4_SERDU/6-177               ......................................................................ll--LPIL.VL.LSLL.ST.S.W..C..-SP.MCNN..Q..CCRF..V.E.G.FPVR.LKKLREDYSQIR.D.F.Y.E.A.N.N.D.L..E..T..A..LL..DQ..S.V..ED.SF..K.SPF.GCHAMNSILDFYLSTV.L.P.T..A.....M....A....EvtedT....R....A.....LK..P...HMES...IQQIFDE.L.KS..D.VTKC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...R...N...L.N...S...TYTQM.E.S....K.G.L....YKAMGELDL.LFNYIEIYLA-s.......................
H0YS51_TAEGU/20-175                  .....................................................mptagdrifhfgacrvsis------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MTEIRAGFTAIK.A.N.I.Q.S.R.D.P.I..R..T..LsiLS..HP..H.S..LH.KV..K.SSD.RCCITYQLFTFYVDKV.F.K.H..C.....R....T....E....D....S....F.....VN..R...KISS...IANSFLS.T.RR..K.LGQC.....R...E...Q.N..N.C...L....C...G...E...E...S...T...E...K...F.K...Q...ILANY.E.G....L.N.VtsaaMKSLGELDI.LLDWME-----ks......................
A0A3Q7TJG4_URSAR/21-171              ...........................................................rarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.IHHIEEAFQEIK.K.T.I.Q.A.K.D.P.F..Q..NvtI..LS..TS..E.T..LH.RI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LRQC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...S...NYDQL.E.A....R.SaA....IKSLGELDV.FLAWID-----rnh.....................
A0A0X9Y7I4_9GAMA/10-170              .........................................................gliltltevpgapvg------.--.----.--.-.-..-..---.--QN..T..CNRV..S.Q.R.IPGM.LRELRTEFQTYE.H.L.Y.D.I.-.-.D.T..D..N..L..LL..ES..Y.I..SQ.EF..N.GVL.ACQGVSDLMQFYLHDV.M.P.Q..V.....E....S....Q....N....P....K.....SV..D...LIRP...LKEKLYS.F.RK..I.IRKC.....Y...K...F.L..F.C...E....F...K...N...P...A...T...D...E...V.K...H...KFIQL.G.D....T.G.G....IKAMSEFGV.FLNYLELYL--sn......................
A0A3P9AUR3_9CICH/5-177               .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..CSP.MCNN..R..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
H2N3X4_PONAB/5-174                   .......................................................................a-LLCCL.VL.LTGV.RA.G.S..G..QGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..E...HVNS...LGENLKT.L.ML..T.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...Q...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A091CLJ3_FUKDA/1-138               .....................................................................mhl------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.---LEESFQEIK.R.T.V.Q.T.K.D.T.F..Q..N..I..TI..LSpvE.T..LR.SI..K.PVD.VCCVTKNLLEFYMDRV.F.K.D..H.....Q....E....L....K....P....Q.....IL..R...KISG...IANTFLY.M.QK..T.LQQC.....Qv.qR...R.C..H.C..sE....E...A...T...N...A...T...R...T...V.H...D...NYEQL.E.I...pS.A.A....IKSLGELDV.FLAWID-----rnr.....................
A0A2K6L8U2_RHIBE/5-169               ...................cilrcwlllvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2Y9PR16_DELLE/11-183              ............................................pclslillfwsqgpgvrgqefqfgpcqv------.--.----.--.-.-..-..---.----..-..----..-.-.-.EGVV.LQELWEAFQAMK.D.I.V.Q.A.Q.D.S.I..T..G..V.qLL..RK..E.V..LQ.NA..S.EAE.SCYLIHALLEFYLNTV.F.K.N..Y.....R....D....K....A....V....Ef...rIL..K...SFST...LANNFIV.I.VS..K.LQPS.....QekeM...F.S..I.S...E....S...A...H...R...R...F...L...L...F.Q...R...AFKQL.DrE....A.A.V....TKAFGEVDI.LLTWMENF---yqt.....................
A0A2K6MZD3_RHIBE/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.HSEN..S..CTRF..P.G.N.VPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A384BL61_URSMA/5-174               .......................................................................a-QLCCL.VL.LAGV.GA.S.R..H..HTA.PSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
H2MLV6_ORYLA/6-177                   ..............................................................hllsvlalft------.-L.L---.-A.G.T..S..SSP.ICNN..R..CCRF..V.E.S.FPVR.LRKLRHDFAQIK.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..T.V..ED.SI..K.SEF.ACQTIDSILDFYLKTI.L.P.K..A.....A....A....G....Y....PddtaD.....VK..P...HVLS...IQEIFDQ.L.RT..D.VTQC.....R...N...Y.F..S.C...K....-...K...H...F...E...I...R...N...L.T...A...AYDEM.Q.N....K.G.L....FKAMGELDL.FFNYIESYLA-s.......................
A0A401SGD7_CHIPU/2-128               ...................................................................nsrqr------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.K.D.D.N.L..H..I..T..LL..GG..R.L..HH.GF..K.GRE.GCQFLKEMLNFYLRDV.I.P.A..A.....K....T....H....Q....Q....V.....IN..N...NISK...IGNILSE.L.KE..N.VQNC.....H...K...F.F..N.C...DlcncR...P...S...P...Y...I...E...K...I.Y...K...LYETL.Q.D....K.G.V....YKAIGELNI.FFDWLQKYITM........................
A0A2K5JNU8_COLAP/5-169               ...................cilrcwlllvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
H0Z8K8_TAEGU/52-168                  .............................................lkssvpkdliktsrllkkttkmlfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQLLSFYVKNV.F.S.R..L.....E....V....G....S....-....D.....KL..Y...FI--...--SAFQV.L.QA..N.MDAC.....L...P...C.S..P.S...T....R...L...T...S...A...V...K...K...L.K...R...MFLKL.G.D....Q.G.F....YKAIHELDI.LLPWIQAYIQ-t.......................
F7HHX8_MACMU/20-175                  ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
G3X1M9_SARHA/7-177                   ....................................................slfllvllwstelgaegqev------.--.----.--.-.-..-..---.----..-..HIGH..C.R.V.QRAI.LQELWRAFQAMK.S.T.V.Q.A.L.D.HnT..E..T..R..LL..RQ..E.F..FQ.NA..T.WAE.ICCLNYSLLDFYLSNI.F.N.N..Y.....H....T....K....A....A....El...gIL..R...PFIT...LANNFFV.V.LK..K.LQHC.....K...ErgmF.S..L.S...E....N...S...E...R...K...F...Q...L...F.Q...K...EFTKL.HpE....A.R.L....TKALGEVDI.LLSWME-----kafr....................
E2R7F8_CANLF/25-172                  ............................................................lrrclismdihp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.---VEETFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PSD.VCCMTKNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.HK..A.LQRC.....Q...A...Q.R..Q.ChcrE....A...A...T...N...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.LLAWID-----knhq....................
F7AQ09_ORNAN/9-174                   ............................................lfsfvsllgwrpsagskklplghcsvsv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---D.IQKLRDEFSGIK.A.L.I.Q.S.E.D.E.S..M..N..I.rIL..KR..SeS..LQ.VT..E.PAD.RCCFLRHLFRLYLDRV.F.N.H..Y.....K....T....H....D....S....D.....IL..R...KIST...IANTFLG.V.KR..D.LRLC.....H...D...H.S..T.C...H....C...G...E...E...ArgkF...S...R...V.L...S...HFEKL.DaE....A.A.A....VKALGELDI.LLSWME-----di......................
F6UG76_MONDO/25-175                  ..........................................................lkrlhlgncvlsmn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.YQEMRNEFLEIK.G.Y.V.Q.A.E.DgN.L..D..K..R..IL..KS..SeA..LQ.DT..K.PTE.RCCFFRHLLRFYLDRV.F.K.N..Y.....Q....T....T....N....H....H.....IR..R...KVSS...LANSFLG.I.KK..E.LRLC.....H...D...H.M..I.ChcgE....E...A...K...K...K...Y...T...Q...I.L...S...HFEEL.D.A....QtA.V....VKALGELDI.LLRWIE-----kt......................
IL10_HORSE/5-174                     .......................................................................a-LLCYL.VF.LAGV.GA.S.R..D..RGT.QSEN..S..CTHF..P.T.S.LPHM.LHELRAAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..NG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RV..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
A0A2U9BGH7_SCOMX/55-174              ..............................................................nvegdreigi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..R..LL..DK..S.L..IK.DV..Q.EGQ.VCCFLHLVLRFYVERV.F.S.N..Y.....A....S....S....Q....P....Q.....QQ..R...CSSA...LANAFVS.I.RK..D.IHKC.....H...C...Q.C..G.E...E....T...R...R...K...A...-...D...S...I.H...A...EFIKL.Q.A...sE.A.A....QKAMGELDT.VLDWLE-----glsq....................
H0WP46_OTOGA/14-175                  ...................................................vfyllwtpstglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEIRNGFSEIR.D.S.V.Q.A.K.DgN.M..D..M.rI..LR..RT..G.S..LQ.DT..K.PAG.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISG...LANSFLT.I.KM..D.LRLC.....H...A...H.M..T.C...H....C...G...E...D...A...M...K...KyshI.L...S...HFEEL.E.P....QaA.A....VKALGELDI.LLRWME-----et......................
F6XX01_HORSE/76-245                  .......................................................................a-LLCYL.VF.LAGV.GA.S.R..D..RGT.QSEN..S..CTHF..P.T.S.LPHM.LHELRAAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..NG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RV..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
A0A3Q7RAT1_VULVU/5-175               ......................................................................al-LCCCL.VL.LAGV.GA.S.R..H..QST.LSED..D..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.R..A.....E....N....H....D....P....D.....IK..D...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A384BLZ7_URSMA/10-183              ..........................................llclnlilllwsqapgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFSAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DAE.SCYLIRALLKFYLTTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.VS..K.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
A0A151MAR4_ALLMI/17-176              ....................................................vfaitfsegrklrfgvcelh------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GTS.LLEIKTYFDAIR.G.T.V.Q.D.E.D.R.V.tD..T..V..LL..KK..I.L..LH.NV..P.ALE.SCCLLRHLLRFYVENV.F.R.H..Y.....Q....A....T....N....P....L.....LR..R...KTSS...LSNSFLS.V.KT..T.LRQC.....H...D...Q.K..K.C...T....C...G...A...E...AnrrL...E...L...F.R...E...EYEKL.DhD....T.A.A....IKALGEMDI.LFKWME-----kak.....................
M3WDI9_FELCA/36-169                  ..............................gtlsqavdrlyvkaawlkatipedriknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMDDV.F.G.Q..L.....Q....L....Q....V....C....K.....ER..H...FV--...--EEFHS.L.RQ..Q.LSRC.....I...S...C.A..S.S...A....R...E...M...K...T...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAVSELDI.LLSWIKQFL--es......................
M3ZNG3_XIPMA/4-174                   .......................................................................q-LLSVL.VL.LSSV.FS.A.W..C..IPL.CHD-..Q..CCRF..V.E.E.FPVR.VQRLREDYRRIR.G.F.Y.E.S.N.D.D.L..D..N..A..LL..DQ..S.V..ED.AF..K.SQF.ACEAMNSILEFYLSTV.L.P.T..A.....M....As.vtS....D....T....S.....LK..T...HVES...IQQIFDE.L.KR..D.VHRC.....R...K...V.F..K.C...K....-...K...P...F...D...I...R...S...L.N...S...TYTEM.E.S....K.G.V....FKAMGELDL.LFNYIETYLA-s.......................
IL10_RABIT/5-174                     .......................................................................a-LLCCL.VF.LGGT.GA.S.R..G..QDT.PAEN..S..CIHF..P.G.G.LPHM.LRELRAAFGRVK.T.F.F.Q.S.K.D.Q.L..N..S..M..LL..TE..S.L..LE.DL..K.GYL.GCQALSEMIQFYLKDV.M.P.Q..A.....E....N....H....S....P....A.....IR..E...HVNS...LGENLKT.L.RL..R.LRQC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....E.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A498MSP0_LABRO/513-642             .........................................................ckfiytdfnliresn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.D.M..E..P..-..LL..NE..N.V..QQ.NI..N.SPY.GCHVMNEILRFYLDTI.L.P.T..A.....V....Q....K....S...hL....H.....SK..T...PIDS...IGNIFQD.L.KR..D.MLKC.....K...N...Y.F..S.C...Q....N...P...F...E...-...L...A...S...I.K...N...SYEKM.K.E....K.G.V....SKAMGELDM.LFKYIEQYLA-s.......................
M3YES0_MUSPF/18-183                  ..................................................llcsqgpgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFWAVK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.I..LQ.NV..S.DVE.SCYLIRALLKFYLNTI.F.K.GylG.....K....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.AS..K.LQPSq..enD...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.SaQ....TKAFGEVDI.LLTWMEKF---yqf.....................
F7HZ89_CALJA/49-204                  ........................................................csvdsrsfrrclistd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MHHIEESFQEIK.K.A.I.Q.A.K.D.T.F..P..N..V..TV..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LQQC.....Qe.qR...Q.C..H.C...G....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knhev...................
G7NVB0_MACFA/5-174                   .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A3Q0D7I2_MESAU/17-171              ..................................................lcsahtrslrrclisvdrslie------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-----KSIPEVK.R.V.L.Q.T.K.D.T.F..R..N..V..TI..LS..T.LenLK.SI..K.PVD.VCCVTSHLLTFYRDRV.F.K.D..H.....Q....E....T....S....L....E.....VM..R...QISS...IANSFLY.M.QK..T.LEQC....vH...N...Q.C..Q.C...S....Q...E..aT...N...A...T...R...T...I.L...D...NYDQL.E.A....SsA.A....LKSLGELDI.FLTWID-----enhq....................
A0A3B3XBA4_9TELE/4-159               .......................................................................q-LLSVL.VL.LSSV.FS.A.C..C..SPV.CH-D..Q..CCRF..V.E.E.FPVR.VQRLREDYRRIR.G.F.Y.E.S.N.D.D.F..D..N..A..LL..DQ..S.V..ED.AF..K.SQF.ACEAMNSILEFYLSTV.L.P.T..A.....V....A....Sv.tiD....T....S.....LK..I...HVES...IQQIFDE.L.KR..D.VHRC.....R...K...V.F..K.C...K....K...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------pfdirslnstytevsvwtvltslr
F7FUZ0_MACMU/6-169                   ...................ilrcgllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A3Q2HKM3_HORSE/15-158              .....................................................llqcsvharglrkclistd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.----------VH.R.A.G.E.T.K.D.A.F..Q..N..V..TI..LS..A.LetLH.RI..K.PLD.VCCMTQNLLAFYMDRV.F.K.D..H.....Q....G....L....N....P....Q.....IL..R...KISS...IANSFLS.M.WK..T.LQQC.....Q...R...P.C..H.C...R....Q...E..aT...N...A...T...R...T...I.H...D...NYSQL.E.A....QsA.A....VKSLGELDV.FLAW-------lgkn....................
G1QJ75_NOMLE/12-175                  ................................................savfyllwtpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LH.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....D....Y.....TL..R...KISS...LANSLLS.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A3F2YKG4_SHEVT/7-167               ...................................................iilfcyvilylfsctvasakk------.--.----.--.-.-..-..---.----..-..CDD-..-.V.S.FDYI.LKDLRSEFSKIK.S.F.V.Q.N.N.D.K.E..N..M..M..LL..SQ..S.M..LD.KL..T.SCI.GCKSLSDMIKFYLNDV.L.P.N..A.....E....K....I....E....-....H.....IK..N...KITS...IGEKLKS.L.KE..K.LISC.....D...-...F.L..H.C...E....N...H...D...-...E...I...K...A...V.K...T...IFNKL.K.D....K.G.I....YKAMGEFDI.FINHLEKYI--vk......................
A0A3Q7SM58_VULVU/20-175              .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.V..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...S....C...G...E...E...A...T...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDI.LLQWME-----em......................
A0A2R9A7S0_PANPA/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...S...HFEKL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
IL10_MACNE/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.M...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
IL10_CANLF/5-177                     ......................................................................al-LCCCL.VL.LAGV.GA.S.R..H..QST.LLED..D..CTHF..P.A.S.LPHM.LRELRAAFGRVK.I.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.SYL.GCQALSEMIQFYLEEV.M.P.R..A.....E....N....H....D....P....D.....IK..N...HVNS...LGEKLKT.L.RLrlR.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A402EJI5_9SAUR/8-176               .............................................................sllaftllslv------.--.----.-L.N.K..A..HCQ.LNEG..S..CKHF..A.D.V.LPLK.LRDLRVAFNEIK.D.Y.F.Q.S.RdD.E.L..D..I..I..LL..NE..D.L..LQ.EF..K.EYL.GCQSMAEMIQFYLEDV.L.L.K..A.....S....N....A....S....K....S.....IK..Q...HVDS...LGNMLLH.L.RL..T.LKRC.....H...R...F.L..I.C...E....K...K...S...K...T...I...E...S...I.K...E...TYEKL.Q.E....K.G.M....YKAMGEFDI.FIDYIEQYL--il......................
F1SEZ1_PIG/21-168                    .................................................................psagcvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-TAN.LQGIRNGFSEIR.D.S.V.Q.A.R.D.E.I..I..D..IriLK..KT..Q.S..LQ.DT..K.PAD.QCCLLRHILRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....VL..R...KISR...LANSFLT.I.KK..D.LRLC.....H...A...R.M..T.C...S....C...G...E...E...A...M...E...KygqI.M...S...HFEEL.Q.P....QaA.V....VKALGELDI.LLQWME-----etv.....................
E1BKN5_BOVIN/13-175                  ..................................................avfylfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQGIRSGFSEIR.D.S.V.Q.A.K.D.E.I..I..DvrI..LR..KT..Q.S..LQ.GT..K.PAD.QCCLLHHILRLYLDRV.F.K.N..Y.....Q....P....P....D....H....H.....IF..R...KVSR...LANSLLT.I.KK..D.LQLC.....H...A...H.M..S.C...P....C...G...E...E...A...K...EkysQ...I.L...S...HFEEL.P.P....Q.AvV....VKALGELDI.LLQWME-----ea......................
A0A337S6M0_FELCA/20-138              .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQAMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRRVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRVC.....-...-...-.-..-.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------ltpqaavvkalg............
G3TMF8_LOXAF/5-174                   .......................................................................a-LLCCL.VF.LAGV.GA.S.Q..S..QET.PSEN..S..CTYF..P.G.S.LPNM.LRELRMAFDRVK.T.F.F.Q.K.K.D.Q.L..D..N..M..LL..NK..S.L..LE.DF..K.GYL.GCQALSEMIKFYLEVV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLTT.L.RI..R.LRRC.....H...R...F.L..P.C...E....N...R...S...K...A...V...E...Q...V.K...E...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIESYMTM........................
A0A2K5H9U6_COLAP/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D.iR..I..LR..RT..E.S..LQ.DT..K.PVD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A3Q2HJG7_HORSE/81-247              ..............................................cllaavfclfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.R.V.L.A.E.D.E.I..I..DvrI..LR..KM..V.S..LQ.DT..E.PAG.QCCLLRHVLRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KLSS...LANSFLT.I.KK..D.LRLC.....H...D...R.M..T.C...P....C...W...E...E...A...M...E...KysrI.L...S...HFEEL.K.P....ReA.V....VKALGELDI.LLRWME-----ea......................
F6PQV8_ORNAN/9-169                   ...igllcvalsllvaesrelsiansrchegmmsrsvdnlylkvtrfkasvpedgiknkkllkkktkrlitk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFRDQLLTFYLEDV.F.G.S..-.....-....H....H....L....P....-.....VG..G...EL-R...IVEDFQR.L.KE..V.LNRC.....V...P...C.A..P.S...S....R...E...M...K...P...I...T...K...M.K...E...LFYKL.G.N....K.G.V....YKAIGELDI.LLPWIKSYI--dn......................
D3ZFI7_RAT/21-172                    ...........................................................hiyslrrclvsvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRLLEKSFQEIR.R.T.L.Q.T.K.D.T.F..K..N..V..TI..LS..T.LenLR.SI..K.PVD.VCCVTNNLLTFYRDRV.F.K.D..H.....Q....E....T....S....L....E.....VV..R...RISR...IANSFLH.M.QK..T.LEQCq...vH...R...Q.C..H.C...S....Q...E..aT...N...A...T...R...T...I.H...D...NYNQL.E.V...sS.A.A....LKSLGELNI.FLAWID-----rnhq....................
H2Q105_PANTR/5-174                   .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....D.....IK..V...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
G1QJ45_NOMLE/41-211                  ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STNM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R..iI.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWID-----knhev...................
A0A1S3P8J8_SALSA/6-158               ...................................................................sllls-----V.LL.VAAL.QC.E.H..A..QCR.RAPC..SdrCCSF..I.E.G.FPVR.LKELRTSFSTIR.D.Y.Y.E.A.N.D.E.L..E..T..S..LL..DE..G.I..LH.HL..K.SPV.GCHAMDSILKFYLDTV.L.P.T..A.....M....Nn.rtQ....N....N....H.....FK..S...PIDS...IGNIFHE.L.KK..E.IVLC.....R...N...Y.F..S.C...K....K...-...P...F...D...I...N...E...F.I...S...SYKKM.Q.G....K.G.-....---------.-----------........................
F7B070_CALJA/5-169                   .......................................cilrcglllvtlslaiarhrqssfskscyprgt------.--.----.--.-.-..-..---.----..-..----..-.-.-.LSQA.VDALHTKAAWLK.A.T.I.-.P.E.D.R.I..K..N..I.rLL..KK..N.T..EK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..Q...FV--...--EDFHS.L.RQ..R.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...I.K...R...IYYGI.G.E....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2K5NVU9_CERAT/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A3Q4HFY8_NEOBR/12-172              .................................................llllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QaN....R.A.A....QKAMGELDT.VLEWLEA----lg......................
A0A2I4APV4_9TELE/81-253              .......................................................................v-LLSLL.AV.LSIF.AT.S.R..S..TRV.-CNN..Q..CCRF..V.E.G.FPGR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACQAIGGILGFYLDTV.L.P.T..AvagvsD....D....A....T....R....S.....LK..P...HVES...IQQIFDQ.L.KT..D.VTKC.....R...H...Y.F..S.C...K....N...Q...F...-...D...I...R...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDL.LFNYIETYLA-s.......................
A0A2K5EIU0_AOTNA/5-169               ...................cilrcglllvtlslaiakhrqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..N.T..KK.QF..M.--K.NCKFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..H...F---...-VEDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...I.K...R...IFYGI.G.E....K.G.I....YKAISELDI.LLSWIKKFL--es......................
R0L4A3_ANAPL/52-168                  .............................................lkssvpkdlikntrllkkttkvlfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQVLSFYVKNV.F.S.H..L.....E....V....E....S....E....K.....--..-...--LY...LISAFQV.L.QE..N.MNAC.....L...P...C.A..P.S...T....R...L...T...P...A...V...K...N...I.K...T...TFLKL.G.E....K.G.I....YKAISELDI.LLPWIQAYIQ-t.......................
A0A2R8ZZP4_PANPA/7-162               ............................................................gvcclspvtqen------.--.----.--.-.-..-..---.----..-..-NRL..C.G.N.LPNM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.G.M..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....L.....AA..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A2Y9Q0Q3_DELLE/18-171              ........................................................csaharglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRRMEESFRGIK.N.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...KISS...IANSFLH.M.QK..S.LQQC.....Qe.rR...L.C..H.C...R....Q...E...A..tN...A...T...R...I...I.H...D...NYHQL.E.V....R.SaA....IKSLGELDV.LLAWID-----knh.....................
E2R7E9_CANLF/20-175                  .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.V..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...S....C...G...E...E...A...T...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDI.LLQWME-----em......................
A0A096NBL5_PAPAN/20-175              .......................................................tpstglktlnlgscvia------.--.----.--.-.-..-..---.----..-..----..-.-.-.--TD.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWIE-----et......................
A0A2Y9DJ64_TRIMA/18-168              ........................................................csvharslkrcspsmd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.LNPIKESFQEIK.A.A.I.Q.A.N.D.T.F..K..N..I..IM..L-..S.N..LH.SI..K.PID.ACCVTRELLEFYMKSV.F.K.Y..C.....E....K....L....S....L....H.....IS..R...EVSG...ISNSFFS.L.QR..T.MQPC.....K...E...Q.S..L.C...P....R...S...G...E...AtsaI...R...I...I.I...N...NYDQL.E.V....QsA.A....IKSLGELDV.FIAWID-----kny.....................
A0A2I4APV8_9TELE/6-178               .......................................................................v-LLSLL.AV.LSIF.AT.S.R..S..TRV.-CNN..Q..CCRF..V.E.G.FPGR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPF.ACQAIGGILGFYLDTV.L.P.T..AvagvsD....D....A....T....R....S.....LK..P...HVES...IQQIFDQ.L.KT..D.VTKC.....R...H...Y.F..S.C...K....N...Q...F...-...D...I...R...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDL.LFNYIETYLA-s.......................
A0A1U7TLM7_TARSY/67-228              .........................................................sqvpgaqgqefrfgp------.--.----.--.-.-..-..---.----..-..----..C.Q.V.KGVM.LRELQEAFWAVK.D.T.V.Q.A.Q.D.N.I..T..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLIYAMLKFYLNTV.F.K.N..Y.....H....N....R....T....V....Ef...rIM..K...SSSS...LANNFIV.I.MS..Q.LQPS.....Qe.dE...M.L..S.I..sE....S...A...H...R...R...F...L...L...F.R...G...AFRQL.DiE....A.A.L....IKAFGELDI.LLAWMEKF---yq......................
A0A2J8QVU7_PANTR/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...S...HFEKL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
G1SDF0_RABIT/12-169                  .........................llvtlslaiashkpsfitkncyswdslsqaidtlyvkaaqlketvpe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.S.I..K..N..V.rLL..KK..N.T..KE.LF..-.-LT.NCRFQEQLLSFFMDDV.F.G.Q..L.....Q....F....Q....A....F....N.....ET..D...FV--...--EDFHC.F.RQ..K.LSRC.....I...T...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAIGELDI.LLSWIKKFL--es......................
A0A3P9N7Q2_POERE/52-222              .......................................................................q-LLSVL.VL.LSSV.FS.A.C..C..SPV.CH-D..Q..CCRF..V.E.E.FPVR.VQRLREDYRRIR.G.F.Y.E.S.N.D.D.L..D..K..A..LL..DQ..S.V..ED.AF..K.SHF.ACEAMNSILEFYLSTV.L.P.T..A.....V....A....Sv.tiD....T....T.....LK..T...HVES...IQLIFDE.L.KR..D.VHRC.....R...K...V.F..E.C...K....-...K...P...F...D...I...R...N...L.N...S...TYTEM.E.S....K.G.V....FKAMGELDL.LFNYIETYLA-s.......................
A0A3Q3VWD8_MOLML/6-176               ......................................................................fl--LSVL.LL.LAYF.CT.-.-..T..QSA.RSCS..P..CCSF..M.E.G.FPGR.LRTLREKYLLIQ.T.F.Y.E.A.N.D.D.L..E..V..E..LL..DQ..S.I..QE.TF..R.SPF.ACDAMNSILDFYLRTV.L.P.T..Ala.gvT....Q....N....T....K....K.....LQ..P...HVED...IQHIFYQ.L.KT..D.VTRC.....R...H...H.F..S.C...K....-...K...P...F...D...I...H...A...L.N...S...TYTQM.Q.S....K.G.L....FKAMNELGL.LFNYFENFL--as......................
A0A2K6K4A3_RHIBE/8-173               ........................................................lwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDI.FLAWIA-----knhev...................
G1PXI7_MYOLU/13-171                  ....................................................tafllsaaharglrrcliam------.--.----.--.-.-..-..---.----..-..----..-.-.-.---D.MRHLGESFQHIK.G.T.I.Q.A.K.D.T.F..P..NvtI..LS..TS..G.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...KISS...IANSFLY.M.QK..V.LQQC.....Qe.qR...L.C..H.C...G....Q...E..aA...N...A...T...R...I...I.H...D...NYNQL.E.V....R.SaA....LKSLGELDV.FLAWID-----knh.....................
A0A3Q0SXV4_AMPCI/6-156               .....................................................lsclsepaasrtlhldscs------.--.----.--.-.-..-..---.----..-..----..-.-.-.VSVH.THELRKYYSDIR.S.NaI.S.G.D.D.E.I..E..I..K..LL..DR..S.L..MK.NV..Q.---.TCCFLRLVLRFYVERV.F.T.N..Y.....A....S....S....E....P....Q.....HQ..R...CSSA...LANAFVS.I.RR..N.IHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKV.R.H....-.A.A....QKAVGELDT.VLEWMEA----lg......................
F6NNV9_DANRE/20-184                  .............................................icivlsglwdaaqgrrlhlgsckvnih------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.THELRHHFQYVR.Q.G.M.I.S.G.D.D.H..K..G..I.rLL..RK..D.V..MS.SL..Q.ATE.SCCFLSQLLHFYMDTV.F.I.S..Y.....T....S....S....H....S....L.....HR..R...TTSV...LANSFLS.I.SK..D.LRVC.....H...A...N.A..H.C...Ec.geN...T...R...L...Q...L...K...S...I.Q...T...AYEKLdQ.A....A.G.T....VKAIGELDS.LLEWIESF---qq......................
A0A2U3XRQ7_LEPWE/12-186              .........................................tllclslvlllwsqvpgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFQAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DTE.SCYLIRALLKFYLNTV.F.K.N..S.....L....D....Ka..aD....S....R.....IR..K...SFST...LANNFFV.I.AS..K.LQPS.....QekeM...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFQQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
G1MGH7_AILME/34-207                  ..........................................llclslilllwsqapgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFWAMK.D.I.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..VQ.NV..S.GAE.SCYLIHALLKFYLNTV.F.K.N..Y.....L....D....Ka..aD....S....R.....IR..K...SFST...LANNFFV.I.VS..K.LQPS.....Ke.nE...M.L..S.I..sE....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
M3YEW2_MUSPF/20-171                  .........................................................vhtrglrrclismdi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHIEETFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TP..E.T..LH.SI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....R....N....P....Q.....IL..R...KISS...IANSFLY.M.KK..A.LQRC.....Q...E...Q.R..Q.C...H....C...R...DeatN...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knh.....................
A0A2I3MAF0_PAPAN/25-194              ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWI------aknhe...................
IL10H_EBVB9/7-167                    ........................................................................VTLQCL.VL.L---.--.-.-..-..-YL.APEC..G..GTDQ..C.D.N.FPQM.LRDLRDAFSRVK.T.F.F.Q.T.K.D.E.V..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....E.....AK..D...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...I.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTI........................
#=GR IL10H_EBVB9/7-167         SS    ........................................................................XXXXXX.XX.X---.--.-.-..-..-XX.XXXX..X..XXXX..-.-.S.HHHH.HHHHHHHHHTTH.H.H.H.C.C.C.-.S.S..S..S..-..SS..-H..H.H..HH.HH..H.STT.HHHHHHHHHHHHHHTH.H.H.H..H.....H....H....H....S....G....G.....GH..H...HHHH...HHHHHHH.H.HH..H.HHTS.....T...T...S.-..G.G...G....-...-...-...H...H...H...H...H...H.H...H...HHHTT.H.H....H.H.H....HHHHHTHHH.HHHHHHHHHHT........................
H2Q6F4_PANTR/6-168                   ....................ilrcglllvtlslaiakhkqssftkscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIK-----klle....................
A0A3P8XA83_ESOLU/71-219              ..........................................................ghglhlgacsvnih------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.THELRRHYTEIR.T.A.V.V.A.S.D.S.E..P..G..V.rMI..RG..D.M..MK.SI..P.VKE.CCCFLRLLLNFYVERV.F.I.S..Y.....G....S....S....Q....P....Q.....HR..R...TTSA...LANSFLT.I.NK..D.LNQC.....H...C...Y.C..G.-...E....D...T...R...T...R...M...D...S...I.Q...A...QFAKL.EiQ....H.A.A....IKALGELDS.LLDWLERLIT-h.......................
A0A3P9A3Q1_ESOLU/4-178               ..........................................................lsvllfltlvavlw------.--.---C.EH.A.Q..S..RAV.TCSN..R..CCSF..I.E.G.FPVR.LKELRTAYSNIR.D.Y.Y.E.A.N.D.A.L..E..T..A..LL..DE..S.L..LH.NF..M.SPF.GCHAIDRILKFYLDTV.L.P.T..A.....V....N....N....Nq.thN....D.....LK..S...PIDS...IGNIFHE.L.KK..E.MIQC.....R...N...Y.F..S.C...K....-...K...P...F...D...I...Q...E...L.I...S...SYKKM.E.A....N.G.L....YKAMGELDL.LFNYIEEYL--vs......................
A0A3P8NTJ9_ASTCA/5-177               .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..CSP.MCNN..R..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...N...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
A0A340YFH1_LIPVE/5-174               .......................................................................a-LLCCL.IF.LAGV.AA.S.Q..H..QGT.QAKD..S..CIHF..P.D.S.LPHM.LRELRAAFSSVK.T.F.F.Q.M.N.D.H.L..D..N..S..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....D....H....G....P....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...VFNKL.Q.D....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
G8XT09_9BETA/4-175                   ..................................................................lrsycl--LWCL.VV.I---.--.-.S..S..SKI.RKKV..D..CSFR..T.G.P.FSGM.LQSLRHDYSKVK.T.V.L.H.D.H.D.T.V..H..T..T.sLL..TG..D.L..LD.EM..L.GPR.GCQTTVQLMEKYLSEW.L.P.K..A.....D....Rl.ylY....D....N....Q.....TI..R...TLDR...LGGTLNG.L.MK..D.MVQC.....P...-...M.L..I.C...G....A...P...S...S...A...M...M...G...L.Q...S...RENKL.PgN....A.G.V....YKGLAEIDL.LGNYLELYMS-k.......................
A0A2U3XRN1_LEPWE/21-171              ...........................................................rarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.IHHIEEAFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....R....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LQQC.....Q...E...Q.M..Q.C...H....C...R...D...E...A...T...NatrI...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knh.....................
G1T727_RABIT/23-172                  .............................................................rglrrcpismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRHLQESFQDIQ.R.A.I.Q.A.N.D.T.F..Q..N..I..TI..LS..A.LdsLQ.GI..K.PLD.VCCVTRSLLAFYMDRV.F.K.D..H.....Q....E....P....D....P....H.....IL..R...RISS...IANSFLY.M.QK..T.VQQC.....Q...V...Q.G..R.C...H....C...R...E...E...At.nV...T...Q..iI.H...N...NYNQL.E.A....RvA.A....VKSLGELNV.FLAWIS-----enyq....................
A0A087QPN1_APTFO/2-173               ...................................................................qtcsa-----L.VL.LLLA.AS.TlP..A..RCS.PTEP..S..CLHF..S.E.L.LPAK.LKELRIKFEEIK.D.Y.F.Q.S.K.DdE.L..S..I..Q..LL..SS..E.L..LD.EF..K.GSF.GCQSVSEMMRFYTEEV.L.P.S..A.....M....R....T....S....T....H.....HQ..Q...SMGD...LGNLLLS.L.KA..T.MRRC.....H...R...F.F..M.C...E....K...R...S...K...T...I...K...H...I.K...E...TFNKM.N.E....N.G.I....YKAMGEFDI.FINYIEEYL--lm......................
A0A2K6F5B3_PROCO/50-220              .............................................lslmlllwsqlpevrgqefrfgscrak------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVD.LQELWEAFWAVK.A.S.V.Q.A.Q.D.N.V..T..S..V.rLL..RR..E.V..LQ.DV..S.DAE.SCHLIHALLKFYLNNV.F.K.H..Y.....H....K....R....T....V....E.....FRplK...SFST...LANNFIV.I.KS..Q.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFRQL.DiE....A.A.L....TKAFGEVDI.LLTWMEKF---yql.....................
A0A286X9X1_CAVPO/36-153              ...................................................vtnlqeiqsefseirdsvpsd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....S....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LQLC.....H...T...Y.M..A.C...H....C...G...Q...E...A...A...EthrQ...I.L...S...HFEQL.E.P....QaA.A....VKVLGELDI.LLRWME-----et......................
A0A2Y9Q0P3_DELLE/32-189              ......................................................vfwtpsarlktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTS.LQAIRSGFSEIQ.D.-.R.Q.P.K.D.E.I..I..DlrI..LR..KT..Q.P..LQ.DT..K.PAG.QCCRLRHILRLYLDRV.F.K.N..X.....Q....T....P....D....H....R.....IL..Q...KISG...LANSFLT.I.KK..D.LCLC.....H...A...H.M..T.C...P....S...G...E...E...A...M...E...KysqL.M...S...HFEEL.Q.P....QaA.V....VKALGELDI.LLSWME-----em......................
H2SEY4_TAKRU/6-159                   ............................................slcllflflllccltkparsqtlllnsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VNVN.LEELRKHYYSIR.L.NaI.T.G.D.D.E.I..G..V..K..FL..DK..S.L..IE.DV..Q.DGQ.RCCFLRLVLRFYVERV.F.R.S..Y.....T....S....S....Q....P....Q.....DE..R...ILSS...LANTFII.I.RK..D.MHKC.....H...C...L.-..C.E...E....P...T...Q...K...R...V...D...A...L.H...Q...AFNQV.R.E....Q.K.R....YR-------.-----------tgtss...................
A0A3Q1B1S8_AMPOC/5-173               ..............................................llgcsvslllllicltepvesrtlhl------.--.----.--.-.-..-..---.----..-..--DS..C.S.V.NVH-.MHELRKYYSDIR.S.N.A.I.S.E.DsE.I..G..V..K..LL..DK..S.L..MK.DV..Q.EGQ.MCCFMRLVLRFYVERV.F.S.N..Y.....A....S....S....H....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..E.IHKC.....H...C...L.C..-.E...E....E...T...Q...R...K...I...D...S...V.H...A...EFIKL.QiS....Q.A.A....QKAVGELDT.VLEWLEGQ---ktq.....................
A0A1S2ZQY1_ERIEU/22-173              ...........................................................trglrkclismdi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHIEENFNEIK.K.A.I.Q.A.K.D.T.F..Q..NvtI..LA..TS..E.P..LQ.KV..K.SLD.VCCMTKNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLN.M.QK..M.LQKC.....E...T...R.L..C.Qy.rQ....E...V...T...N...A...T...R...I...I.Q...N...NYNQL.E.V....QsA.A....IKCLGELEV.FLTWID-----kthlqi..................
W5KIM7_ASTMX/44-197                  .............................................................vlcrklhlgtc------.--.----.--.-.-..-..---.----..-..----..-.-.S.LTVH.THELRHHFQQIR.H.S.M.L.T.E.D.S.H..K..G..V.rLL..KV..N.I..MK.NL..Q.ATE.SCCFLRRVLRFYIEKV.F.S.S..Y.....T....S....S....Q....S....L.....HR..R...TTSV...LANSFHS.I.TK..E.LKLC.....H...A...Q.M..H.C...Q....C...S...Q...E...TnlkF...D...A...I.Q...T...NYDKL.E.M...gA.A.S....VKAIGELDS.VLEWLESF---hs......................
A0A093G3V7_DRYPU/1-166               ..........................................................lllllaastlpagg------.--.----.--.-.-..-..--S.APQP..S..RLHF..S.E.L.LPAR.LKELRSKFEEIK.D.Y.F.Q.S.K.DdE.L..S..V..Q..LL..SP..D.L..LD.EF..K.GTF.GCQSVSEMMRFYMEEV.L.P.S..A.....M....R....T....S....T....D.....HQ..Q...SMGD...LGNLLLS.L.KM..T.MRRC.....H...R...F.F..T.C...E....K...R...S...K...T...L...R...H...I.K...E...TFDKM.N.E....Q.G.I....YKAMGEFDI.FINYIEEYL--lm......................
A0A2R9B3D8_PANPA/3-173               ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLEFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KVSS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWIN-----knhev...................
IL10_CHICK/1-171                     .....................................................................mqt---CCQ.AL.LLLL.AA.C.T..L..PAH.CLEP..T..CLHF..S.E.L.LPAR.LRELRVKFEEIK.D.Y.F.Q.S.R.DdE.L..N..I..Q..LL..SS..E.L..LD.EF..K.GTF.GCQSVSEMLRFYTDEV.L.P.R..A.....M....Q....T....S....T....S.....HQ..Q...SMGD...LGNMLLG.L.KA..T.MRRC.....H...R...F.F..T.C...E....K...R...S...K...A...I...K...Q...I.K...E...TFEKM.D.E....N.G.I....YKAMGEFDI.FINYIEEYL--lm......................
A0A1U7R2X3_MESAU/17-172              ..................................................lcsahtrslrrclisvdrslie------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-----KSIPEVK.R.V.L.Q.T.K.D.T.F..R..N..V..TI..LS..T.LenLK.SI..K.PVD.VCCVTSHLLTFYRDRV.F.K.D..H.....Q....E....T....S....L....E.....VM..R...QISS...IANSFLY.M.QK..T.LEQC.....Q...V...H.N..Q.C...Q....C...SqeaT...N...A...T...R...T...I.L...D...NYDQL.E.A....SsA.A....LKSLGELDI.FLTWID-----enhq....................
A0A091CNQ2_FUKDA/5-174               ........................................................................VLLCCL.VL.LAGV.RT.S.Q..G..MGT.QSED..S..CTHF..P.A.G.LPHM.LQELRAAFGKVK.T.F.F.Q.T.K.D.P.L..D..N..T..LL..NQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.K..A.....E....N....H....D....P....S.....VQ..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...Q...Q...V.K...D...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEVYMT-e.......................
H0VDI2_CAVPO/5-174                   .......................................................................a-LLCCL.VL.LAGV.KA.S.Q..G..TNT.QSED..S..CAHF..P.A.G.LPHM.LRELRAAFGRVK.T.F.F.Q.T.Q.D.Q.L..D..N..V..LL..NK..S.L..LE.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.K..A.....E....N....H....D....P....D.....IK..E...HVSS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...TFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMT-r.......................
Q5EFQ8_DANRE/6-175                   .................................................................vilsall------.-T.LLLC.DC.A.Q..S..RRV.ECKT..D..CCSF..V.E.G.FPLR.LRELRSAYKEIQ.K.F.Y.E.S.N.D.D.L..E..P..L..-L..NE..D.I..KH.NI..N.SPY.GCHVMNEILHFYLETI.L.P.T..A.....L....Q....K....N....Pl..kH.....ST..T...PIDS...IGNIFQE.L.KR..D.MVKC.....K...R...Y.F..S.C...Q....N...P...F...-...E...V...N...S...L.K...N...SYEKM.K.E....K.G.V....YKAMGELDL.LFRYIEQYLA-s.......................
A0A401SGE9_CHIPU/31-200              ..............................................................ptifclalsv------.--.----.--.S.I..S..QPP.FAES..K..RLHF..G.QcS.LTAN.LQEIQDYFSEIK.H.I.I.Q.A.E.D.T.I.tD..T..R..FL..TE..S.I..FH.SI..Q.AEE.SCCFLRHLLRFYVETV.F.K.H..H.....T....P....S....S....S....L.....IE..R...RTSS...LANSFLS.I.KR..D.LRQC.....H...A...E.M..K.Ch.cG....E...E...S...R..tM...M...K...K...I.Q...N...TFENL.T.L....R.AaA....VKAIGEIDI.LIEWME-----qdh.....................
M7AZ52_CHEMY/2-173                   .......................................................................k-LLTAL.IF.LALI.AS.I.K..H..ASCqLSEE..S..CTHL..A.N.L.LPLR.LKDLRIAFGEIK.D.Y.F.Q.A.K.DdE.L..D..I..L..LL..KE..D.L..LE.DF..K.GYL.GCQSVSDMIRFYLDEV.L.P.K..A.....I....N....S....S....K....H.....IK..R...SVGS...IGNMLLD.L.RQ..T.LKRC.....H...R...F.F..T.C...E....K...R...S...Q...T...L...K...Q...I.K...E...TYDKL.Q.E....K.G.I....YKAMGEFDI.FINYIEEYLM-m.......................
A0A0A0MQ14_FELCA/5-174               .......................................................................a-LLCFL.VF.LAGV.GA.S.R..H..QST.LSED..N..CTHF..S.V.S.LPHM.LRELRAAFGKVK.T.F.F.Q.T.K.D.E.L..H..S..I..LL..TR..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....E....D....P....D.....IK..Q...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...V...V...E...Q...V.K...S...TFSKL.Q.E....K.G.V....YKAMGEFDI.FINYIEAYMTM........................
H0XVQ9_OTOGA/6-169                   vlrsgllfvtlslaiakqkqssftkscyprgtlsqavdslyikaarlkavipedriknirllkkkakrlfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EI..H...----...FVEDFYS.L.QQ..K.LSCW.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFSKI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2K5S3C9_CEBCA/5-174               .......................................................................a-LLCCL.VF.LTGV.RA.S.P..G..QGT.QSEN..S..CTHF..P.G.S.LPHM.LRELRVAFSRVK.T.F.F.Q.K.K.D.Q.L..D..S..M..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....VK..V...HVNS...LGEKLKT.F.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...A...Q...V.K...D...AVSKL.Q.E....K.G.V....YKAMSEFDI.FIDYIEAYMTM........................
A0A2D1AF31_9GAMA/34-196              ..................................................alplgsrsadsrsvdgqrvpap------.--.----.--.-.-..-..---.----..-..----..Q.N.N.YPGL.LRDLRLGYEGFK.Q.K.V.T.D.S.H.P.D..E..T..L..LG..SS..R.L..AG.DL..K.GPL.RCQALSEMIQFLLQVV.L.P.D..A.....E....N....S....R....Q....D.....LR..S...QFST...LGDRITG.L.RQ..Q.LRRD.....P...T...V.F..P.C...E....S...R...S...D...G...V...S...D...L.R...S...AYTRL.G.S....T.G.A....EKVLSEFDI.FINYIEAYVT-s.......................
G1MGJ4_AILME/5-174                   .......................................................................a-QLCCL.VL.LAGV.GA.S.R..H..HTA.PSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A3B5AN60_9TELE/64-166              ....................................................................qspf------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.ACHTMDNVLNFYLSTV.L.P.K..A.....M....SevteD....T....R....D.....LR..P...HMES...IQQIFDE.L.KS..D.VIKC.....R...K...Y.F..S.C...K....-...K...H...F...D...I...N...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDL.LFNYIETYLA-s.......................
A0A2K6CGL1_MACNE/3-173               ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...V...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
A0A452HGB5_9SAUR/28-123              .......................................skncsvrdqllsfymknvfgglsigsdkvyivs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...---AFQT.L.QE..N.LSNC.....V...S..iF.F..E.K...K....N...Ry.lR...K...D...L...T...L...A.F...R...IYYRL.G.E....K.G.I....YKAISELDI.LLHWIQTYI--et......................
A0A3Q0D2E5_MESAU/5-169               .......................................................................a-LLCCL.LL.LAGV.GP.S.R..G..QYT.QHES..N..CTHF..P.V.S.QTHM.LRELRTAFSQ--.-.-.-.Q.K.K.D.Q.L..D..N..I..LL..TD..S.L..LQ.DF..K.GYL.GCQTLSEMIQFYLVEV.M.P.Q..A.....E....N....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RR..Q.LQRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...D...NFNKL.Q.E....K.G.V....FKAMNEFDI.FINCIEVYMTI........................
A0A2K6S329_SAIBB/5-173               ............................................cvslwllgtmlilcfvdsrslrkclist------.--.----.--.-.-..-..---.----..-..----..-.-.-.--DM.-HHVEESFQEIK.R.A.I.Q.A.K.D.I.F..P..N..V..TI..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.A....R.SaA....IKSLGELDV.FLAWID-----knhev...................
F6UHB0_MONDO/6-170                   .......................................................................m-LLFCL.LF.LTDL.SS.-.-..-..-SS.AAED..N..CSNF..S.I.T.LPNM.LRDLRAAFGKVK.I.Y.F.Q.K.R.D.K.L..E..T..R..LI..DR..S.L..LE.DL..K.SYL.GCQALSQMIKFYLEKV.M.P.Q..A.....E....N....E....E....-....G.....VK..E...KVGS...LGDKLQI.L.RL..R.LKRC.....H...R...F.L..P.C...E....D...E...S...K...V...V...N...R...V.K...D...TYEKL.Q.E....Q.G.V....YKAMGDFDI.FINYMEEYLTM........................
A0A1S3F834_DIPOR/5-174               .......................................................................a-LLCCL.VL.LARV.VV.S.Q..G..EDT.QSEN..N..CTLF..P.A.G.LPHM.LRELRAAFGRVK.T.Y.F.Q.T.R.D.Q.L..D..S..M..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLLEV.M.P.Q..A.....E....N....Q....G....P....D.....IM..E...HVNS...LGEKLKV.L.RS..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTM........................
A0A3B4WT03_SERLL/4-170               ............................................llscslslllvlsclsepvesrtlhlds------.--.----.--.-.-..-..---.----..-..----..C.-.S.VNVH.THELRKYYSTIR.S.D.V.L.AgD.N.E.I..G..V..K..LL..DK..S.L..IK.DV..Q.EGQ.TCCFLHLLLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...H.C..-.R...E....E...T...Q...R...T...I...D...S...L.H...V...AFIKL.QiN....Q.A.A....QKAMGELDT.VLEWLE-----glg.....................
A0A1U7S5S6_ALLSI/5-173               .....................................................................taf---ASL.VL.LAS-.-L.Q.R..A..SCL.LPEE..S..CTQV..G.D.S.LLRR.LNALRTEFNQVK.N.F.F.Q.D.K.DdE.L..D..I..L..LL..QD..E.L..LK.DF..Q.GQL.GCQSVSEMIQFYLEEV.L.P.K..A.....E....G....S....D....Q....S.....IE..R...HVDT...IGNKLLD.L.RH..T.LKRC.....H...R...F.L..P.C...E....K...R...S...Q...T...V...K...Q...I.K...E...TYKTL.H.K....K.G.M....YKAMGEFDI.FIDYIEEYLM-m.......................
Q6TVJ3_ORFSA/6-183                   ...............................................ilvcvviiltytlytdaycveykes------.--.----.--.-.-..-..EED.RQQC..S..SSSF..P.A.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..N..S..M..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...R...VFNML.Q.E....R.G.V....YKAMSEFDI.FINYIESYMTT........................
A0A2U3X0Z3_ODORO/21-171              ...........................................................rarglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.IHDIEEAFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCMTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LQQC.....Q...E...Q.M..Q.C...H....C...RdetT...N...A...T...R...I...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDI.FLAWID-----knn.....................
A0A3B3ZBA4_9GOBI/8-180               ........................................................iissllavflvlarqv------.--.----.--.-.-..Q..GNP.TCNN..Q..CCRF..V.E.G.FPLR.LRKLREDYSQIR.D.Y.Y.E.A.N.D.E.L..D..T..V..LL..DD..S.V..EH.SF..N.SPF.ACQAMDGILGFYLRTV.L.P.S..Ala.vaT....E....D....A....R....T.....LR..P...YMES...IQQIFDE.L.KR..E.VTKC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...R...N...L.N...S...TYTQM.E.S....K.G.L....FKAMGELDI.LFNYFEKYLA-s.......................
K7GEX7_PELSI/57-167                  .....................kdliknrrllkkatkklfmkncsvrdqllsfyvknvfgglrsgsdrvymvs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...---AFQT.L.QE..N.LSNC.....L...P...C.A..P.S...S....R...V...T...M...A...V...K...K...I.K...Q...MFDKL.G.E....K.G.I....YKAISELDI.LLPWIQTYI--et......................
U3J7J1_ANAPP/5-175                   .......................................................hlllclysvtcwlslmp------.--.----.--.-.-..-..---.AAEN..K..IFHF.gP.C.R.ISMS.VTEIRSGFTAIK.A.N.I.Q.A.R.D.P.I..R..T..LsiLS..HP..Q.S..LH.KV..K.SSD.RCCIIHNLFNFYMDKV.F.K.H..C.....Q....T....E....D....S....Y.....IN..R...KISS...IANSFLS.I.KR..K.LEQC.....H...N...Q.N..K.C...L....C...G...Q...E...S...T...E...K...F.K...Q...ILANY.E.G....L.N.ItsaaIKSLGELDI.LLDWME-----ks......................
A0A226PYE4_COLVI/1-171               .....................................................................mqt---CCQ.AL.LLLL.AA.C.S..L..PAH.CSEP..G..CLHF..S.E.L.LPAR.IRELRVKFEEIK.D.Y.F.Q.S.R.DdE.L..N..I..Q..LL..SS..E.L..LD.EF..K.GTF.GCQSVSEMLRFYTDEV.L.P.R..A.....M....R....T....S....T....S.....HQ..K...SMDD...LGNMLLG.L.KS..M.MRRC.....H...R...F.F..T.C...E....K...R...S...K...A...I...K...Q...I.K...E...TFEKM.D.E....S.G.I....YKAMGEFDI.FINYIEEYL--lm......................
A0A2K5S2W6_CEBCA/6-169               ....................ilrcglllvtlslaiakhrqssfskscyprgtlsqavdalyikaawlkatip------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.E.D.R.I..K..N..I.rLL..KK..N.T..KK.QF..M.--K.NCQFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....D....C....K.....KI..H...F---...-VEDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...I.K...R...IFYGI.G.E....K.G.I....YKAISELDI.LLSWIKKFL--es......................
G3X1C2_SARHA/24-174                  ...........................................................agslrrclismdi------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-HHMEKSFQGIK.T.A.V.Q.A.K.D.S.F..Q..N..I..TIlsAS..E.T..LY.NI..T.SSD.VCCMTKDVLQFYVDKV.F.R.N..H.....E....E....S....D....P....R.....IQ..R...GLST...IANSFLH.I.RN..A.LEQC.....R...S...Q.K..N.C...Y....C...R...K...E...T...T...S...KfqlI.V...R...NYEQM.E.V....K.AaA....IKSLGELDI.LLSWIS-----rnyq....................
A0A060YRF1_ONCMY/65-164              .............................................................avrkqslnwav------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.C.F.L.QeA.N.D.E.L..E..T..S..LL..DE..G.I..LH.HL..K.SPV.GCHAMDSILKFYLDTV.L.P.T..A.....M....N....NrtqnN....N....D.....FK..S...PIDS...IGNIFHE.L.KK..E.IVQC....xX...R...F.I..P.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------lsls....................
A0A2Y9EEH6_PHYMC/5-174               .......................................................................a-LLCCL.IF.LAGV.AA.S.Q..H..QGT.QSKD..G..CIHF..P.N.S.LPHM.LRELRAAFSNVK.T.F.F.Q.M.N.D.Q.V..D..T..S..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....D....H....G....P....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...VFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
G3RBT0_GORGO/20-175                  ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..I.rI..LR..RT..E.S..LQ.DT..K.PAN.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...S...HFEKL.E.P....HaA.V....VKALGELDI.LLQWME-----et......................
A0A452Q7Y8_URSAM/5-174               .......................................................................a-QLCCL.VL.LAGV.GA.S.R..H..HTA.PSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A3B4GN67_9CICH/12-160              .................................................llllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.C..-.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKV.R.-....-.-.-....---------.-----------htikskmtscl.............
A0A2Y9PUU1_DELLE/5-174               .......................................................................a-LLCCL.IF.LARV.AA.G.Q..H..QGT.QAKD..S..CIHF..P.D.S.LPHM.LRELRAAFSSVK.T.F.F.Q.M.N.D.Q.L..D..N..S..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....D....H....G....P....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...VFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
G1PXI8_MYOLU/10-174                  ..............................................lllavfslfwtpsaglktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEMQTEFSQIR.D.R.M.Q.A.E.D.E.I..M..D..L.rIL..KT..E.S..SQ.DT..K.PAD.QCCLLRHILRLYLGMV.F.K.N..Y.....Q....T....S....N....K....L.....IL..Q...KLSS...LANSFLT.I.KK..D.LRLC.....H...A...R.M..T.C...P....C...G...E...E...A...M...E...K...F.NqilS...RFEEL.KlQ....E.A.V....VKALGELDI.LLQW-------mgem....................
A0A2K5MM70_CERAT/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A3Q3FBB0_9LABR/5-177               ...................................................................sllls----IL.LL.L-SF.FS.T.M..S..CSP.MCNN..Q..CCRF..V.E.N.FPVR.LRKLRQDYSQIR.D.F.F.E.A.N.D.D.L..D..E..A..LL..DQ..S.V..ED.SF..K.SEF.ACHAINSILDFYLGTV.L.P.T..Ala.gvT....D....E....T....R....G.....LK..P...HMES...IQQIFDA.L.KG..D.VTKC.....R...H...Y.F..S.C...K....T...Q...F...-...D...I...K...H...L.N...S...TYTQM.E.S....K.G.L....YKAMGELDL.LFNYIEAYLA-s.......................
G1NYG4_MYOLU/11-167                  .....llfatlslaiakhkqssfakschprgtlsqavdmlyvktarlkatipedsiknirllkkkskklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....V....-....-....-....-.....-R..K...EIQ-...FVEEFHS.L.RQ..K.LSRC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...TFYGI.G.N....R.G.I....YKAINELDI.LLSWIKQFL--en......................
A0A2K6F2M2_PROCO/5-174               .......................................................................a-LLCCL.VF.LAGV.GA.S.Q..D..QSI.QSEN..S..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.T.K.D.Q.L..D..N..M..LL..NE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A4D9ED44_9SAUR/217-308             ........................................kncsvrdqllsfyvknvfgglgigsdkvyivs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...---AFQT.L.QE..N.LSSC.....L...P...C.A..P.T...T....R...V...T...T...A...V...K...K...I.K...K...MFDKL.G.E....K.G.I....YKAIGELDI.LLPWIQTYI--et......................
A0A068EGM0_9POXV/3-172               ......................................................clrfivlivaifpinila------.--.----.--.-.-..N..KIS.SDTN..S..CDHK..KrH.R.IPSL.IKELDGKFKEVK.D.Y.F.Q.S.R.D.H.D..L..S..T..ML..LI..D.L..TS.TL..K.GPC.GCRTLDKLLTRYMLVT.S.N.T..I.....P....Y....I....P....Q....D.....ME..S...KVHD...IVNCLNS.L.QH..I.MEEC.....Y...-...-.Y..I.C...R....G...Y...D...T...P...I...N...N...I.N...N...YYSKM.G.V....N.A.T....NKVMGEFDI.LLDGIR-----dlla....................
A0A3Q7RBZ0_VULVU/25-171              ............................................................lrrclismdihp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.---VEETFQEIK.K.T.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PSD.VCCMTKNLLAFYVDRV.F.K.D..H.....Q....E....L....D....P....Q.....IL..R...KISS...IANSFLY.M.HK..A.LQRC.....Q...A...Q.R..Q.ChcrE....A...A...T...N...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.LLAWID-----knh.....................
A0A452Q8D9_URSAM/30-202              ..........................................llclnlilllwsqapgvqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFSAMK.D.-.I.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.NV..S.DAE.SCYLIRALLKFYLTTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.VS..K.LQPSq..enE...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---yqf.....................
A0A2K5CHZ3_AOTNA/40-210              ................................................lqcvslwllgimliscsvdsrslr------.--.----.--.-.-..-..---.----..-..---R..C.L.I.STDM.-HHLEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knhev...................
F7HHY0_MACMU/3-173                   ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViR...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
A0A2Y9DIE0_TRIMA/5-174               .......................................................................a-LLCCL.VF.LAGV.GA.S.Q..S..QDP.QSEN..S..CTYF..P.H.S.LPHM.LRELRMAFNRVK.T.F.F.Q.T.K.D.Q.L..D..N..M..LL..NK..S.L..LE.DF..K.GYL.GCQALSEMIKFYLEVV.M.P.K..A.....E....N....H....G....P....N.....IK..E...HVNS...LGEKLTT.L.RA..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFDKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
E1BCI0_BOVIN/20-170                  ..........................................................vharglrrclismn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.LHRVEESFRGIK.T.A.I.Q.A.K.D.T.F..Q..N..VtiLS..PS..E.T..LH.GI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IM..R...KISS...LANSFLY.M.QK..T.LQQC.....Q...N...L.C..H.C...R....Q...E...A..tN...A...T...R...I...I.H...D...NYDQL.E.V....R.SaA....VKSLGELDV.FLAWIDK----hhr.....................
A0A2Y9JXT5_ENHLU/20-176              .........................................................tpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.IidT..R..I..LR..KT..E.S..LQ.DT..K.PTD.QCCLLRHVLRLYLDRV.F.K.N..F.....K....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..E.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...T...E...KysqI.L...S...HFEEL.MpQ....A.A.V....VKALGELDI.LLQWME-----emk.....................
A0A2K5SIF5_CEBCA/55-211              .......................................................lcfvdsrslrkclistd------.--.----.--.-.-..-..---.----..-..----..-.-.-.---M.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knhev...................
A0A1L8H749_XENLA/2-173               ........................................................valsalvstvlvcilm------.--.----.--.-.-..M..KIK.IIES..S..GHHC..P.V.S.LD--.IQEFKKYHESVK.E.V.L.H.K.K.D.V.I..T..D..V.sLL..KA..K.V..LN.QI..H.PSE.QCCFLLKLGRFYMNNI.F.P.K..L.....E....I....S....S....I....K.....EQ..K...GLNH...LANSVLG.L.KI..E.LKHC.....H...S...S.MrcP.C...G....D...Q...S..hK...I...M...E...D...F.R...E...TFYQM.EtE....A.A.I....IKAIGDLNI.LIRWLEK----nyq.....................
I3RLF3_ANHV1/7-163                   .....................................................vvllclvfdaaqsaaqcrk------.--.----.--.-.-..-..---.----..-..----..-.G.T.ITSR.LKMLRTAFEKVR.E.F.Y.E.D.S.D.E.E..E..T..A..LA..S-..-.-..TE.HL..H.GPE.SCSVIDELITHYTKCV.I.P.A..A.....N....E....E....E....G....A.....DL..L...SLDT...LQVALEN.V.KG..L.LANC.....Q...E...E.F..G.C...K....P...Pf.sM...R...D...Y...K...K...Q.Y...R...QLNKE.K.N....A.G.M....IKAMGELGM.LFNGIEE----rvi.....................
A0A383Z9A0_BALAS/13-171              ...................................................amiflcsaharglrrcvisld------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRRIEESFRGIK.N.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....S....P....Q.....IL..R...RISS...IANSFLY.M.QK..T.LQQC.....Qe.qR...L.C..H.C...S....Q...E...A...T..nA...T...R...I...I.H...D...YYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knh.....................
A0A1S3LFA1_SALSA/1-173               ...................................................................lllsl------.LL.AAAL.QC.E.H..A..QCR.RAPC..SdrCCSF..I.E.G.FPVR.LKELRTAFSTIR.D.Y.Y.E.A.N.D.E.L..E..T..P..LL..DK..G.I..LD.HI..K.SPV.GCHTMDSILKFYLNTV.L.P.N..A.....M....N....N....N....Ng.thN.....FK..S...PIDS...IGNIFHE.L.KK..E.IVQC.....R...N...Y.F..S.C...K....-...K...P...F...D...I...N...N...F.I...S...SYKKM.Q.D....K.G.L....YKAMGELDL.LFNYIEEYL--vs......................
A0A2K6UBE9_SAIBB/32-204              ......................................aliclsllllwsqvpgaqgqkfqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.M.Q.A.Q.D.N.I..T..S..V.rLL..RQ..E.V..LQ.NV..S.AAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFIL.I.VS..Q.LQPS.....K...EnemF.A..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKEL.DmE....A.A.L....TKALGEVDV.LLTWMQ-----kfyk....................
W5N369_LEPOC/6-177                   .................................................lstllfllsallventqikknvc------.--.----.--.-.-..-..---.--WD..N..CCLF..I.E.N.FPVR.LKELRTAFSQIR.D.Y.Y.E.A.S.D.E.L.iD..T..A..LL..DE..A.L..LE.EL..H.SPF.GCHAMKEVLRFYLDLV.L.P.A..A....vK....D....K....G....N....D.....FK..H...PLDS...IGNIFID.L.KA..N.LNRC.....R...R...Y.F..S.C...K....-...K...T...F...E...I...E...N...I.T...N...EYRKM.E.G....K.G.L....YKAMGELDL.LFNYIEEYL--vr......................
A0A1U7QIX2_MESAU/5-174               .......................................................................a-LLCCL.LL.LAGV.GP.S.R..G..QYT.QHES..N..CTHF..P.V.S.QTHM.LRELRTAFSQVK.T.F.F.Q.K.K.D.Q.L..D..N..I..LL..TD..S.L..LQ.DF..K.GYL.GCQTLSEMIQFYLVEV.M.P.Q..A.....E....N....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RR..Q.LQRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...D...NFNKL.Q.E....K.G.V....FKAMNEFDI.FINCIEVYMTI........................
A0A3Q2V2E0_HAPBU/12-172              .................................................llllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QaN....R.A.A....QKAVGELDT.VLEWLEA----lg......................
A0A3B3DUQ1_ORYME/6-177               .......................................................................h-LLCVL.VL.L-SV.LA.E.T..L..STP.ICNN..Q..CCRF..V.E.G.FPAR.LRELRVSFLHIR.D.F.Y.T.A.N.D.D.L..D..S..A..LL..DQ..T.V..ED.SI..K.SDF.ACQTIDSILGFYLSTI.L.P.K..A.....AasatD....D....T....A....N.....LK..P...HVES...IQEIFDQ.L.KS..D.VTQC.....R...H...Y.F..S.C...K....-...K...H...F...D...I...S...N...L.T...S...TYNKM.A.N....K.G.L....FKAMGELDL.FFNYIESYLA-s.......................
A0A3P8V1L5_CYNSE/13-178              ..llccslalllvlsclkdvksraiplsscsvnvhtqelqkyysdirsdllagdneigtrtytdvftrlhqe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.GQM.-CCFMHLLMRFYIERV.F.S.S..Y.....T....S....P....Q....P....I.....NQ..R...CSSA...LANAFVT.I.KR..D.IHKC.....H...C...H.C..G.-...E....E...T...H...R...K...I...D...S...I.H...A...EFTKL.QvD....T.A.A....RKAMGELNV.VLEWLE-----glg.....................
A0A3Q1MVU8_BOVIN/6-156               .......................................................................a-LLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CIHL..P.T.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..H..S..L..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...R...VFSEV.-.-....-.-.-....---------.-----------rlgcwq..................
A0A3Q2CF46_CYPVA/5-178               .......................................................................s-LLLCV.LL.LLSV.FQ.F.R..R..CVP.VCNN..Q..CCRF..V.E.E.FPVR.AKKLRQDYKQIR.D.F.Y.E.A.N.D.D.L..D..K..A..LL..DQ..S.V..ED.SL..NpSPF.ACQAMNSILDFYLRTV.L.P.T..Ava.gvT....E....E....T....T....D.....LK..P...HVES...IQQIFDE.L.KS..D.VTRC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...K...N...L.N...Q...TYTQM.E.N....K.G.M....FKAMGELDV.LVNYIEMYLA-s.......................
I3M4J5_ICTTR/19-171                  .........................................................svytrslrrcpisvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRHLEESFQEIK.R.A.I.Q.T.K.D.N.F..Q..N..V..TI..LS..T.LgaLQ.NT..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....S....D....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LQQC.....Qv.qR...Q.C..R.C...S....Q...E..aT...N...A...T...K...I...I.H...D...NYDQL.E.V...pS.A.A....VKSLGELNV.FLAWI------gknh....................
M3W5Z2_FELCA/20-171                  ..........................................................vhargprrclvsmd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRHVVESFQEIK.K.A.I.Q.A.K.D.T.F..Q..NvtI..LS..TS..E.T..LH.RI..K.PLD.VCCVTKNLLAFYVDKV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KLSS...IANFFLY.M.QK..A.LQPC.....Q...K...Q.R..Q.ChcrE....E...A...T...N...A...T...R...I...V.H...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWL------dknh....................
W5P8Y9_SHEEP/16-172                  ......................................................lflcsaharglrrclist------.--.----.--.-.-..-..---.----..-..----..-.-.-.---N.LHRMEESFRGIK.T.A.I.Q.A.K.D.T.F..Q..N..VtiLS..PS..E.T..LH.GI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IM..R...KISS...LANSFLY.M.QK..T.LQQC.....Q...Q...K.L.cH.C...R....Q...E...A..tN...A...T...R...I...I.H...D...NYDQL.E.V....R.AaA....VKSLGELDV.FLAWIDK----hhq.....................
A0A2D0PJY5_ICTPU/48-218              ..............................................................lllslltvll------.--.---L.RA.A.Q..C..TKI.ICKD..S..CCSF..V.E.G.FPVR.LKALRSSYAVIR.D.Y.Y.E.G.K.D.D.L..D..T..S..LF..NR..T.V..LD.HF..K.TPY.GCSVMNDILHFYLETV.L.P.N..A.....I....Sg.hmN....G....K....N.....FR..T...PIDT...IGSLFQE.L.KR..E.LVKC.....R...S...Y.F..T.C...R....-...K...P...F...E...I...S...S...V.K...N...SYHQM.G.G....K.G.L....YKAMGELDM.LFNYIEDYV--as......................
A0A2K5SIF2_CEBCA/17-173              .......................................................lcfvdsrslrkclistd------.--.----.--.-.-..-..---.----..-..----..-.-.-.---M.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knhev...................
U3JCS4_FICAL/12-178                  ......................................................illlllllllllgstaha------.--.----.--.-.-..-..---.--LP..S..CSHF..P.Q.L.LPAR.LKEIRVKFEEIK.D.Y.F.Q.S.K.DdD.L..S..T..Q..LL..SS..D.L..LE.EF..K.GSL.GCQSVSELMEFYMEEV.L.P.S..A.....M....S....S....S....S....Q.....HQ..H...SVGD...LGNLLLS.L.RA..V.MRRC.....H...R...S.F..T.C...E....E...R...S...T...S...M...K...H...I.K...E...NFSKM.S.R....N.G.I....YKAMGEFDI.FINYIEKYLTM........................
A0A218UJX2_9PASE/6-171               ...................................................................tavpi-----L.LL.LLGI.AP.A.R..A..Q--.---P..S..CLHF..P.E.L.LPAK.LKELRLKFEEIK.D.Y.F.Q.S.K.D.DdL..S..I..Q..LL..SS..D.L..LE.EI..K.GRI.GCQSVSEMMGFYMEKV.L.P.S..A.....I....R....T....S....T....E.....HQ..H...SMGD...LGNLLLS.L.RA..M.MRRC.....H...R...F.F..T.C...E....E...R...S...R...S...M...E...H...I.K...E...TFSRM.D.K....N.G.I....YKAMGEFDI.FINYIEKYLTM........................
A0A3Q3LQH8_9TELE/58-229              ......................................................................ll--LSVL.VL.LSFF.ST.A.W..-..CTP.MCNS..H..CCRF..V.D.N.FPVR.LRKLRANYSKIR.D.F.Y.E.A.N.N.D.L..E..T..A..LL..DQ..S.I..EE.SL..K.TPF.ACHAISSILNFYLSTV.L.P.T..Ama.gvT....E....D....T....K....N.....LK..P...HMEA...IQHIFDE.V.KC..D.VIKC.....R...N...Y.F..S.C...K....N...H...F...-...D...I...K...N...L.N...A...TYTQM.Q.S....K.G.L....YKAVSELDV.LFNYIETYLA-s.......................
Q6TV62_9POXV/21-185                  ........................................................snsyctmcstgvcken------.--.----.--.-.-..-..--P.HQKQ..E..CENT..G.H.Q.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..H..S..L..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...R...VFSEL.Q.E....R.G.V....YKAMSEFDI.FINYIETYM--........................
A0A2K6MR47_RHIBE/20-175              ........................................................tpstglktlnlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.D.G.N..T..D..IriLR..RT..E.S..LQ.DT..K.PGD.QCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....Y.....TL..R...KISS...LANSFLT.I.KK..E.LRLC.....H...A...H.M..T.C...H....C...G...E...E...A...M...KkygQ...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A2Y9JTL2_ENHLU/20-183              ...................................................csqapgvqgqefqfgpcrveg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--VV.LQELWEAFWAMK.D.I.V.V.T.K.D.N.I..T..S..V.rLL..RK..E.I..LQ.NV..S.DVE.SCYLIRALLKFYLNTV.F.K.N..Yl...dK....A....A....D....S....R.....IR..K...SFST...LANNFFV.I.AS..K.LQPSq..enD...M...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.SaQ....TKAFGEVDI.LLTWMEKF---yqf.....................
A0A3B3RN78_9TELE/7-171               .......................................................tflsffiiavvfdssan------.--.----.--.-.-..-..---.--CI..H..CDKF..V.E.G.FPAK.LKELRKTFSRIK.N.Y.Y.E.A.N.D.N.T..D..T..A..LL..DD..T.I..LQ.DF..K.SPS.GCHAMNDILRFYLDTV.L.P.T..A.....A....T....K....A....P....R.....LH..T..pDISI...ISGIFSG.L.KK..D.VIAC.....K...K...Y.F..S.C...K....-...K...P...F...S...L...E...I...I.T...S...TYKNM.N.V....D.G.L....YKAMGELDL.LFNYIEEYL--vs......................
I3KT29_ORENI/6-178                   .......................................................................t-VLLCV.LA.LASF.FS.S.A..L..CSP.MCNN..H..CCRF..V.E.G.FPVR.LKKLRQDYSRIR.D.F.Y.E.A.N.D.D.L..D..S..A..LL..DQ..S.V..ED.SF..K.SPF.ACYAMNSLLEFYLDTV.L.P.T..A.....M....AgvteE....I....K....D.....LK..P...HVES...IQEIFNT.L.KR..D.VTQC.....R...K...Y.F..S.C...K....-...K...Q...F...D...I...N...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
IL10_MACFA/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A2U3XRM4_LEPWE/21-136              ..........................................................psaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRSGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHILRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LWLC.....-...-...-.-..-.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------ltpqaavvka..............
M3WJJ2_FELCA/12-176                  .................................................savfylfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQAMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRRVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRVC.....H...A...H.M..T.C...P....C...G...E...E...A...V...E...KysqI.L...S...HFEEL.T.P...qA.A.V....VKALGELDI.LLQWME-----ela.....................
IL10_RAT/5-174                       .......................................................................a-LLCCL.LL.LAGV.KT.S.K..G..HSI.RGDN..N..CTHF..P.V.S.QTHM.LRELRAAFSQVK.T.F.F.Q.K.K.D.Q.L..D..N..I..LL..TD..S.L..LQ.DF..K.GYL.GCQALSEMIKFYLVEV.M.P.Q..A.....E....N....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.WI..Q.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...DFNKL.Q.D....K.G.V....YKAMNEFDI.FINCIEAYVT-l.......................
A0A2D0TB63_ICTPU/4-176               ..........................................sltcilaicallasiwgsamgrrlhlgsca------.--.----.--.-.-..-..---.----..-..----..-.-.-.LTVH.THELRHHFEQIR.H.N.M.I.T.R.D.N.H..K..G..V.rLL..RG..D.M..MK.SL..Q.ATD.SCCFLRQLLRFYIEKV.F.S.G..Y.....T....S....S....Q....S....L.....HQ..R...TTSV...LANSFLS.M.TK..D.LRAC.....H...A...Q.M..L.C...Q....C...S...Q...E...TnlkF...D...A...I.Q...E...TYDKL.E.V...gA.A.S....VKAIGELDS.LLEWLESFHT-k.......................
A0A1U7QSF7_MESAU/23-176              ...........................................................tgletlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-TAN.LQAIQKEFSEIR.D.S.V.Q.A.E.D.EnI..D.iR..I..LR..TT..E.S..LQ.GI..K.HSD.RCCFLRHLVRFYLDRV.F.K.F..Y.....Q....T....P....D....H....R.....IL..R...KTSS...LANSFLI.I.KK..D.LSIC.....H...S...R.M..A.C...H....C...G...E...E...A...MkkyN...H...V.L...S...HFTEL.E.H....QaA.V....VKALGELDI.LLRWMEE----mi......................
G1MXI5_MELGA/13-175                  ...............................................mtccltllpaagnkillfgpcrisv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---S.MSEIRAGFTAIK.T.N.I.Q.A.R.D.P.I..R..T..LsiLS..HP..H.S..LH.RV..Q.PSD.KCCMVHKVFNFYVDKV.F.K.H..C.....Q....T....E....N....S....Y.....IN..R...KISS...IANSFLS.I.KR..K.LEHC.....H...D...E.N..K.C...L....C...G...Q...E...P...T...E...R...F.K...Q...ILVNY.E.GlnvtS.A.A....MKSLGELDI.LLDWME-----ks......................
A0A3Q7VED4_URSAR/22-176              ...........................................................saglktlrlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDI.LLQWME-----emk.....................
F7HHV8_MACMU/50-207                  ......................................................vqgqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.S.Q.D.N.I..R..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.AS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
IL10_VULVU/5-175                     ......................................................................al-LCCCL.VL.LAGV.GA.S.R..H..QST.LSED..D..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.R..A.....E....N....H....D....P....D.....IK..D...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMTM........................
IL10H_EHV2/5-175                     .......................................................................s-LLCCL.VL.LAGV.WA.D.N..K..YDS.ESGD..D..CPTL..P.T.S.LPHM.LHELRAAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..M..LL..DG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....S....T....D....qEK..D...KVNS...LGEKLKT.L.RV..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTT........................
A0A2R9B3D3_PANPA/43-213              ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLEFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KVSS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWIN-----knhev...................
L5JXR2_PTEAL/9-175                   ..............................................cilvavfylswtpsaglkilhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.VTTN.LQEMHNGFSEIR.D.T.V.Q.A.K.D.K.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHILRLYLNTV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...K...EkysQ...I.L...S...HFEEL.EpQ....E.A.V....VKALGELDI.LLRWME-----et......................
IL10_CAVPO/5-174                     .......................................................................a-LLCCL.AL.LAGV.KA.S.Q..G..TNT.QSED..S..CAHF..P.A.G.LPHM.LRELRAAFGRVK.T.F.F.Q.T.Q.D.Q.L..D..N..V..LL..NK..S.L..LE.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.Q..A.....E....K....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RM..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...DFNKL.Q.D....Q.G.V....YKAMNEFDI.FINCIEAYMMI........................
A0A3Q4ANB6_MOLML/11-169              .........cllllliclgevtqgrhlllnacsvnvhtqelhkyyshirsnavssmqhptlffminfvfqeg------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.--Q.TCCFLRLVLRFYVERV.F.G.N..Y.....A....S....S....Q....P....Q.....HQ..R...SSSA...LANAFVS.I.RR..D.MHKC.....H...C...H.C..-.T...E....E...T...Q...R...T...V...D...S...L.D...A...AFNKL.DmN....K.A.A....QKAVGELDT.VLDWLE-----glsq....................
A0A2U3X0N5_ODORO/20-140              ........................................................tpsaglktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-NTN.LQEMRSGFSEIR.D.S.V.Q.A.K.D.E.I..V..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....-...-...-.-..-.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------ltpqaavvkalgel..........
A0A2R8MR56_CALJA/18-173              ........................................................csvdsrsfrrclistd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MHHIEESFQEIK.K.A.I.Q.A.K.D.T.F..P..N..V..TV..LS..T.LetLQ.SI..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....H....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LQQC.....Qe.qR...Q.C..H.C...G....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDV.FLAWID-----knhev...................
A0A1L8GUJ8_XENLA/6-173               ....................................sllsmvyltslyvftcetkifhpkhcqraqleknte------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.--DLYNKTVSFK.R.L.F.P.K.D.N.I.T..D..I..Q..LL..TK..Q.L..KE.DF..M.AQK.NCNLRNNLLSFYINTF.L.-.-..-.....E....N....T....L....V....K.....EK..A...KKFK...IIDKLMV.I.QD..L.LLHC.....K...K...S.HcdQ.K...E....T...E...S...K...S...F...R...E...L.K...K...KTCQI.H.G....K.R.V...lWKAISEMDI.LVEWIQEYI--ee......................
I3M7X1_ICTTR/14-175                  ...................................................mfcllwapstgfktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LEEIQSGFSKIR.D.T.V.Q.A.K.D.EnI..D.iR..I..LR..RT..E.S..LQ.DT..K.PSA.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....F....D....H....N.....TL..R...NISS...LANSFLT.I.KK..G.LRLC.....H...A...R.M..T.C...R....C...G...E...E...A...T...E...KysqI.L...S...HFEKL.DlQ....E.A.V....VKALGELDI.LLRWME-----et......................
G8XUH0_9BETA/9-179                   .......................................................................g-LLCCG.VF.A--A.AS.S.R..S..PKN.KPSI..D..CNPQ..T.G.D.FVNM.LKSMRQDYSRIR.D.T.L.H.D.R.D.K.L..H..S..S..LL..TG..A.L..LD.EM..M.GYS.GCRTTLLLMEHYLDTW.Y.P.A..A.....Y....R....Hh.lyD....N....Q.....TL..V...VVDR...MGSTLVA.L.LK..A.MVQC.....P...-...M.L..A.C...G....A...P...S...P...A...M...D...K...M.L...Q...QEAKM.K.K...yT.G.V....YKGISETDL.LLGYLELYMM-k.......................
M3WJJ3_FELCA/18-191                  ..........................................llclslilhlwsqgpgiqgqefqfgpcrve------.--.----.--.-.-..-..---.----..-..----..-.-.-.-GVV.LQELWEAFWAMK.D.I.V.Q.A.K.D.N.I..T..N..V.rLL..RK..E.V..LQ.NV..S.NAE.SCYLIRALLKFYLNTV.F.K.N..Y.....Q....D....Ka..aD....F....R.....VR..K...SFST...LANNFVV.I.VS..K.LQPS.....QeneM...F.S..V.S...D....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.DiE....A.A.Q....TKAFGEVDI.LLTWMEKF---yql.....................
A0A2U9BGB5_SCOMX/6-177               .......................................................................l-LLCAL.AL.LSLL.GT.A.R..S..GPM.-CNN..R..CCRF..V.E.G.FPVR.LRRLREDYSQIR.D.F.Y.E.A.N.D.D.L..N..T..A..LL..DQ..S.V..ED.SF..E.SPF.ACHAMNSILDFYLSTV.L.P.T..Ama.gvT....E....D....A....K....E.....LK..P...HVES...IQHIFDE.L.KS..D.VSRC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...N...H...L.N...S...TYNQM.E.S....R.G.L....FKAMGELDQ.LFNYIEKYLA-s.......................
A0A3P8UYN6_CYNSE/33-200              ......................................................ivlgllslfswalsgpmc------.--.----.--.-.-..-..---.--TN..Q..CCRF..V.E.G.FPVR.LKKLRQSYLQIR.D.Y.Y.E.A.N.N.D.L..D..S..V..LL..DH..S.I..ED.SF..N.SPF.ACHVMDTILNFYLSEV.L.P.R..A.....M....S....Qv.tdN....I....D.....LK..P...HVES...ILQIFDE.L.KD..D.VHKC.....R...N...Y.F..S.C...K....-...K...P...F...D...I...K...D...L.N...S...SYTQM.E.S....K.G.L....FKAMGELDL.LFNYIEKYLA-s.......................
A0A087YF42_POEFO/9-172               .............................................vcavllllllgflngpaesrtlhmdgc------.--.----.--.-.-..-..---.----..-..----..-.-.S.ANVH.LHELHQYFSEIK.S.D.A.I.S.A.DgE.I..G..V..K..LL..DA..S.L..MK.NV..Q.EGQ.TCCFVRLLLRFYVERV.F.G.N..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...S...V.L...A...NFDKL.QiQ....Q.A.A....QKAVGELGT.VLDWLE-----gl......................
H2N3X3_PONAB/54-210                  ............................................................ilcsvdnhglrr------.--.----.--.-.-..-..---.----..-..----..C.L.I.STDM.-HHTEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTRNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Q..eR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.AaA....IKSLGELDI.FLAWID-----knhev...................
A0A2Y9E3Q5_TRIMA/11-169              .....llfvtlsfaiakhkqsfftksccskvtltqavdslfvkaawlkatipedsiknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCQFQEQLRSFFMEDV.F.G.H..L.....Q....L....Q....V....C....K.....EI..H...FV--...--DDFCS.L.RQ..K.LSHC.....I...S...C.P..S.S...A....R...E...M...K...S...I...T...T...I.K...K...TFYGI.G.N....K.G.I....YKAISELDI.LLSWIKNFL--es......................
Q9J4U5_9BETA/15-188                  ....................................................................aigt-----L.LM.MAVV.VL.S.A..H..DHE.HKEVppA..CDPV..H.G.N.LAGI.FKELRATYASIR.E.G.L.Q.K.K.D.T.V..Y.yT..S..LF..ND..R.V..LH.EM..L.SPM.GCRVTNELMEHYLDGV.L.P.R..A.....S....H....L....D....Y....Dn...sTL..N...GLHV...FASSMQA.L.YQ..H.MLKC.....P...-...A.L..A.C...T....G...K...T...P...A...W...M...Y...F.L...E...VEHKL.N.P...wR.G.T....AKAAAEADL.LLNYLETFL--lq......................
A0A1S3A2V5_ERIEU/57-170              ...............................................atvpedhiknirllkkktqkafmkn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CRFQEQLFSFFMEDV.F.G.Q..L.....X....V....Y....K....-....-.....--..E...--MH...FVEDFHS.F.RQ..N.WSRC.....I...S...C.A..L.S...V....K...Q...T...K...T...I...T...R...I.K...R...KFYGI.G.H....K.G.V....YKAISELDI.LLAWIKKFL--es......................
A0A452G6X4_CAPHI/56-167              .................................................ipedriknirllkkktkklfmkn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CRFQEQLLSFFMEDV.F.G.Q..L.....Q....V....C....-....-....-.....-K..E...M--H...FVEDFHS.L.RQ..K.LSRC.....I...S...C.V..S.S...A....R...E...M...K...S...I...T...R...M.K...R...TFYEM.G.K....K.G.I....YKAISELDI.LLSWIKQFL--es......................
A0A096MZK1_PAPAN/5-174               .......................................................................a-LLCCL.VV.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A1A6GM16_NEOLE/5-174               .......................................................................a-LLCCL.LL.LAGV.GT.S.R..G..HYT.QNEN..N..CTHF..P.V.S.QTHM.LRELRTAFSQVK.T.F.F.Q.K.K.D.Q.L..D..N..I..LL..TD..S.L..LK.DF..K.GYL.GCQALSEMIQFYLVEV.M.P.Q..A.....E....N....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RR..Q.LQRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...L.K...N...DFNKL.Q.E....K.G.V....YKAMNEFDI.FINCIEAYMTI........................
W5N377_LEPOC/14-172                  ..................llsvcllpvmaypakggklvhfgncvlsvpihdleetirgikghivsasegdpt------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..I..L..LL..KI..G.T..LD.SV..R.SAE.SCCFLKQLLAFYLDSV.L.P.H..L.....R....G....V....P....T....H.....VR..R...HASR...LGNGLLL.L.AR..S.VENC.....H...C...D.C..G.E...E....-...V...P...D...K...T...Q...S...I.R...S...TFDGMdK.E....A.A.V....GKAVSEMDI.FLN--------w.......................
A0A452ECT1_CAPHI/16-174              ......................................................lfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQGIRSGFSEIR.D.S.V.Q.A.K.D.E.I..I..DirI..LR..KT..Q.F..LQ.GT..K.PAD.QCCLLHHILRLYLDRV.F.K.N..Y.....Q....P....P....D....H....H.....IF..R...KVSR...LANSLLT.I.KK..D.LRLC.....H...A...H.M..S.C...P....C...G...E...E...A...K...EkysQ...I.L...S...HFEEL.P.P....QaA.A....VKALGELDI.LLRWME-----ev......................
A0A3Q3ASP3_KRYMA/10-173              ............................................vvsllvllgclckaaegrtlhvdgcsan------.--.----.--.-.-..-..---.----..-..----..-.-.-.--VH.FHELRRQYTDIR.S.DaL.S.G.D.N.E.I..E..V..K..LL..DT..S.L..IK.TL..Q.EGQ.TCCFLRLLLRFYIERV.F.K.N..Y.....E....S....S....H....P....H.....QQ..R...CSSA...LANAFVS.I.RR..D.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...L...D...S...V.H...T...KFDKL.Q.I....QpA.A....HKAVGELNT.LLDWM------dglkq...................
A0A2K5NHU2_CERAT/48-206              ..................................................ilmlcsvdnhgfrrclisidmd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.--HIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWI------aknhe...................
A0A2K5K5I4_COLAP/5-174               .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.HSEN..S..CTRF..P.G.N.VPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A0D9RR41_CHLSB/3-173               .................................................lqcvslwllgtilmlcsvdnhgl------.--.----.--.-.-..-..---.----..-..--RR..C.L.I.STDM.-DHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....HsA.A....VKSLGELDI.FLAWIA-----knhev...................
IL10H_HCMVA/8-173                    ...................................................................sslvl-----I.VF.FLGA.SE.E.AkpA..TTT.IKNT..K..PQCR..P.E.D.YATR.LQDLRVTFHRVK.P.T.L.Q.R.E.D.D.Y..-..S..V..WL..DG..T.V..V-.--..K.GCW.GCSVMDWLLRRYLEIV.F.P.A..G.....D....H....V....Y....P....G.....LK..T...ELHS...MRSTLES.I.YK..D.MRQC.....P...-...L.L..G.C...G....D...K...S...-...V...I...S...R...L.S...Q...EAERK.S.D....N.G.T....RKGLSELDT.LFSRLEEYL--hs......................
#=GR IL10H_HCMVA/8-173         SS    ...................................................................XXXXX-----X.XX.XXXX.XX.X.XXXX..XXX.XXX-..-..GGGS..G.G.G.CHHH.HHHHHHHHHHHH.H.H.H.T.S.S.S.-.S..-..-..-..SS..-T..T.T..T-.--..-.STT.HHHHHHHHHHHHHHTH.H.H.H..H.....H....C....C....-....G....G.....GH..H...HHHH...HHHHHHH.H.HH..H.HCT-.....G...-...G.G..S.-...T....C...H...H...-...H...H...H...H...H.H...H...HCCTS.T.T....T.T.H....HHHHHTHHH.HHHHHHHHH--HH......................
A0A2Y9EQB7_PHYMC/11-169              ........................llfvtlslaiakhkqssfaascyprgtlsqavdmlcvkaarlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.V..K..K..V.qLL..KK..K.I..IK.LF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EI..H...----...FVEDFHS.L.RQ..K.LIHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...KFYEI.G.K....K.G.I....YKAISELDI.LLSWIKQFL--es......................
A0A452H999_9SAUR/2-173               .......................................................................k-LLTAL.IF.LALT.AS.I.K..Q..ASCqLSEE..S..CTKL..V.N.L.LPLR.LKDLRIAFDEIK.D.Y.F.Q.A.K.DdE.L..D..I..L..LL..KE..D.L..LE.DF..K.GYL.GCQSVSDMIRFYLDEV.L.P.K..A.....I....N....S....S....Q....H.....TK..R...SMVN...IGHMLMD.L.QQ..T.LKRC.....H...R...F.F..T.C...E....K...R...N...Q...T...L...K...Q...I.K...E...TYDKL.Q.E....K.G.I....YKAMGEFDI.FINYIEEYLM-m.......................
G7NUQ4_MACFA/3-173                   ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWIA-----knhev...................
IL19_MOUSE/22-171                    ............................................................iyslrrclisvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRLIEKSFHEIK.R.A.M.Q.T.K.D.T.F..K..N..V.tIL..SL..E.N..LR.SI..K.PGD.VCCMTNNLLTFYRDRV.F.Q.D..H.....Q....E....R....S....L....E.....VL..R...RISS...IANSFLC.V.QK..S.LERCq...vH...R...Q.C..N.C...S....Q...E...A..tN...A...T...R...I...I.H...D...NYNQL.E.V...sS.A.A....LKSLGELNI.LLAWID-----rnhl....................
G3X0Q7_SARHA/6-172                   ..........................................................lmllfyflfltgps------.--.----.--.-.-..-..PSS.ASED..N..CTSF..S.T.T.LPIL.LRELRTGFEEVK.G.Y.F.Q.S.K.D.E.L..I..S..V.rLL..DE..P.L..LE.DF..K.SYL.GCQALSDMITFYLEDV.I.P.R..A.....E....N....E....-....T....E.....IK..N...SVVS...LKDKLMG.L.RR..T.LKQC.....H...R...F.L..P.C...E....V...K...S...T...A...V...Q...K...I.K...S...TYEQL.N.G....N.G.V....LKAMGEFNI.FINYMETFL--ik......................
IL10H_EBVA8/7-167                    ........................................................................VTLQCL.VL.L---.--.-.-..-..-YL.APEC..G..GTDQ..C.D.N.FPQM.LRDLRDAFSRVK.T.F.F.Q.T.K.D.E.V..D..N..L..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....Q....D....P....E.....AK..D...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...I.K...N...AFNKL.Q.E....K.G.I....YKAMSEFDI.FINYIEAYMTI........................
A0A3Q1GHL7_9TELE/9-173               ........................................................vsllllllicltepve------.--.----.--.-.-..-..---.---S..G..TLHL..N.ScS.VNVH.MHELRKYYTDIR.S.N.A.I.S.E.DsE.I..G..V..K..LL..DK..S.L..MK.DL..Q.EGQ.TCCFIRLVLRFYVERV.F.S.N..Y.....A....S....S....H....P....Q.....QQ..R...CSSA...LANAFIS.I.RR..D.IHKC.....H...C...L.C..E.-...E....E...T...Q...R...K...M...D...S...V.H...A...EFIKL.QiS....Q.A.A....QKAVGELDT.VLEWLEE----qktq....................
L5JYH4_PTEAL/5-174                   .......................................................................a-LLCCL.VF.LAGV.GA.S.R..D..QRT.PSEN..S..CTHF..P.A.S.LPSM.LHELRAAFDKVK.A.F.F.Q.M.K.D.Q.L..D..N..I..LL..NG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....S....Q....G....P....D.....IK..K...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A087QPN0_APTFO/8-175               .............................................lylfsmscwlnlmptagnkifhfgpcr------.--.----.--.-.-..-..---.----..-..----..-.-.-.ISMS.VTEIRSGFTAIK.A.N.I.Q.A.R.D.P.I..R..T..LsiLS..YP..H.S..LH.RV..K.SSD.RCCITHHLFNFYVDKV.F.K.H..C.....K....T....E....D....S....Y.....VN..R...KISS...IANSFLS.V.KR..K.LGQC.....H...E...Q.N..K.C...M....C...G...QesaK...K...F...K...Q...I.L...V...NYEGL.N.V...tS.A.A....IKSLGELDI.LLDWME-----ks......................
A0A1U8C8Q7_MESAU/44-218              ........................................tlsclsllllvwnqvpglhghefrfgpcrveg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--VV.LSELWEAFWAVK.N.T.L.Q.T.Q.D.N.I..T..S..V.qLL..KP..Q.V..LQ.DV..S.DAE.SCYLVHSLLKFYLNTV.F.K.N..Y.....H....N....K....I....A....K.....VKilK...SFSS...LANNFIV.I.VS..K.LQPS.....Ke.kD...M.L..S.I...S....E...R..aH...R...R...F...L...L...F.R...R...TFKQMgT.E....A.A.L....VKAVGEVDI.LLTWMQK----fyql....................
A0A1U7TLL5_TARSY/5-174               .......................................................................a-LLCCL.VF.LAGV.RA.S.R..D..QGT.PSEN..S..CIYF..S.S.N.LPHM.LRELRAAFSRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..NE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....VK..E...HVNS...LGEKLKT.L.RM..R.LRRC.....H...Q...F.L..P.C...E....N...K...S...K...A...V...Q...Q...V.K...N...AFSKL.Q.E....Q.G.V....YKAMSEFDI.FINYIEAYMTM........................
I3LZ75_ICTTR/10-170                  .gllcatlslaiakhqpsqssftqpchsrellsqavdtfyvkaawlkatipedriknirllkketkklfmkn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CRFQEQLLSFFMEDV.F.G.G..L.....Q....L....Q....-....-....-.....IC..K...EI-G...FVEDFHS.L.RQ..K.LSRC.....I...S...CaL..P.A...-....R...E...V...T...S...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAISELDI.LLSWIK-----elle....................
A0A452Q880_URSAM/22-176              ...........................................................saglktlrlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.S.V.Q.A.K.D.E.I..I..D..IriLR..KT..E.S..LQ.DT..K.PAD.QCCLLRHVLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KTSS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.C...P....C...G...E...E...A...M...E...KysqI.L...S...HFEEL.T.P....QaA.V....VKALGELDV.LLQWME-----emk.....................
IL10_BOVIN/5-174                     .......................................................................a-LLCCL.VF.LAGV.AA.S.R..D..AST.LSDS..S..CIHL..P.T.S.LPHM.LRELRAAFGKVK.T.F.F.Q.M.K.D.Q.L..H..S..L..LL..TQ..S.L..LD.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....G....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...R...VFSEL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTT........................
A0A2R9B4Z7_PANPA/41-211              ....................................................lqcvslwllgtililcsvdn------.--.----.--.-.-..-..---.----..H..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLEFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KVSS...IANSFLY.M.QK..T.LRQC.....Q...E...Q.R..Q.C...H....C...R...Q...EatnA...T...R...V...I.H...D...NYDQL.E.V....R.AaA....IKSLGELDV.FLAWIN-----knhev...................
F1SEZ0_PIG/31-201                    ...........................................clglilllwsqgpgvqgqefqfgpcrveg------.--.----.--.-.-..-..---.----..-..----..-.-.-.--IV.LQELWEAFWDMK.D.V.V.Q.A.Q.D.N.I..T..N..V.rLL..RK..E.V..LQ.NV..S.EAE.SCYLIHSLLKFYLNTI.F.K.N..Y.....R....E....K....A....V....Kf...rIL..R...SFST...LANNFVV.I.MS..K.LQPS.....Qe.nE...M.F..PiS...E....N...A...R...R...R...F...L...L...F.Q...R...EFKQL.DrE....V.A.L....TKAFGEMDI.LLTWMETF---yq......................
A0A3Q3FBR2_9LABR/7-161               ..............cslcllvllgwmsgyvesgtlhldscsvsvhthelrkyysairtnavmtsiclslqeg------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.--Q.TCCFLRLVLRFYVERV.F.S.N..Y.....V....S....S....Q....P....T.....QQ..R...STSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.A...E....E...T...Q...K...T...I...D...S...L.H...A...EFDKL.ViD....S.A.A....QKAMGELDT.VLEWLEAQK--th......................
A0A3L8Q5D4_CHLGU/11-157              ...................................................................ptlll-----L.LL.LLGT.AP.T.R..-..---.-AQP..S..CLRF..P.E.L.LPAR.LKELRLKFEEIK.E.Y.F.Q.S.K.D.DdL..S..I..Q..LL..SS..D.L..LE.EI..K.GRL.GCQSVSEMMGFYMEEV.L.P.S..A.....M....R....T....S....T....E.....HQ..H...SMGD...LGNLLLS.L.RA..M.MRRC.....H...R...F.F..T.C...E....E...R...S...R...S...M...E...H...I.K...E...TFSRV.R.P....-.-.-....---------.-----------ragr....................
F6XL14_HORSE/42-208                  ..............................................cllaavfclfwtpsaglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.ITTN.LQEMRNGFSEIR.D.R.V.L.A.E.D.E.I..I..DvrI..LR..KM..V.S..LQ.DT..E.PAG.QCCLLRHVLRLYLDKV.F.K.N..Y.....Q....T....P....D....H....H.....IL..R...KLSS...LANSFLT.I.KK..D.LRLC.....H...D...R.M..T.C...P....C...W...E...E...A...M...E...KysrI.L...S...HFEEL.K.P....ReA.V....VKALGELDI.LLRWME-----ea......................
A0A2K5XPY6_MANLE/49-206              ......................................................vqgqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.S.Q.D.N.I..R..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.VS..Q.LQPS.....Qe.nE...M.L..S.I...R....D...S...A..hR...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
A0A2U3Y8L8_LEPWE/21-169              ...............akhrpsssvkgcyprgtlsqavdmlyvkaaqlkatipedhiknirllkkktkklftk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.SCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....R.....EI..H...----...FVEELHS.L.RQ..Q.LSCC.....I...S...C.A..S.S...A....R...E...M...K...T...I...T...R...M.K...R...TFYEI.G.N....K.G.I....YKAISELDI.LLSWIKQFL--es......................
A0A2K5W336_MACFA/40-209              ...................................................lqcvslwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-DHIEDSFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....VKSLGELDI.FLAWI------aknhe...................
A1BLZ3_9GAMA/14-181                  .....................................................iwilyftlplseervlplr------.--.----.--.-.-..-..---.-GNC..K..LLLQ..D.T.V.IPNL.LYSMRSIFQDIK.P.Y.F.Q.G.K.D.S.L..N..N..L..LL..SG..Q.L..LE.DL..Q.SPI.GCDALSEMIQFYLEEV.M.P.Q..A.....E....I....H....H....P....K.....HK..N...SVMQ...LGETLHT.L.IS..Q.LQEC.....T...A...L.F..P.C...K....H...K...S...L...G...A...Q...K...I.K...E...EVSKL.G.Q....Y.G.I....IKAVAEFDI.FINYMESYF--gv......................
H9GD87_ANOCA/1-170                   ....................................................................mtvv-----L.VL.LSLV.LIlE.N..A..HSQ.LAET..N..CQYF..A.N.A.LPLR.LKELRGTFNKVK.E.Y.F.Q.T.Q.DeE.L..D..I..M..LL..KQ..D.L..LE.DF..K.GYL.GCQSVGEMIQFYLEEV.L.P.N..V.....S....S....S....-....N....T.....IN..Q...DVGF...LGDMLLE.L.RQ..L.IKRC.....H...R...Y.F..I.C...E....K...K...S...K...T...I...K...D...I.K...D...TYKKL.Q.D....K.G.I....YKAMGEFDI.FINYIEEYLM-m.......................
L5JW63_PTEAL/1-138                   .....................................................................mhh------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.---IEESFREIK.G.A.I.Q.A.K.D.I.F..Q..N..VtiLS..TL..E.I..LR.SV..K.PLD.VCCMTTNLLAFYVDRV.F.K.D..H.....Q....E....L....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..A.LQQC.....Qe.qR...L.C..H.C...G....Q...E..aT...N...A...T...R...I...I.H...N...NYNQL.E.V....QsA.A....LKSLGELDV.FLAWV------hknh....................
A0A1U7TBW8_TARSY/14-175              ...................................................vfsllwtpstglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.VTTH.LQEIQNGFSEIR.D.N.V.Q.A.N.DgN.I..D..V.rI..LR..RT..E.S..LQ.DT..K.PED.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISN...LANSFLT.I.KK..D.LRLC.....H...T...H.M..T.ChcgE....E...A...M...K...K...Y...S...Q...I.L...N...HFEEL.E.S....QaA.V....VKALGELDI.LLRWME-----mk......................
A0A3Q3LE84_9TELE/8-170               ........................................................slclllllcclsgles------.--.----.--.-.-..-..---.----..R..TVHL..D.TcS.VNIH.IHELRKYYSDIR.S.N.A.I.T.G.DsE.I..G..V..K..LL..DK..S.L..IK.DV..E.EGQ.TCCFMRLLLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...H.C..G.-...E....E...T...Q...R...K...I...D...S...L.H...A...EFIKL.QvN....Q.A.A....QKAVGELDT.LLQWLEG----lvh.....................
A0A3L8SRW2_CHLGU/52-168              .............................................lkssvpkdlikttrllkkttkilfmtn------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.-CSVRDQLLSFYVKNV.F.S.R..L.....E....V....G....S....-....D.....KL..Y...FI--...--SAFQV.L.QA..N.MDAC.....L...P...C.S..P.S...T....R...L...T...S...T...V...K...K...L.K...R...TFLKL.G.D....Q.G.F....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A3P8NT29_ASTCA/12-172              .................................................llllllscltepaesrtlhldsc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VSVH.THELRKYYAHIR.S.N.A.IsE.D.N.E.I..G..M..K..LL..DR..S.L..MK.NV..Q.DGQ.TCCFLRLVLRFYVERV.F.S.N..Y.....A....S....S....E....P....Q.....QQ..R...CSSA...LANAFVS.I.RR..D.IHKC.....H...C...Q.-..C.G...E....E...T...Q...R...T...I...D...S...V.H...A...EFIKL.QaN....R.A.A....QKAVGELDT.VLEWLEA----lg......................
A0A3Q7U8C0_URSAR/5-174               .......................................................................a-QLCCL.VL.LAGV.GA.S.R..H..HTA.PSED..N..CTHF..P.A.S.LPHM.LRELRAAFGRVK.T.F.F.Q.M.K.D.K.L..D..N..I..LL..TG..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...AFSKL.Q.E....R.G.V....YKAMSEFDI.FINYIETYMTM........................
A0A3Q3W2K0_MOLML/6-169               ...........................................sacllllliclgevtqgrhlllnacsvnv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---H.TQELHKYYSHIR.S.N.A.I.T.G.DsE.I..G..V..K..LL..DK..S.L..IK.GV..Q.EGQ.TCCFLRLVLRFYVERV.F.G.N..Y.....A....S....S....Q....P....Q.....HQ..R...SSSA...LANAFVS.I.RR..D.MHKC.....H...C...H.C..-.T...E....E...T...Q...R...T...V...D...S...L.D...A...AFNKL.DmN....K.A.A....QKAVGELDT.VLDWLE-----glsq....................
A0A0R4J1N5_MOUSE/63-219              .............................................................legqefrfgsc------.--.----.--.-.-..-..---.----..-..----..-.Q.V.TGVV.LPELWEAFWTVK.N.T.V.Q.T.Q.D.D.I..T..S..I.rLL..KP..Q.V..LR.NV..S.GAE.SCYLAHSLLKFYLNTV.F.K.N..Y.....H....S....K....I....A....K.....FKvlR...SFST...LANNFIV.I.MS..Q.LQPSk...dN...S...M.L..P.I...S....E..sA...H...Q...R...F...L...L...F.R...R...AFKQL.DtE....V.A.L....VKAFGEVDI.LLTWMQK----fyh.....................
A0A1U7T7W5_TARSY/19-172              .........................................................svhtrglrrclismd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MHHIEQSFQGIK.R.A.V.Q.A.K.D.T.F..Q..N..VtiLS..KS..E.T..LQ.SI..K.PLD.VCCVTKNLLTFYMDRV.F.K.D..H.....Q....E....P....N....P....Q.....IL..R...KISS...IANSFLY.M.QK..T.LQQC.....Q...E...Q.R..R.C...H....C...R...Q...E...A...I...NvttV...I.H...D...NYDQL.E.V....R.SaA....VKSLGELDV.FLAWID-----knhq....................
K7F6U1_PELSI/16-174                  ...................................................iclkpttslrrlhlgqcvisv------.--.----.--.-.-..-..---.----..-..----..-.-.-.---N.IHEIRHSFRAIK.D.M.T.Q.S.K.D.E.H..T..D..I.rLL..HQ..S.Y.sLQ.DT..E.PMD.RCCFLRHLLRFYLTTV.F.S.H..C.....K....V....S....S....S....P.....II..R...KVSR...IANTFLS.I.KK..D.LRLC.....H...Q...V.S..M.C...H....C...R...E...D...V...K...H...KyglI.M...S...QYEKM.D.V....H.S.A...gLKALGELDI.LLDWM------dka.....................
A0A2K5UB53_MACFA/39-207              ...........................................lilllwsqvpgvqaqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.S.Q.D.N.I..R..S..V.rLL..QQ..E.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.AS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
F6PN11_CANLF/13-180                  ..................................................lilllrsqgpgvqgqefrfgpc------.--.----.--.-.-..-..---.----..-..----..-.R.V.QGVA.LRELREAFWTVK.D.T.V.Q.A.K.D.N.I..T..S..V.rLL..RK..E.V..LQ.DV..S.DAE.SCYLIRALLKFYLNTV.F.K.NylD.....E....A....A....D....V....R.....IR..R...SFST...LANNFFV.I.AS..K.LQPS.....QedeM...F.S..I.S...E....S...A...R...R...R...F...L...L...F.Q...R...AFKQL.D.I....Q.A.A...qTKAFGEVDI.LLTWMEKF---ye......................
A0A091UYL7_NIPNI/58-168              ....................kdlikntrllkkttkvlfmtncsvrdqllsfyvknvfshlgvgndklyiisa------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.----------------.-.-.-..-.....-....-....-....-....-....-.....--..-...----...----FQV.L.QA..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...L.R...K...TFRKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYIQ-t.......................
A0A3B1K4Q0_ASTMX/7-177               .........................................................lflafllavallaed------.--.----.--.A.Q..C..KRV.ICKD..S..CCSF..V.E.S.FPVK.LRKLRTSYDEMR.N.Y.Y.V.N.N.D.D.L..G..F..A..LF..NR..T.V..LE.NL..K.GPY.FCHVMNEVLRFYLDTV.L.P.T..A.....I....T....Q....E....T...qN.....FK..T...SIDY...IGNIFNS.I.KR..D.IVKC.....K...S...Y.F..S.C...K....-...K...P...F...E...I...S...S...I.Q...K...SYSQM.K.E....K.G.L....YKAMGELDM.LFNYIEDYLA-s.......................
A0A1L8HER6_XENLA/3-167               ...................................................fcllltfffftckvvrcqsgg------.--.----.--.-.-..-..---.---G..N..CHRV..V.N.I.FPAK.LRELRATFQKVK.N.F.F.Q.M.K.DnN.L..E..T..V..LL..QD..D.L..LQ.EF..K.GNI.GCQSVSETIRFYLEEV.L.P.Q..A.....N....H....-....-....-....-.....YK..L...NVSF...LKDKLLD.L.KH..T.LRRC.....H...N...F.L..P.C...E....R...K...S...K...A...I...K...E...I.K...Q...AYNKM.R.E....Q.G.I....YKAMGEFDI.LIDYIEEYL--ms......................
A0A3B3HF71_ORYLA/17-160              ..................................lgclvsllfilnrvvdsrtlhtdscsfnvythelrkyy------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..AD..M.L..VH.LF..Q.EDQ.TCCFLRLLLRFYVERV.F.N.N..F.....S....P....S....E....P....H.....QL..R...CSSA...VANAFVS.I.RR..D.MQKC.....H...C...H.C..-.A...E....E...T...H...R...Q...I...D...S...M.H...T...AFDKL.Q.I....QlA.A....QKAVGELDT.VLDWLEA----lg......................
A0A3B3U9H2_9TELE/4-174               .......................................................................q-LLSVL.VL.LSSV.FS.A.C..C..SPV.CHD-..Q..CCRF..V.E.E.FPVR.VQMLREDYRRIR.G.F.Y.E.S.N.D.D.F..D..N..A..LL..DQ..S.V..ED.AF..K.SQF.ACEAINSILEFYLSTV.L.P.T..A.....V....A....Sv.tiD....N....S.....LK..T...HVES...IQQIFDE.L.KR..D.VHRC.....R...K...V.F..E.C...K....-...K...P...F...D...I...R...S...L.N...S...TYTEM.E.S....R.G.V....YKAMGELDQ.LFNYIETYLA-s.......................
A0A384BIT0_URSMA/39-169              .................................fqavdtlyvkaawlkatipedhiknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....A....Q....V....C....R.....ET..H...F---...-VEELHS.L.RQ..Q.MNRC.....I...S...C.A..S.S...A....R...E...M...K...A...I...T...R...M.K...R...TFYGI.G.N....K.G.I....YKAIRELDI.LLSWIKQFL--es......................
A0A2K6SM35_SAIBB/21-175              .........................................................pstglktlhlgkcvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..V.rI..LR..RT..E.S..LQ.DT..K.PAD.RCCLLRHLLRLYLDRV.F.K.D..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.M..T.ChcgE....G...A...T...K...K...Y...S...Q...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
G3TLC8_LOXAF/18-170                  .......................................................csvharslkrcppsmdm------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-NPVKESFQEIK.G.A.I.Q.A.N.D.T.F..K..N..V..TI..LS..-.N..LH.SI..K.PVD.VCCMTRELLEFYMKRV.F.K.H..R.....E....E....L....S....L....Q.....IS..R...EVSS...ISNSFLP.L.QR..T.VQPC.....K...Kq.sL.C..P.C...S....E...E..aI...S...A...T...R...T...I.I...N...NYDQL.E.V....R.SaA....IKSLGELDV.FIAWIDK----nyhs....................
A0A2K5YSX4_MANLE/6-169               ...................ilrcgllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.N....K.G.I....YKAISELDI.LLSWIKKFL--es......................
A0A2K6QQV7_RHIRO/8-173               ........................................................lwllgtilmlcsvdnh------.--.----.--.-.-..-..---.----..-..GLRR..C.L.I.STDM.-HHIEESFQEIK.R.A.I.Q.A.K.D.T.F..P..N..V..TI..LS..T.LetLQ.II..K.PLD.VCCVTKNLLAFYVDRV.F.K.D..H.....Q....E....P....N....P....K.....IL..R...KISS...IANSFLY.M.QK..T.LRQC.....Qe.qR...Q.C..H.C...R....Q...E...A...T...N...V...T...R...ViH...D...NYDQL.E.V....R.SaA....IKSLGELDI.FLAWIA-----knhev...................
A0A2U3UZL1_TURTR/5-174               .......................................................................a-LLCCL.IF.LARV.AA.G.Q..H..QGT.QAKD..S..CIHF..P.D.S.LPHM.LRELRAAFSSVK.T.F.F.Q.M.N.D.Q.L..D..N..S..LL..SQ..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.K..A.....E....D....H....G....S....N.....IK..E...HVNS...LGEKLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...VFNKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMI-t.......................
Q9Q5L1_CHV12/10-167                  ................................................................hflvflcl------.--.----.--.-.-..-..---.APAC..G..RAET..C.G.N.IPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....A....M....S....L....K.....SQ..E...HVNF...LGENLNT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
H0WP43_OTOGA/5-174                   .......................................................................a-LLCCL.VF.LAGV.GA.H.Q..G..QSI.QSEN..S..CTHF..P.A.S.LPNM.LRELRDAFGKVK.T.F.F.Q.T.K.D.Q.L..D..N..M..LL..NE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....E....P....G.....IK..E...HVNS...LGEKLKN.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...S...TFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIETYMT-r.......................
A0A0D9RR76_CHLSB/47-206              ....................................................pgaqgqefqfgpcqvkgvvp------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.-QKLWEAFWAVK.D.T.V.Q.A.Q.D.N.I..R..S..V.rLL..QQ..K.V..LQ.NV..S.DAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.VS..Q.LQPS.....Q...EnemF.S..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DiE....A.A.L....TKALGEVDI.LLTWMQQ----fykl....................
A0A1A6GL30_NEOLE/18-172              ........................................................csvhtrslrrclisvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRFIEKSFQEIK.R.T.L.Q.T.K.X.T.F..Q..N..V..TI..LS..T.LenLR.SI..K.VPVdVCCVTSHLLTFYRDRV.F.K.D..H.....Q....E....T....S....P....E.....VM..R...RISG...IANSFLY.M.QR..T.LEQC.....V...R...SrC..H.C...S....Q..eA...T...N...A...T...R...I...I.H...D...NYNQL.G.V...sS.A.A....LKSLGELDI.FLAWID-----knhq....................
A0A1S3FA89_DIPOR/9-175               ..............................................sllsavllvvgrpsnglktlhlgscv------.--.----.--.-.-..-..---.----..-..----..-.-.-.VTIN.LQEIQHGFSEIR.D.S.V.Q.A.K.D.D.N..I..N..I..RIlrST..E.S..LQ.DT..K.ASE.KCCLLHHLLSFYLNRV.F.N.N..Y.....Q....T....T....D....H....P.....TL..R...KLSS...LANSFLI.I.KK..D.LQLC.....H...A...H.M..T.C...Q....C...E...E...E...A...I...A...KynrI.L...S...HFEEL.E.P....QaA.T....VKALGELDI.LLRWME-----es......................
A0A0Q3TEF7_AMAAE/35-156              ....................................................................apqs------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.K.D.D.E.L..S..I..Q..LL..SS..E.L..LD.DF..K.GSF.GCQSVSEMMRFYMEEV.L.P.S..A.....M....R....T....S....T....H.....HQ..Q...SMGD...LGNLLLS.L.KA..T.MRRC.....H...R...F.F..T.C...E....K...R...S...K...T...I...K...H...I.R...E...TFQKM.N.E....N.G.V....YKAMGEFDI.FINYIEEYLM-m.......................
G3N5D6_GASAC/16-170                  ......................................................yinlsplaesrtlslasc------.--.----.--.-.-..-..---.----..-..----..-.-.S.VNVH.IHELRQYYNDIR.L.D.ViE.S.D.T.D.I..G..V..K..LL..DK..S.L..MT.NI..Q.DGQ.TCCFVRLVLRFYIERV.F.S.N..Y.....A....S....S....Q....P....Q.....HQ..R...CSSA...LANAFFS.I.RR..D.IREC.....H...C...-.-..N.C...E....E..dT...Q...R...K...I...D...S...V.I...A...EFNKL.DmN....Q.A.A....KKAVGELDT.VLEW-------lqgl....................
A0A2I4APV9_9TELE/11-170              .................................................llllllgclcrttegrtlhvdgc------.--.----.--.-.-..-..---.----..-..----..-.S.A.-HVH.LHELRSHYSDIR.Q.H.A.Q.S.G.DnE.I..G..V..K..LL..DG..S.L..IN.HV..Q.NGQ.TCCFLRLVLRFYVERV.F.H.N..F.....E....S....S....Q....P....H.....HQ..R...GSSA...LANAFVT.I.RR..D.MHRC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...T...V.H...S...KFDML.Q.I....RpA.A....HKAVGELNT.VLDW-------ldgl....................
A0A3L8RU67_CHLGU/16-175              ..................................................wmnlmptagdkifhfgacrvsi------.--.----.--.-.-..-..---.----..-..----..-.-.-.---S.MTEIRAGFTAIK.A.N.I.Q.S.R.D.P.I..R..T..LsiLS..HP..H.S..LH.KV..K.SSD.RCCITYQLFTFYVDKV.F.K.H..C.....R....T....E....D....P....F.....VN..R...KISS...IANSFLS.T.RR..K.LGQC.....R...E...Q.N..N.C...L....C...G...E...E...S...T...E...K...F.K...Q...ILANY.E.G....L.N.VtsaaMKSLGELDI.LLDWME-----ks......................
A0A3Q0SY57_AMPCI/5-177               .......................................................................s-VLLCV.LA.LAYF.FS.S.A..L..CSP.TCNN..R..CCRF..V.E.G.FPLR.LKQLRQDYARIR.D.Y.Y.E.A.N.D.D.L..D..T..A..LL..DQ..S.V..ED.SF..K.SPY.GCHTMNSLLDFYLSTV.L.P.T..A.....V....A....G...vT....E....Di..ksLK..P...HMES...IQEIFSN.L.KR..D.VIQC.....R...N...Y.F..S.C...K....-...K...Q...F...D...I...Q...N...L.N...S...TYTQM.E.S....R.G.L....YKAMGELDI.LFNYFETYLA-s.......................
A0A2Y9ND25_DELLE/38-169              ................................lsqavdklyvkaarlkatipedrvkkvqllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRLQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EI..H...----...FVEDFHS.L.RQ..K.LSHC.....I...S...C.V..S.S...A....R...E...M...K...S...I...T...R...M.K...R...KFYEI.G.K....K.G.I....YKAISELAI.LLSWIKQFL--es......................
A0A2K5V5V2_MACFA/6-169               ...................ilrcgllsvtlslaiakhrqssftktcyprgtlsqavdalyikaawlkatipe------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.D.R.I..K..N..I.rLL..KK..K.T..KK.QF..M.--K.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....F....Q....G....C....K.....KI..R...FV--...--EDFHS.L.RQ..K.LSHC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...IFYRI.G.H....K.G.I....YKAISELDI.LLSWIKKFL--es......................
G3HB01_CRIGR/5-174                   .......................................................................a-LLCCL.LL.LAGV.GP.S.R..G..QYT.QQEN..N..CTHF..P.V.S.QTHM.LRELRTAFSQVK.T.F.F.Q.K.K.D.Q.L..D..N..I..LL..TD..S.L..VQ.DF..E.GYL.GCQTLSEMIQFYLVEV.M.P.Q..A.....E....N....H....G....P....E.....IK..E...HLNS...LGEKLKT.L.RR..Q.LQRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...K...V.K...S...DFNKL.Q.E....K.G.V....YKAMNEFDI.FINCIETYMTI........................
A0A091JAF4_CALAN/50-168              ............................................tslkssipkdlikntrllkkttkvqfmt------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRVRDELLSFYTKNV.F.S.H..L.....G....A....G....S....-....-.....DK..L...YIIS...---AFQV.L.QT..N.MNAC.....L...P...C.A..P.S...T....R...L...T...S...A...V...K...K...L.K...K...TFLKL.G.E....K.G.I....YKAIHELDI.LLPWIQAYI--rt......................
A0A151MAR5_ALLMI/35-208              ....................................................................vscl----CL.SF.LLAV.CG.L.H..W..TPT.T-AN..K..IFHF..G.S.C.EILMnVNEIRTGFTAIK.A.N.I.Q.A.R.D.T.V..RttS..I..LS..FP..Y.S..LH.RV..N.SED.TCCIIHHLLKFYVDMV.F.K.H..C.....E....T....E....D....S....W.....VN..R...KISS...IANSFLS.I.KK..N.FRHC.....H...Q...Q.S..L.C...R....C...G...E...E...A...T...Q...K...Y.K...QiltNYSQL.N.V....KnA.A....MKSLGELDI.LLDWME-----kay.....................
Q2THG5_MOUSE/34-154                  .......................................................vitanlqaiqkefseir------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.DS..V.SLD.RCCFLRHLVRFYLDRV.F.K.V..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLI.I.KK..D.LSVC.....H...S...H.M..A.C...H....C...G...E...E...A...M...E...K...Y.N...QilsHFIEL.ElQ....A.A.V....VKALGELGI.LLRWMEE----ml......................
A0A091CQR5_FUKDA/12-175              ...............................................saifyllctpssglqtlhlgscvii------.--.----.--.-.-..-..---.----..-..----..-.-.-.--TN.LQKIQSEFSEIR.D.S.V.Q.A.N.D.QnI..D..F.rV..LR..NA..G.S..LQ.DT..E.PSD.RCCLLRHLLGLYLDRV.F.R.N..Y.....Q....T....S....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LQLC.....H...T...Y.T..T.C...H....C...G...E...E...A...T...E...KyrqI.L...S...HFEQL.E.P....QaA.A....VKVLGELDI.LLRW-------mket....................
D4A2T8_RAT/24-176                    ............................................................glktlhlgscvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-TAN.LQAIQKEFSEIR.H.S.V.Q.A.E.D.EnI..D.vR..I..LR..TT..E.S..LK.DT..K.LSD.RCCFLRHLVRFYLDRV.F.K.V..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLI.I.KK..D.LSVC.....H...S...H.M..A.C...H....C...G...E...E...A...M...E...KynqI.L...S...HFTEL.ElQ....A.A.V....VKALGELGI.LLRWMEE----ml......................
A0A2K5CFM5_AOTNA/21-175              .........................................................pstglktlhlgkcvi------.--.----.--.-.-..-..---.----..-..----..-.-.-.-ATN.LQEIRNGFSEIR.G.S.V.Q.A.K.DgN.I..D..V.rI..LR..RT..E.S..LQ.DT..K.PAD.RCCLLRHLLRLYLDRV.F.K.N..Y.....Q....T....P....D....H....H.....TL..R...KISS...LANSFLT.I.KK..D.LRLC.....H...A...H.T..T.ChcgE....G...A...T...K...K...Y...S...Q...I.L...S...HFEEL.E.P....QaA.V....VKALGELDI.LLQWME-----et......................
A0A493TC31_ANAPP/1-137               .....................................................................mrt---CCV.AL.LLLL.AA.S.TqpA..RCL.LTDP..S..CLHL..S.D.L.LPAK.LKELRMKFEEIK.D.Y.F.Q.S.Q.DdE.L..S..I..Q..LL..SS..D.L..LE.EF..K.GNF.GCQSVLEMMRFYMEEV.L.P.S..A.....L....R....S....S....E....H.....HQ..Q...SVGD...LGNLLLS.L.KA..M.MRRC.....V...S...G.-..-.-...-....-...-...-...-...-...-...-...-...-.-...-...-----.-.-....-.-.-....---------.-----------lstaargai...............
IL10_MACMU/5-174                     .......................................................................a-LLCCL.VL.LTGV.RA.S.P..G..QGT.QSEN..S..CTRF..P.G.N.LPHM.LRDLRDAFSRVK.T.F.F.Q.M.K.D.Q.L..D..N..I..LL..KE..S.L..LE.DF..K.GYL.GCQALSEMIQFYLEEV.M.P.Q..A.....E....N....H....D....P....D.....IK..E...HVNS...LGENLKT.L.RL..R.LRRC.....H...R...F.L..P.C...E....N...K...S...K...A...V...E...Q...V.K...N...AFSKL.Q.E....K.G.V....YKAMSEFDI.FINYIEAYMTM........................
A0A3Q1M9H7_BOVIN/8-169               ..rcgllfvtlslaiakhkqssfaercyprgtlsqavdtlyvkaaslratipedriknirllkkktkklfmk------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.------------.-.-.-.-.-.-.-.-.-..-..-..-..--..--..-.-..--.--..-.---.NCRFQEQLLSFFMEDV.F.G.Q..L.....Q....L....Q....V....C....K.....EM..H...----...FVEDFHS.L.RQ..K.LSRC.....I...S...C.A..S.S...A....R...E...M...K...S...I...T...R...M.K...R...TFYEI.G.K....K.G.I....YKAISELDI.LLSWIKQFL--es......................
A0A3B3YNU8_9TELE/36-200              .............................................vcavllllllgflngpaesrtlhmdgc------.--.----.--.-.-..-..---.----..-..----..-.-.S.ANVH.LHELHQYFSEIK.S.D.A.I.S.A.DgE.I..G..V..K..LL..DA..S.L..MK.NV..Q.EGQ.TCCFVRLLLRFYVERV.F.G.N..Y.....E....S....S....Q....P....S.....QQ..R...CSSA...LANAFVS.I.RR..E.MHKC.....H...C...H.C..-.G...E....E...T...Q...R...T...I...D...L...V.L...A...NFDKL.QiQ....Q.A.A....QKAVGELGT.VLDWLE-----glg.....................
A0A2K5C7Y7_AOTNA/31-204              ............................................atltclsllllwsqmpgaqgqkfqfgpc------.--.----.--.-.-..-..---.----..-..----..-.Q.A.KGVV.PQKLWEAFWAVK.D.T.M.Q.A.Q.D.N.I..T..S..V.rLL..RQ..E.V..LQ.NV..S.AAE.SCYLVHTLLEFYLKTV.F.K.N..Y.....H....N....R....T....V....E.....VRtlK...SFST...LANNFVL.I.MS..Q.LQPS.....Q...EnemF.A..I.R...D....S...A...H...R...R...F...L...L...F.R...R...AFKQL.DmE....A.A.L....TKALGEVDV.LLTWMQ-----kfyk....................
A0A1S3F8A7_DIPOR/21-171              ...........................................................qslgfrrclisvd------.--.----.--.-.-..-..---.----..-..----..-.-.-.----.MRHLERSFQEIK.R.T.L.Q.N.K.D.V.F..Q..N..V..TI..LS..T.LqsLQ.GI..K.PID.VCCVTRNLLAFYMDKV.L.K.D..H.....Q....E....P....N....P....Q.....IR..R...QISS...IANSFLH.T.QK..T.LQQC....eQ...R...W.C..H.C...S....Q...E..aT...N...A...T...S...I...I.Q...D...NYDQL.E.V....R.AaA....IKSLGELDI.FLAWIN-----knhq....................
IL10H_HCMVM/8-174                    ..................................................................sslvli------.VF.FLGA.SEeA.K..PatTTT.IKNT..K..PQCR..P.E.D.YATR.LQDLRVTFHRVK.P.T.L.Q.R.E.D.D.Y..-..S..V..WL..DG..T.V..V-.--..K.GCW.GCSVMDWLLRRYLEIV.F.P.A..G.....D....H....V....Y....P....G.....LK..T...ELHS...MRSTLES.I.YK..D.MRQC.....P...-...L.L..G.C...G....D...K...S...-...V...I...S...R...L.S...Q...EAERK.S.D....N.G.T....RKGLSELDT.LFSRLEEYL--hs......................
#=GC SS_cons                         ..............................................................EEEEETTEEE-----X.XX.XXXX.XX.X.XXXX..XXX.XXX-..C..GGGS..T.T.T.HHHH.HHHHHHHHHHHH.H.H.H.H.C.T.S.S.S..T..S..S..SS..TH..H.HGSHH.HH..H.STT.HHHHHHHHHHHHHHTH.H.H.H..H.....H....C....C....S....G....G.....GH..H...HHHH...HHHHHHH.H.HH..H.HHHS.....T...T...T.S..G.G...G....C...H...H...HHHHH...H...H...H...H.H...H...HHHHS.T.H....HHH.H....HHHHHTHHH.HHHHHHHHHHHHHS.....................
#=GC seq_cons                        ..................................................................h....s....................................................s...hpclcpsFppl+.s.h.h.Q.s.c.D.p.l..p..s..h..Ll..pp..p.l..Lp.sh..c.sh..sCphhcplLpFYl-cV.F.t.p..h.....p....s....p....s....s....c.....lh..c...plso...lussFhs.l.+p..c.LppC.....+...p...h.h..s.C...c....p...p...p...c...s...l...c...p...l.+...s...sFppL.p.p....p.u.l....hKAhGELDI.hLsWlE.....t.......................
//
DBGET integrated database retrieval system