GenomeNet

Database: Pfam
Entry: Jak1_Phl
LinkDB: Jak1_Phl
Original site: Jak1_Phl 
#=GF ID   Jak1_Phl
#=GF AC   PF17887.3
#=GF DE   Jak1 pleckstrin homology-like domain
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF00644
#=GF GA   26.10 26.10;
#=GF TC   26.30 26.10;
#=GF NC   26.00 26.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0266
#=GF RN   [1]
#=GF RM   27133025
#=GF RT   The Structural Basis for Class II Cytokine Receptor Recognition
#=GF RT   by JAK1.
#=GF RA   Ferrao R, Wallweber HJ, Ho H, Tam C, Franke Y, Quinn J, Lupardus
#=GF RA   PJ;
#=GF RL   Structure. 2016;24:897-905.
#=GF DR   INTERPRO; IPR041381;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This entry is for the pleckstrin homology-like (PHL) subdomain
#=GF CC   found in Jak1 proteins. JAK1 is a member of the Janus kinase
#=GF CC   (JAK) family of non-receptor tyrosine kinases that are activated
#=GF CC   in response to cytokines and interferons. PHL (residues 283-419)
#=GF CC   together with the N-terminal ubiquitin-like subdomain (residues
#=GF CC   36-111) and an acyl-coenzyme A binding protein-like subdomain
#=GF CC   (residues 148-282), associate into a canonical tri-lobed FERM
#=GF CC   domain [1].
#=GF SQ   1693
#=GS A0A2K5ZKJ8_MANLE/284-421    AC A0A2K5ZKJ8.1
#=GS A0A5C6MSB8_9TELE/194-327    AC A0A5C6MSB8.1
#=GS A0A452QRX6_URSAM/251-292    AC A0A452QRX6.1
#=GS A0A2U9CRA6_SCOMX/281-416    AC A0A2U9CRA6.1
#=GS A0A3Q1C5B6_AMPOC/302-433    AC A0A3Q1C5B6.1
#=GS A0A4W5QJQ8_9TELE/269-347    AC A0A4W5QJQ8.1
#=GS A0A671VH66_SPAAU/276-354    AC A0A671VH66.1
#=GS A0A2Y9SI10_PHYMC/284-421    AC A0A2Y9SI10.1
#=GS A0A4W5RDZ8_9TELE/269-351    AC A0A4W5RDZ8.1
#=GS D6WT73_TRICA/226-300        AC D6WT73.2
#=GS A0A673Y8E2_SALTR/295-368    AC A0A673Y8E2.1
#=GS A0A4W6BZX2_LATCA/289-423    AC A0A4W6BZX2.1
#=GS A0A498NV82_LABRO/355-385    AC A0A498NV82.1
#=GS A0A667Y3P0_9TELE/276-360    AC A0A667Y3P0.1
#=GS A0A4W6DA93_LATCA/288-412    AC A0A4W6DA93.1
#=GS A0A218U7X2_9PASE/256-385    AC A0A218U7X2.1
#=GS G3QT84_GORGO/285-430        AC G3QT84.2
#=GS A0A093QW73_PHACA/295-380    AC A0A093QW73.1
#=GS A0A096P1L9_PAPAN/299-381    AC A0A096P1L9.2
#=GS A0JM01_XENTR/297-379        AC A0JM01.1
#=GS A0A2R9C372_PANPA/273-357    AC A0A2R9C372.1
#=GS A0A384B744_BALAS/273-357    AC A0A384B744.1
#=GS A0A5F4CCQ3_CANLF/166-267    AC A0A5F4CCQ3.1
#=GS A0A5J5DGU8_9PERO/307-352    AC A0A5J5DGU8.1
#=GS A0A455BLA3_PHYMC/55-137     AC A0A455BLA3.1
#=GS A0A060Z6D0_ONCMY/2-135      AC A0A060Z6D0.1
#=GS A0A2K6NJX6_RHIRO/303-333    AC A0A2K6NJX6.1
#=GS A0A672Z5C6_9TELE/276-408    AC A0A672Z5C6.1
#=GS A0A673V4B2_SURSU/333-469    AC A0A673V4B2.1
#=GS A0A670KEH3_PODMU/259-360    AC A0A670KEH3.1
#=GS A0A663FK24_AQUCH/184-317    AC A0A663FK24.1
#=GS A0A4W5QM70_9TELE/246-380    AC A0A4W5QM70.1
#=GS A0A556VYC7_BAGYA/273-410    AC A0A556VYC7.1
#=GS A0A553QGZ8_9TELE/267-383    AC A0A553QGZ8.1
#=GS A0A665UU38_ECHNA/277-409    AC A0A665UU38.1
#=GS A0A6I8QLR1_XENTR/267-346    AC A0A6I8QLR1.1
#=GS A0A1U7SPN9_CARSF/298-380    AC A0A1U7SPN9.1
#=GS A0A4W6BT82_LATCA/285-419    AC A0A4W6BT82.1
#=GS A0A4U5VUR7_COLLU/283-419    AC A0A4U5VUR7.1
#=GS A0A498MD09_LABRO/277-355    AC A0A498MD09.1
#=GS A0A1A6HMC7_NEOLE/290-433    AC A0A1A6HMC7.1
#=GS A0A060Z5I9_ONCMY/1-70       AC A0A060Z5I9.1
#=GS A0A091KC07_COLST/296-380    AC A0A091KC07.1
#=GS A0A5F7ZH35_MACMU/286-423    AC A0A5F7ZH35.1
#=GS A0A669BX01_ORENI/80-158     AC A0A669BX01.1
#=GS A0A674D956_SALTR/283-420    AC A0A674D956.1
#=GS A0A665VLH1_ECHNA/288-370    AC A0A665VLH1.1
#=GS A0A087XVK1_POEFO/301-432    AC A0A087XVK1.1
#=GS A0A5F9ZH07_HUMAN/123-260    AC A0A5F9ZH07.1
#=GS G1MVV3_MELGA/252-388        AC G1MVV3.1
#=GS A0A667ZAK0_9TELE/300-378    AC A0A667ZAK0.1
#=GS A0A2K5L5N3_CERAT/297-379    AC A0A2K5L5N3.1
#=GS A0A674D947_SALTR/269-406    AC A0A674D947.1
#=GS A0A3Q2DNL9_CYPVA/301-434    AC A0A3Q2DNL9.1
#=GS M3ZWG4_XIPMA/258-364        AC M3ZWG4.1
#=GS A0A6I8S889_XENTR/270-403    AC A0A6I8S889.1
#=GS A0A665UPJ0_ECHNA/304-365    AC A0A665UPJ0.1
#=GS A0A1S3KQH9_SALSA/326-404    AC A0A1S3KQH9.1
#=GS A0A452QRS4_URSAM/267-339    AC A0A452QRS4.1
#=GS A0A671VY45_SPAAU/285-411    AC A0A671VY45.1
#=GS A0A673WDD6_SALTR/295-378    AC A0A673WDD6.1
#=GS A0A1V4KY01_PATFA/314-449    AC A0A1V4KY01.1
#=GS A0A2Y9F7X6_PHYMC/279-357    AC A0A2Y9F7X6.1
#=GS A0A452F668_CAPHI/286-433    AC A0A452F668.1
#=GS I3M8D2_ICTTR/299-381        AC I3M8D2.2
#=GS A0A3P8ZAR2_ESOLU/263-366    AC A0A3P8ZAR2.1
#=GS A0A672IUT4_SALFA/286-411    AC A0A672IUT4.1
#=GS A0A672ISH7_SALFA/276-362    AC A0A672ISH7.1
#=GS A0A1U7S0K0_ALLSI/305-445    AC A0A1U7S0K0.2
#=GS M3ZJ44_XIPMA/286-410        AC M3ZJ44.2
#=GS A0A671FA08_RHIFE/299-381    AC A0A671FA08.1
#=GS A0A3N0Y8G7_ANAGA/283-364    AC A0A3N0Y8G7.1
#=GS A0A3Q4ATP0_MOLML/261-387    AC A0A3Q4ATP0.1
#=GS A0A4X2K9Z9_VOMUR/299-381    AC A0A4X2K9Z9.1
#=GS A0A665VND6_ECHNA/312-387    AC A0A665VND6.1
#=GS A0A672UZA3_STRHB/216-297    AC A0A672UZA3.1
#=GS A0A091RTW2_9GRUI/294-380    AC A0A091RTW2.1
#=GS A0A087XSD4_POEFO/294-373    AC A0A087XSD4.2
#=GS A0A1L8GFQ7_XENLA/168-293    AC A0A1L8GFQ7.1
#=GS A0A665VN97_ECHNA/292-367    AC A0A665VN97.1
#=GS A0A4W4HE42_ELEEL/278-365    AC A0A4W4HE42.1
#=GS A0A2Y9TJT6_PHYMC/286-432    AC A0A2Y9TJT6.1
#=GS A0A4W3GYQ6_CALMI/315-357    AC A0A4W3GYQ6.1
#=GS A0A4W6CM35_LATCA/265-365    AC A0A4W6CM35.1
#=GS A0A2K5H7P1_COLAP/281-357    AC A0A2K5H7P1.1
#=GS A0A671W3Z8_SPAAU/314-409    AC A0A671W3Z8.1
#=GS A0A3N0YKL0_ANAGA/281-359    AC A0A3N0YKL0.1
#=GS A0A2I2U8B7_FELCA/284-420    AC A0A2I2U8B7.1
#=GS A0A665WV78_ECHNA/284-366    AC A0A665WV78.1
#=GS A0A6J3R6M8_TURTR/325-471    AC A0A6J3R6M8.1
#=GS A0A3P8SS74_AMPPE/302-433    AC A0A3P8SS74.1
#=GS A0A667XI82_9TELE/285-367    AC A0A667XI82.1
#=GS H2L7P7_ORYLA/295-373        AC H2L7P7.2
#=GS A0A5E4ACQ3_MARMO/280-357    AC A0A5E4ACQ3.1
#=GS A0A3Q3W2M5_MOLML/288-419    AC A0A3Q3W2M5.1
#=GS F1QWX8_DANRE/272-347        AC F1QWX8.1
#=GS A0A665WV51_ECHNA/282-364    AC A0A665WV51.1
#=GS A0A226PM45_COLVI/325-409    AC A0A226PM45.1
#=GS A0A096MCU2_POEFO/292-377    AC A0A096MCU2.1
#=GS A0A5C6NT12_9TELE/964-1077   AC A0A5C6NT12.1
#=GS A0A4W4FCC5_ELEEL/266-398    AC A0A4W4FCC5.1
#=GS J9JIK9_PIG/299-381          AC J9JIK9.2
#=GS A0A6G1B418_CROCR/299-381    AC A0A6G1B418.1
#=GS A0A3Q0GV11_ALLSI/297-379    AC A0A3Q0GV11.1
#=GS A0A4W4GJ75_ELEEL/219-299    AC A0A4W4GJ75.1
#=GS G1LYZ3_AILME/290-433        AC G1LYZ3.1
#=GS A0A665VK46_ECHNA/262-367    AC A0A665VK46.1
#=GS A0A4W4FCJ5_ELEEL/256-386    AC A0A4W4FCJ5.1
#=GS A0A4V6AQT0_COLLU/295-373    AC A0A4V6AQT0.1
#=GS A0A674EB63_SALTR/258-394    AC A0A674EB63.1
#=GS A0A4W5JGS2_9TELE/274-410    AC A0A4W5JGS2.1
#=GS A0A0P7WCB5_SCLFO/275-363    AC A0A0P7WCB5.1
#=GS W5ML83_LEPOC/303-443        AC W5ML83.1
#=GS A0A452ID23_9SAUR/307-445    AC A0A452ID23.1
#=GS A0A2I4CI85_9TELE/203-282    AC A0A2I4CI85.1
#=GS A0A091W206_NIPNI/244-369    AC A0A091W206.1
#=GS A0A6Q2XW72_ESOLU/240-369    AC A0A6Q2XW72.1
#=GS JAK2_CHICK/297-379          AC Q75R65.1
#=GS A0A671V6H3_SPAAU/190-323    AC A0A671V6H3.1
#=GS A0A4W4FTP6_ELEEL/300-372    AC A0A4W4FTP6.1
#=GS A0A672UZA7_STRHB/264-345    AC A0A672UZA7.1
#=GS A0A4W5MPR9_9TELE/282-419    AC A0A4W5MPR9.1
#=GS A0A4W5MMZ0_9TELE/290-427    AC A0A4W5MMZ0.1
#=GS A0A672IFT7_SALFA/268-350    AC A0A672IFT7.1
#=GS A0A4W5R1G2_9TELE/295-374    AC A0A4W5R1G2.1
#=GS A0A4W4EN58_ELEEL/164-302    AC A0A4W4EN58.1
#=GS A0A401SHL5_CHIPU/299-438    AC A0A401SHL5.1
#=GS A0A2Y9QSG0_TRIMA/299-381    AC A0A2Y9QSG0.1
#=GS A0A671VHY6_SPAAU/279-357    AC A0A671VHY6.1
#=GS A0A3Q2H1C4_HORSE/284-421    AC A0A3Q2H1C4.1
#=GS A0A672Z4I1_9TELE/236-377    AC A0A672Z4I1.1
#=GS A0A3Q3ADB6_KRYMA/298-377    AC A0A3Q3ADB6.1
#=GS A0A5J5N9Z2_MUNRE/282-418    AC A0A5J5N9Z2.1
#=GS A0A671XVD8_SPAAU/305-375    AC A0A671XVD8.1
#=GS A0A4W5RQ50_9TELE/284-419    AC A0A4W5RQ50.1
#=GS A0A3Q1E9V9_9TELE/306-385    AC A0A3Q1E9V9.1
#=GS A0A4W3K5Q3_CALMI/291-401    AC A0A4W3K5Q3.1
#=GS A0A3Q3WTR8_MOLML/286-419    AC A0A3Q3WTR8.1
#=GS A0A672Z4N3_9TELE/281-402    AC A0A672Z4N3.1
#=GS A0A2K5PWB1_CEBCA/284-421    AC A0A2K5PWB1.1
#=GS A0A3Q1ITJ4_ANATE/288-365    AC A0A3Q1ITJ4.1
#=GS A0A402ESW3_9SAUR/285-420    AC A0A402ESW3.1
#=GS A0A060Z096_ONCMY/204-282    AC A0A060Z096.1
#=GS A0A2K5WBL6_MACFA/299-381    AC A0A2K5WBL6.1
#=GS W5L4R3_ASTMX/248-383        AC W5L4R3.2
#=GS A0A667XGV8_9TELE/277-401    AC A0A667XGV8.1
#=GS A0A2Y9SYZ0_PHYMC/299-381    AC A0A2Y9SYZ0.1
#=GS H2TE39_TAKRU/290-403        AC H2TE39.3
#=GS A0A669ERW6_ORENI/274-394    AC A0A669ERW6.1
#=GS A0A4W5QQN9_9TELE/283-420    AC A0A4W5QQN9.1
#=GS A0A6I8S3U7_XENTR/290-346    AC A0A6I8S3U7.1
#=GS A0A667XEA2_9TELE/290-371    AC A0A667XEA2.1
#=GS A0A671UPH5_SPAAU/290-364    AC A0A671UPH5.1
#=GS A0A672J8T1_SALFA/285-420    AC A0A672J8T1.1
#=GS A0A670KCQ3_PODMU/295-380    AC A0A670KCQ3.1
#=GS A0A662YT38_ACIRT/308-390    AC A0A662YT38.1
#=GS A0A4W2DG60_BOBOX/327-359    AC A0A4W2DG60.1
#=GS A0A4W3HIY6_CALMI/290-365    AC A0A4W3HIY6.1
#=GS A0A4W3JB84_CALMI/331-402    AC A0A4W3JB84.1
#=GS A0A671XZ85_SPAAU/272-347    AC A0A671XZ85.1
#=GS A0A091IV20_EGRGA/295-380    AC A0A091IV20.1
#=GS A0A6I8QWJ3_XENTR/237-313    AC A0A6I8QWJ3.1
#=GS A0A673A5U9_9TELE/296-384    AC A0A673A5U9.1
#=GS A0A3Q3LH92_9TELE/305-383    AC A0A3Q3LH92.1
#=GS A0A6I8QQW9_XENTR/246-325    AC A0A6I8QQW9.1
#=GS A0A6I8P5T5_ORNAN/308-446    AC A0A6I8P5T5.1
#=GS A0A3P8SSF8_AMPPE/282-419    AC A0A3P8SSF8.1
#=GS A0A672JQG9_SALFA/222-303    AC A0A672JQG9.1
#=GS A0A6Q2ZE69_ESOLU/294-377    AC A0A6Q2ZE69.1
#=GS S9X5J1_CAMFR/400-537        AC S9X5J1.1
#=GS A0A665VPK8_ECHNA/313-385    AC A0A665VPK8.1
#=GS A0A2K5F005_AOTNA/285-427    AC A0A2K5F005.1
#=GS A0A674EB72_SALTR/374-404    AC A0A674EB72.1
#=GS A0A672ZI98_9TELE/297-376    AC A0A672ZI98.1
#=GS A0A672JDP8_SALFA/230-303    AC A0A672JDP8.1
#=GS A0A4W6CM65_LATCA/264-368    AC A0A4W6CM65.1
#=GS E1BCP6_BOVIN/299-381        AC E1BCP6.2
#=GS I3N6E8_ICTTR/284-421        AC I3N6E8.2
#=GS A0A6Q2Y8A7_ESOLU/263-382    AC A0A6Q2Y8A7.1
#=GS A0A498NAB0_LABRO/247-384    AC A0A498NAB0.1
#=GS A0A3N0XJD9_ANAGA/835-933    AC A0A3N0XJD9.1
#=GS G1P9Z2_MYOLU/284-421        AC G1P9Z2.1
#=GS A0A485NGP8_LYNPA/275-357    AC A0A485NGP8.1
#=GS A0A672J853_SALFA/284-414    AC A0A672J853.1
#=GS A0A2K6ARQ3_MACNE/284-421    AC A0A2K6ARQ3.1
#=GS A0A674MA01_TAKRU/293-452    AC A0A674MA01.1
#=GS A0A672JFN9_SALFA/257-390    AC A0A672JFN9.1
#=GS A0A6I8QGV3_XENTR/287-363    AC A0A6I8QGV3.1
#=GS A0A4W4ECE2_ELEEL/283-402    AC A0A4W4ECE2.1
#=GS A0A6I8S133_XENTR/235-311    AC A0A6I8S133.1
#=GS A0A3Q2DQ66_CYPVA/301-434    AC A0A3Q2DQ66.1
#=GS A0A4W5RTQ8_9TELE/284-419    AC A0A4W5RTQ8.1
#=GS A0A6I8N379_ORNAN/328-395    AC A0A6I8N379.1
#=GS A0A4W4EQ80_ELEEL/88-226     AC A0A4W4EQ80.1
#=GS F6WH53_MONDO/297-379        AC F6WH53.2
#=GS A0A5N5KL54_PANHP/283-418    AC A0A5N5KL54.1
#=GS A0A672ZIB2_9TELE/288-367    AC A0A672ZIB2.1
#=GS A0A670K8H6_PODMU/259-340    AC A0A670K8H6.1
#=GS S9YWR6_CAMFR/290-374        AC S9YWR6.1
#=GS A0A3Q0FYA4_ALLSI/340-370    AC A0A3Q0FYA4.1
#=GS A0A315VU87_GAMAF/377-457    AC A0A315VU87.1
#=GS L9L1A5_TUPCH/206-296        AC L9L1A5.1
#=GS A0A3Q1I9B4_ANATE/290-370    AC A0A3Q1I9B4.1
#=GS A0A4W3J8R4_CALMI/278-416    AC A0A4W3J8R4.1
#=GS A0A1U7STL7_CARSF/298-380    AC A0A1U7STL7.1
#=GS A0A5E4AAK5_MARMO/286-430    AC A0A5E4AAK5.1
#=GS A0A669F017_ORENI/267-406    AC A0A669F017.1
#=GS A0A4W4HF05_ELEEL/257-381    AC A0A4W4HF05.1
#=GS A0A665UQW1_ECHNA/318-389    AC A0A665UQW1.1
#=GS K7FRF6_PELSI/307-445        AC K7FRF6.1
#=GS A0A4W5MRJ6_9TELE/230-355    AC A0A4W5MRJ6.1
#=GS A0A4W4GEM0_ELEEL/286-366    AC A0A4W4GEM0.1
#=GS A0A3Q7TQE3_VULVU/216-298    AC A0A3Q7TQE3.1
#=GS A0A674DZJ8_SALTR/295-399    AC A0A674DZJ8.1
#=GS A0A2K5EZD2_AOTNA/272-331    AC A0A2K5EZD2.1
#=GS A0A6Q2YV58_ESOLU/272-375    AC A0A6Q2YV58.1
#=GS A0A670IZT7_PODMU/284-419    AC A0A670IZT7.1
#=GS A0A3P8WTB1_CYNSE/298-422    AC A0A3P8WTB1.1
#=GS A0A384C412_URSMA/299-381    AC A0A384C412.1
#=GS A0A4W5QDY5_9TELE/295-370    AC A0A4W5QDY5.1
#=GS A0A4W5QLH3_9TELE/231-309    AC A0A4W5QLH3.1
#=GS A0A5E4ALU8_MARMO/272-409    AC A0A5E4ALU8.1
#=GS A0A3S2PRF2_ORYJA/275-363    AC A0A3S2PRF2.1
#=GS A0A672UTK9_STRHB/277-410    AC A0A672UTK9.1
#=GS G3SSY6_LOXAF/281-418        AC G3SSY6.1
#=GS A0A091GBI7_9AVES/244-384    AC A0A091GBI7.1
#=GS A0A672ISU6_SALFA/267-372    AC A0A672ISU6.1
#=GS A0A669EKS1_ORENI/229-354    AC A0A669EKS1.1
#=GS A0A673XR93_SALTR/274-352    AC A0A673XR93.1
#=GS A0A673UGX1_SURSU/181-324    AC A0A673UGX1.1
#=GS A0A2K5EZ81_AOTNA/284-421    AC A0A2K5EZ81.1
#=GS A0A340XM97_LIPVE/284-421    AC A0A340XM97.1
#=GS A0A2U3WH50_ODORO/297-379    AC A0A2U3WH50.1
#=GS A0A3Q1ANZ7_AMPOC/302-397    AC A0A3Q1ANZ7.1
#=GS A0A6I8NMG4_ORNAN/284-421    AC A0A6I8NMG4.1
#=GS A0A1U7R5X2_MESAU/284-420    AC A0A1U7R5X2.1
#=GS G3RK14_GORGO/284-421        AC G3RK14.1
#=GS A0A667XPA8_9TELE/315-359    AC A0A667XPA8.1
#=GS A0A4W6EKQ7_LATCA/290-370    AC A0A4W6EKQ7.1
#=GS A0A091L3K5_CATAU/175-308    AC A0A091L3K5.1
#=GS A0A672V266_STRHB/205-290    AC A0A672V266.1
#=GS A0A3Q1IH21_ANATE/288-365    AC A0A3Q1IH21.1
#=GS G5B225_HETGA/286-430        AC G5B225.1
#=GS H0V6S7_CAVPO/284-422        AC H0V6S7.2
#=GS A0A3Q0GQF4_ALLSI/297-379    AC A0A3Q0GQF4.1
#=GS Q9TTJ0_PIG/299-381          AC Q9TTJ0.1
#=GS F7BLR3_HORSE/272-409        AC F7BLR3.3
#=GS A0A672H5T4_SALFA/115-248    AC A0A672H5T4.1
#=GS A0A0P7V4D3_SCLFO/281-418    AC A0A0P7V4D3.1
#=GS A0A3P8WKX7_CYNSE/303-381    AC A0A3P8WKX7.1
#=GS A0A2R8ZP32_PANPA/299-381    AC A0A2R8ZP32.1
#=GS A0A673Y892_SALTR/259-393    AC A0A673Y892.1
#=GS A0A2I0MG33_COLLI/295-379    AC A0A2I0MG33.1
#=GS A0A4W5MM92_9TELE/283-359    AC A0A4W5MM92.1
#=GS A0A4W5MQC8_9TELE/282-416    AC A0A4W5MQC8.1
#=GS A0A2K6P3E5_RHIRO/240-322    AC A0A2K6P3E5.1
#=GS A0A673WTA2_SALTR/290-368    AC A0A673WTA2.1
#=GS A0A4W6EJS4_LATCA/295-375    AC A0A4W6EJS4.1
#=GS A0A452S2T0_URSAM/271-393    AC A0A452S2T0.1
#=GS A0A4W4EQ69_ELEEL/162-297    AC A0A4W4EQ69.1
#=GS A0A5N5KDW2_PANHP/282-361    AC A0A5N5KDW2.1
#=GS A0A4W6DA82_LATCA/302-434    AC A0A4W6DA82.1
#=GS A0A2R8ZF74_PANPA/284-421    AC A0A2R8ZF74.1
#=GS A0A4W3IYJ2_CALMI/281-423    AC A0A4W3IYJ2.1
#=GS A0A670KG06_PODMU/314-384    AC A0A670KG06.1
#=GS I3KJT0_ORENI/284-364        AC I3KJT0.2
#=GS A0A094L2N6_PODCR/222-306    AC A0A094L2N6.1
#=GS A0A674D745_SALTR/282-419    AC A0A674D745.1
#=GS A0A1S3KQI9_SALSA/326-404    AC A0A1S3KQI9.1
#=GS E9PPF2_HUMAN/285-432        AC E9PPF2.1
#=GS A0A0Q3V9G8_AMAAE/296-378    AC A0A0Q3V9G8.1
#=GS L5K6W6_PTEAL/291-428        AC L5K6W6.1
#=GS A0A3Q2D026_CYPVA/277-409    AC A0A3Q2D026.1
#=GS A0A665UQZ8_ECHNA/270-367    AC A0A665UQZ8.1
#=GS A0A341BFL7_NEOAA/286-432    AC A0A341BFL7.1
#=GS A0A3P9ANB0_ESOLU/282-413    AC A0A3P9ANB0.2
#=GS G3H4C8_CRIGR/83-112         AC G3H4C8.1
#=GS A0A4W6CM15_LATCA/263-363    AC A0A4W6CM15.1
#=GS A0A452DQ67_CAPHI/299-381    AC A0A452DQ67.1
#=GS A0A4W3JY01_CALMI/252-334    AC A0A4W3JY01.1
#=GS A0A663FA97_AQUCH/295-379    AC A0A663FA97.1
#=GS A0A4W4ENT3_ELEEL/128-254    AC A0A4W4ENT3.1
#=GS A0A3Q3RYN4_9TELE/305-383    AC A0A3Q3RYN4.1
#=GS A0A4W4ED95_ELEEL/283-420    AC A0A4W4ED95.1
#=GS W5L4W4_ASTMX/257-358        AC W5L4W4.2
#=GS A0A4U1FJH6_MONMO/332-407    AC A0A4U1FJH6.1
#=GS A0A1A6HG24_NEOLE/226-306    AC A0A1A6HG24.1
#=GS A0A5F7ZBH2_MACMU/274-358    AC A0A5F7ZBH2.1
#=GS A0A2K5ITF8_COLAP/285-432    AC A0A2K5ITF8.1
#=GS A0A6Q2Z3C9_ESOLU/263-366    AC A0A6Q2Z3C9.1
#=GS A0A671V4P1_SPAAU/257-396    AC A0A671V4P1.1
#=GS A0A3L8R0H9_CHLGU/329-404    AC A0A3L8R0H9.1
#=GS A0A672JTN1_SALFA/198-330    AC A0A672JTN1.1
#=GS A0A4U1FH19_MONMO/350-487    AC A0A4U1FH19.1
#=GS A0A6Q2WUD5_ESOLU/243-392    AC A0A6Q2WUD5.1
#=GS A0A2K5F071_AOTNA/285-427    AC A0A2K5F071.1
#=GS B7ZU18_XENTR/283-359        AC B7ZU18.1
#=GS A0A665UQH3_ECHNA/282-411    AC A0A665UQH3.1
#=GS L8YCU2_TUPCH/278-350        AC L8YCU2.1
#=GS A0A3Q0GJJ7_ALLSI/407-547    AC A0A3Q0GJJ7.1
#=GS A0A6Q2WZL3_ESOLU/247-380    AC A0A6Q2WZL3.1
#=GS A0A672IF37_SALFA/245-382    AC A0A672IF37.1
#=GS A0A669CSF9_ORENI/293-373    AC A0A669CSF9.1
#=GS A0A340XLT5_LIPVE/272-357    AC A0A340XLT5.1
#=GS A0A4D9F7U6_9SAUR/257-308    AC A0A4D9F7U6.1
#=GS A0A6I8QQ90_XENTR/291-439    AC A0A6I8QQ90.1
#=GS A0A2I0TMR2_LIMLA/390-523    AC A0A2I0TMR2.1
#=GS A0A087VRZ8_BALRE/284-417    AC A0A087VRZ8.1
#=GS A0A671VL57_SPAAU/290-368    AC A0A671VL57.1
#=GS A0A673WNR7_SALTR/295-378    AC A0A673WNR7.1
#=GS A0A4W3JVI8_CALMI/266-308    AC A0A4W3JVI8.1
#=GS H2V1W5_TAKRU/292-370        AC H2V1W5.3
#=GS A0A452S216_URSAM/267-394    AC A0A452S216.1
#=GS A0A672ZG17_9TELE/307-386    AC A0A672ZG17.1
#=GS A0A669CFP9_ORENI/325-370    AC A0A669CFP9.1
#=GS A0A3Q7VNC1_URSAR/284-421    AC A0A3Q7VNC1.1
#=GS A0A2F0AYP7_ESCRO/1-29       AC A0A2F0AYP7.1
#=GS A0A2K6NJZ6_RHIRO/273-357    AC A0A2K6NJZ6.1
#=GS A0A4W5RQ31_9TELE/284-419    AC A0A4W5RQ31.1
#=GS M3Y5N7_MUSPF/286-429        AC M3Y5N7.1
#=GS A0A3Q4G7N9_NEOBR/273-355    AC A0A3Q4G7N9.1
#=GS A0A1S2ZMB9_ERIEU/299-381    AC A0A1S2ZMB9.1
#=GS A0A671XT81_SPAAU/308-387    AC A0A671XT81.1
#=GS A0A4W5RTU3_9TELE/228-367    AC A0A4W5RTU3.1
#=GS A0A671UPP1_SPAAU/198-269    AC A0A671UPP1.1
#=GS A0A4W5MK90_9TELE/219-297    AC A0A4W5MK90.1
#=GS A0A671XSJ1_SPAAU/301-376    AC A0A671XSJ1.1
#=GS A0A2K6LW13_RHIBE/281-357    AC A0A2K6LW13.1
#=GS M3XNR7_MUSPF/284-421        AC M3XNR7.1
#=GS A0A6I8SGI2_XENTR/287-427    AC A0A6I8SGI2.1
#=GS A0A5F9ZHN8_HUMAN/240-377    AC A0A5F9ZHN8.1
#=GS A0A218UJX7_9PASE/283-413    AC A0A218UJX7.1
#=GS A0A4W5MQS6_9TELE/281-418    AC A0A4W5MQS6.1
#=GS A0A2K6N0R1_RHIBE/226-308    AC A0A2K6N0R1.1
#=GS A0A5F8GX05_MONDO/261-304    AC A0A5F8GX05.1
#=GS JAK2_PONAB/299-381          AC Q5RB23.1
#=GS A0A4W3JVJ3_CALMI/222-292    AC A0A4W3JVJ3.1
#=GS A0A667Y0C7_9TELE/282-396    AC A0A667Y0C7.1
#=GS A0A673YFF4_SALTR/294-368    AC A0A673YFF4.1
#=GS A0A093PY01_9PASS/295-379    AC A0A093PY01.1
#=GS A0A672JDT2_SALFA/241-321    AC A0A672JDT2.1
#=GS A0A0A0MUA2_PAPAN/285-432    AC A0A0A0MUA2.2
#=GS A0A2U3Y110_LEPWE/119-201    AC A0A2U3Y110.1
#=GS A0A341BFK7_NEOAA/303-449    AC A0A341BFK7.1
#=GS A0A6I8SJW1_XENTR/190-266    AC A0A6I8SJW1.1
#=GS A0A4W4FCL1_ELEEL/276-414    AC A0A4W4FCL1.1
#=GS A0A671XVR3_SPAAU/201-340    AC A0A671XVR3.1
#=GS A0A341AKB6_NEOAA/299-381    AC A0A341AKB6.1
#=GS A0A6A5ENF9_PERFL/352-433    AC A0A6A5ENF9.1
#=GS A0A673WG24_SALTR/290-368    AC A0A673WG24.1
#=GS A0A673A497_9TELE/262-363    AC A0A673A497.1
#=GS H0X6H8_OTOGA/299-381        AC H0X6H8.1
#=GS A0A4W5MIY8_9TELE/229-307    AC A0A4W5MIY8.1
#=GS A0A452DZ12_CAPHI/273-357    AC A0A452DZ12.1
#=GS A0A2K5WBJ6_MACFA/299-381    AC A0A2K5WBJ6.1
#=GS A0A1S3KQJ9_SALSA/177-255    AC A0A1S3KQJ9.1
#=GS A0A341D8D9_NEOAA/284-357    AC A0A341D8D9.1
#=GS A0A6A5FHI0_PERFL/292-370    AC A0A6A5FHI0.1
#=GS A0A3P9NV34_POERE/363-442    AC A0A3P9NV34.1
#=GS A0A4W4HE37_ELEEL/210-290    AC A0A4W4HE37.1
#=GS L8YCU2_TUPCH/232-286        AC L8YCU2.1
#=GS A0A2Y9DZP7_TRIMA/283-359    AC A0A2Y9DZP7.1
#=GS A0A4W3H2H1_CALMI/269-344    AC A0A4W3H2H1.1
#=GS A0A673YH93_SALTR/238-367    AC A0A673YH93.1
#=GS A0A0Q3U4V2_AMAAE/294-427    AC A0A0Q3U4V2.1
#=GS A0A6Q2ZI16_ESOLU/273-376    AC A0A6Q2ZI16.1
#=GS A0A6I8QIM9_XENTR/283-419    AC A0A6I8QIM9.1
#=GS H0VRI8_CAVPO/202-284        AC H0VRI8.2
#=GS H3A1R3_LATCH/1-19           AC H3A1R3.1
#=GS A0A452QRG6_URSAM/302-378    AC A0A452QRG6.1
#=GS A0A484CLG6_PERFV/307-386    AC A0A484CLG6.1
#=GS A0A665WVI0_ECHNA/227-326    AC A0A665WVI0.1
#=GS A0A4W5QL77_9TELE/245-380    AC A0A4W5QL77.1
#=GS A0A673A3Z1_9TELE/283-365    AC A0A673A3Z1.1
#=GS A0A4W5QR99_9TELE/264-390    AC A0A4W5QR99.1
#=GS F6TJR2_ORNAN/297-379        AC F6TJR2.2
#=GS A0A096MF50_POEFO/310-384    AC A0A096MF50.1
#=GS A0A667XE92_9TELE/283-361    AC A0A667XE92.1
#=GS A0A444UMW8_ACIRT/266-404    AC A0A444UMW8.1
#=GS A0A2K6T879_SAIBB/284-421    AC A0A2K6T879.1
#=GS A0A671VZS2_SPAAU/285-415    AC A0A671VZS2.1
#=GS H2L7P4_ORYLA/295-373        AC H2L7P4.2
#=GS A0A226PRN9_COLVI/392-525    AC A0A226PRN9.1
#=GS A0A5C6NGK3_9TELE/220-348    AC A0A5C6NGK3.1
#=GS A0A383Z2F5_BALAS/286-413    AC A0A383Z2F5.1
#=GS A0A485ND59_LYNPA/277-357    AC A0A485ND59.1
#=GS A0A3P9Q7T0_POERE/301-434    AC A0A3P9Q7T0.1
#=GS A0A4W6C0R2_LATCA/269-391    AC A0A4W6C0R2.1
#=GS A0A672IEU1_SALFA/281-363    AC A0A672IEU1.1
#=GS A0A099ZDF1_TINGU/295-380    AC A0A099ZDF1.1
#=GS A0A553QH32_9TELE/267-383    AC A0A553QH32.1
#=GS A0A5C6MXB5_9TELE/257-380    AC A0A5C6MXB5.1
#=GS A0A2R8MWV0_CALJA/285-432    AC A0A2R8MWV0.1
#=GS A0A665VJZ6_ECHNA/284-366    AC A0A665VJZ6.1
#=GS A0A4X2LVA4_VOMUR/268-415    AC A0A4X2LVA4.1
#=GS A0A1S3QZA5_SALSA/275-415    AC A0A1S3QZA5.1
#=GS A0A4W6CM67_LATCA/255-365    AC A0A4W6CM67.1
#=GS A0A553R0X8_9TELE/252-331    AC A0A553R0X8.1
#=GS A0A5N3X2V0_MUNRE/223-305    AC A0A5N3X2V0.1
#=GS A0A4W6DA55_LATCA/280-397    AC A0A4W6DA55.1
#=GS A0A5A9P0E1_9TELE/81-193     AC A0A5A9P0E1.1
#=GS A0A4W6CLW5_LATCA/285-365    AC A0A4W6CLW5.1
#=GS A0A671XSI6_SPAAU/308-387    AC A0A671XSI6.1
#=GS A0A452QRF7_URSAM/299-381    AC A0A452QRF7.1
#=GS I3IZB2_ORENI/280-414        AC I3IZB2.2
#=GS A0A668AEH8_9TELE/304-430    AC A0A668AEH8.1
#=GS A0A3Q3VYG3_MOLML/251-374    AC A0A3Q3VYG3.1
#=GS A0A218U785_9PASE/37-172     AC A0A218U785.1
#=GS A0A6Q2ZI51_ESOLU/241-345    AC A0A6Q2ZI51.1
#=GS A0A672JFB2_SALFA/245-361    AC A0A672JFB2.1
#=GS A0A5J5DA65_9PERO/290-365    AC A0A5J5DA65.1
#=GS A0A669BEQ1_ORENI/332-411    AC A0A669BEQ1.1
#=GS A0A673YG77_SALTR/288-420    AC A0A673YG77.1
#=GS A0A5E4AMF8_MARMO/272-409    AC A0A5E4AMF8.1
#=GS A0A672JE28_SALFA/245-325    AC A0A672JE28.1
#=GS A0A674NBS3_TAKRU/296-429    AC A0A674NBS3.1
#=GS A0A672JTM0_SALFA/215-296    AC A0A672JTM0.1
#=GS A0A091CVI5_FUKDA/735-764    AC A0A091CVI5.1
#=GS A0A2Y9LU92_DELLE/286-432    AC A0A2Y9LU92.1
#=GS A0A671VHJ0_SPAAU/293-371    AC A0A671VHJ0.1
#=GS A0A3Q7RA95_VULVU/284-421    AC A0A3Q7RA95.1
#=GS A0A5E4AA88_MARMO/286-430    AC A0A5E4AA88.1
#=GS A0A2Y9HKV9_NEOSC/297-379    AC A0A2Y9HKV9.1
#=GS A0A2Y9LBA5_ENHLU/299-442    AC A0A2Y9LBA5.1
#=GS A0A5F4D515_CANLF/202-314    AC A0A5F4D515.1
#=GS G3U018_LOXAF/288-425        AC G3U018.1
#=GS A0A2K5Q799_CEBCA/285-432    AC A0A2K5Q799.1
#=GS A0A669C8K4_ORENI/268-397    AC A0A669C8K4.1
#=GS A0A3Q1FC04_9TELE/292-370    AC A0A3Q1FC04.1
#=GS A0A673A714_9TELE/168-272    AC A0A673A714.1
#=GS A0A0A0MTV7_PAPAN/285-432    AC A0A0A0MTV7.2
#=GS W5MIP2_LEPOC/280-415        AC W5MIP2.1
#=GS A0A2K5VPQ0_MACFA/285-432    AC A0A2K5VPQ0.1
#=GS A0A665WVV2_ECHNA/262-361    AC A0A665WVV2.1
#=GS A0A1U7QD80_MESAU/299-381    AC A0A1U7QD80.1
#=GS S7PNQ5_MYOBR/380-464        AC S7PNQ5.1
#=GS E9PM19_HUMAN/100-247        AC E9PM19.1
#=GS A0A673WGR6_SALTR/247-325    AC A0A673WGR6.1
#=GS A0A673WSY6_SALTR/296-374    AC A0A673WSY6.1
#=GS A0A2K6U8W2_SAIBB/316-400    AC A0A2K6U8W2.1
#=GS A0A452RVG9_URSAM/283-357    AC A0A452RVG9.1
#=GS A0A3Q1BRP3_AMPOC/283-363    AC A0A3Q1BRP3.1
#=GS A0A402FYP1_9SAUR/341-389    AC A0A402FYP1.1
#=GS A0A671VZX6_SPAAU/286-403    AC A0A671VZX6.1
#=GS H2VE39_TAKRU/281-414        AC H2VE39.3
#=GS A0A091I5H9_CALAN/298-380    AC A0A091I5H9.1
#=GS A0A3P9Q8Q5_POERE/301-434    AC A0A3P9Q8Q5.1
#=GS A0A226MBR6_CALSU/444-580    AC A0A226MBR6.1
#=GS G1RYT5_NOMLE/283-418        AC G1RYT5.2
#=GS A0A673BZR6_9TELE/280-311    AC A0A673BZR6.1
#=GS A0A6Q2YVQ3_ESOLU/166-239    AC A0A6Q2YVQ3.1
#=GS A0A662YQC4_ACIRT/1882-1959  AC A0A662YQC4.1
#=GS A0A672UXK2_STRHB/286-421    AC A0A672UXK2.1
#=GS A0A672JDA0_SALFA/243-323    AC A0A672JDA0.1
#=GS A0A669CD94_ORENI/345-389    AC A0A669CD94.1
#=GS A0A2K6P929_RHIRO/285-432    AC A0A2K6P929.1
#=GS A0A4W5Q4V4_9TELE/340-475    AC A0A4W5Q4V4.1
#=GS A0A673XY37_SALTR/276-352    AC A0A673XY37.1
#=GS H2TE41_TAKRU/271-384        AC H2TE41.3
#=GS A0A1U7R3C7_MESAU/290-433    AC A0A1U7R3C7.1
#=GS A0A3Q1K6Q1_ANATE/306-385    AC A0A3Q1K6Q1.1
#=GS A0A091R6W6_MERNU/284-417    AC A0A091R6W6.1
#=GS A0A2K6NK05_RHIRO/218-302    AC A0A2K6NK05.1
#=GS A0A3Q2HL76_HORSE/284-421    AC A0A3Q2HL76.2
#=GS A0A4W6DA50_LATCA/274-396    AC A0A4W6DA50.1
#=GS A0A0P7WH47_SCLFO/290-370    AC A0A0P7WH47.1
#=GS M3ZLD9_XIPMA/293-373        AC M3ZLD9.1
#=GS H2QWZ4_PANTR/299-381        AC H2QWZ4.2
#=GS G3PKI3_GASAC/290-370        AC G3PKI3.1
#=GS A0A674PFU5_TAKRU/277-402    AC A0A674PFU5.1
#=GS A0A2K6N0V3_RHIBE/256-338    AC A0A2K6N0V3.1
#=GS A0A0R4ICU5_DANRE/283-365    AC A0A0R4ICU5.1
#=GS A0A4W6CM50_LATCA/255-334    AC A0A4W6CM50.1
#=GS A0A1S3ADN5_ERIEU/278-352    AC A0A1S3ADN5.1
#=GS A0A663FKI4_AQUCH/284-417    AC A0A663FKI4.1
#=GS A0A663DQT3_AQUCH/287-429    AC A0A663DQT3.1
#=GS F1LR79_RAT/277-354          AC F1LR79.2
#=GS A0A4W5QJI0_9TELE/276-354    AC A0A4W5QJI0.1
#=GS A0A3Q2TXU4_CHICK/297-379    AC A0A3Q2TXU4.1
#=GS A0A2J7R3I0_9NEOP/221-304    AC A0A2J7R3I0.1
#=GS A0A5F4BRD0_CANLF/574-656    AC A0A5F4BRD0.1
#=GS A0A2K6N0Q5_RHIBE/336-418    AC A0A2K6N0Q5.1
#=GS A0A4W5MM75_9TELE/281-418    AC A0A4W5MM75.1
#=GS A0A6I8QZ07_XENTR/294-432    AC A0A6I8QZ07.1
#=GS A0A672ZK88_9TELE/262-332    AC A0A672ZK88.1
#=GS A0A668A5H5_9TELE/273-400    AC A0A668A5H5.1
#=GS A0A4X2M7E6_VOMUR/239-386    AC A0A4X2M7E6.1
#=GS A0A5F4C7C6_CANLF/272-420    AC A0A5F4C7C6.1
#=GS A0A452S2E2_URSAM/267-394    AC A0A452S2E2.1
#=GS JAK1_DANRE/282-417          AC O12990.1
#=GS A0A671XSS2_SPAAU/200-276    AC A0A671XSS2.1
#=GS A0A4W4EFR3_ELEEL/281-416    AC A0A4W4EFR3.1
#=GS A0A4X2L5P7_VOMUR/285-357    AC A0A4X2L5P7.1
#=GS S7MJU2_MYOBR/227-309        AC S7MJU2.1
#=GS K7GSE8_PIG/273-356          AC K7GSE8.1
#=GS A0A2K5F086_AOTNA/285-427    AC A0A2K5F086.1
#=GS A0A3Q7V4V1_URSAR/283-357    AC A0A3Q7V4V1.1
#=GS A0A4W6CM31_LATCA/279-359    AC A0A4W6CM31.1
#=GS A0A2K6FGU0_PROCO/284-421    AC A0A2K6FGU0.1
#=GS A0A5E4A9W2_MARMO/286-430    AC A0A5E4A9W2.1
#=GS A0A6G1AVY6_CROCR/284-420    AC A0A6G1AVY6.1
#=GS A0A671XSY0_SPAAU/298-373    AC A0A671XSY0.1
#=GS A0A4U1F8P3_MONMO/463-545    AC A0A4U1F8P3.1
#=GS A0A2U3Z0Y0_LEPWE/272-357    AC A0A2U3Z0Y0.1
#=GS A0A2U9CF62_SCOMX/312-412    AC A0A2U9CF62.1
#=GS A0A091XF04_OPIHO/298-380    AC A0A091XF04.1
#=GS A0A673XYW0_SALTR/291-369    AC A0A673XYW0.1
#=GS A0A673Y5Y9_SALTR/260-397    AC A0A673Y5Y9.1
#=GS F1PBD0_CANLF/272-413        AC F1PBD0.3
#=GS A0A384C3J0_URSMA/284-421    AC A0A384C3J0.1
#=GS A0A2K5Q1Z6_CEBCA/299-381    AC A0A2K5Q1Z6.1
#=GS A0A401NV79_SCYTO/364-505    AC A0A401NV79.1
#=GS A0A667ZF98_9TELE/287-366    AC A0A667ZF98.1
#=GS A0A3P9CKW9_9CICH/307-386    AC A0A3P9CKW9.1
#=GS A0A4W5RE64_9TELE/154-203    AC A0A4W5RE64.1
#=GS A0A2Y9G9Q3_NEOSC/284-421    AC A0A2Y9G9Q3.1
#=GS A0A672IG66_SALFA/257-364    AC A0A672IG66.1
#=GS X1WHN6_DANRE/259-360        AC X1WHN6.3
#=GS A0A5N4CLW7_CAMDR/317-401    AC A0A5N4CLW7.1
#=GS A0A672JAY8_SALFA/222-297    AC A0A672JAY8.1
#=GS G3QSH5_GORGO/273-357        AC G3QSH5.2
#=GS A0A3S2MYF5_ORYJA/279-406    AC A0A3S2MYF5.1
#=GS G3IEQ4_CRIGR/289-371        AC G3IEQ4.1
#=GS A0A1L8HY58_XENLA/297-379    AC A0A1L8HY58.1
#=GS A0A091TPR4_PELCR/295-380    AC A0A091TPR4.1
#=GS A0A674HNV0_TAEGU/283-413    AC A0A674HNV0.1
#=GS A0A672IVQ7_SALFA/273-378    AC A0A672IVQ7.1
#=GS A0A4W4GFW2_ELEEL/288-360    AC A0A4W4GFW2.1
#=GS A0A4W6EKN6_LATCA/292-370    AC A0A4W6EKN6.1
#=GS I3K427_ORENI/326-414        AC I3K427.2
#=GS A0A1S3LTH7_SALSA/291-369    AC A0A1S3LTH7.1
#=GS A0A384A4I8_BALAS/299-381    AC A0A384A4I8.1
#=GS A0A4W4H6Z5_ELEEL/224-319    AC A0A4W4H6Z5.1
#=GS A0A4W6C123_LATCA/289-423    AC A0A4W6C123.1
#=GS A0A5A9PCH4_9TELE/250-386    AC A0A5A9PCH4.1
#=GS W5MIN0_LEPOC/284-419        AC W5MIN0.1
#=GS A0A4W4EP58_ELEEL/158-291    AC A0A4W4EP58.1
#=GS W5PVH1_SHEEP/299-381        AC W5PVH1.1
#=GS A0A673YF71_SALTR/292-366    AC A0A673YF71.1
#=GS A0A4W3JUV1_CALMI/283-425    AC A0A4W3JUV1.1
#=GS A0A485NN57_LYNPA/136-217    AC A0A485NN57.1
#=GS A0A665UQE7_ECHNA/301-431    AC A0A665UQE7.1
#=GS A0A4W4EGP8_ELEEL/298-435    AC A0A4W4EGP8.1
#=GS A0A673C8F6_9TELE/315-383    AC A0A673C8F6.1
#=GS A0A4W5MLC8_9TELE/295-373    AC A0A4W5MLC8.1
#=GS A0A671W3K5_SPAAU/261-381    AC A0A671W3K5.1
#=GS A0A2K6JTR6_RHIBE/290-427    AC A0A2K6JTR6.1
#=GS A0A669B420_ORENI/274-403    AC A0A669B420.1
#=GS A0A674D7B8_SALTR/282-419    AC A0A674D7B8.1
#=GS A0A6Q2Z134_ESOLU/293-374    AC A0A6Q2Z134.1
#=GS A0A670K528_PODMU/295-380    AC A0A670K528.1
#=GS A0A670KAY1_PODMU/100-201    AC A0A670KAY1.1
#=GS A0A6J3R6N7_TURTR/325-401    AC A0A6J3R6N7.1
#=GS A0A673YIJ0_SALTR/252-384    AC A0A673YIJ0.1
#=GS A0A6I8QZL9_XENTR/297-379    AC A0A6I8QZL9.1
#=GS A0A5G2R6U0_PIG/236-318      AC A0A5G2R6U0.1
#=GS A0A091CUK2_FUKDA/316-453    AC A0A091CUK2.1
#=GS A0A556VU80_BAGYA/311-446    AC A0A556VU80.1
#=GS A0A2I4CIS6_9TELE/281-412    AC A0A2I4CIS6.1
#=GS A0A4U1EWU8_MONMO/286-432    AC A0A4U1EWU8.1
#=GS A0A452QRE2_URSAM/290-368    AC A0A452QRE2.1
#=GS G3NVW0_GASAC/305-437        AC G3NVW0.1
#=GS A0A6I8P0P2_ORNAN/202-277    AC A0A6I8P0P2.1
#=GS A0A6Q2XVQ0_ESOLU/263-366    AC A0A6Q2XVQ0.1
#=GS A0A4W3HJ12_CALMI/288-363    AC A0A4W3HJ12.1
#=GS G3W042_SARHA/288-435        AC G3W042.1
#=GS A0A672IDD0_SALFA/284-367    AC A0A672IDD0.1
#=GS A0A3P8WN30_CYNSE/288-395    AC A0A3P8WN30.1
#=GS A0A0R4J0R7_MOUSE/275-354    AC A0A0R4J0R7.1
#=GS A0A3P9CMC0_9CICH/278-320    AC A0A3P9CMC0.1
#=GS A0A4W3JKR6_CALMI/219-301    AC A0A4W3JKR6.1
#=GS A0A3Q3W8P7_MOLML/268-394    AC A0A3Q3W8P7.1
#=GS A0A226MI46_CALSU/270-355    AC A0A226MI46.1
#=GS A0A4W6D9H2_LATCA/219-343    AC A0A4W6D9H2.1
#=GS H0Z3Y5_TAEGU/297-379        AC H0Z3Y5.2
#=GS A0A3P8WZL7_CYNSE/282-418    AC A0A3P8WZL7.1
#=GS A0A671UP86_SPAAU/172-271    AC A0A671UP86.1
#=GS A0A401NRJ4_SCYTO/176-262    AC A0A401NRJ4.1
#=GS H3CH80_TETNG/307-390        AC H3CH80.1
#=GS A0A5N4CLX1_CAMDR/326-401    AC A0A5N4CLX1.1
#=GS A0A672JQ86_SALFA/269-375    AC A0A672JQ86.1
#=GS A0A1S3FJH6_DIPOR/284-420    AC A0A1S3FJH6.1
#=GS A0A672ZKE9_9TELE/195-267    AC A0A672ZKE9.1
#=GS A0A3Q0CF12_MESAU/356-433    AC A0A3Q0CF12.1
#=GS D2GV17_AILME/282-357        AC D2GV17.1
#=GS A0A4W5QLJ4_9TELE/283-421    AC A0A4W5QLJ4.1
#=GS G1KCE0_ANOCA/285-379        AC G1KCE0.2
#=GS A0A6I8QGD3_XENTR/212-288    AC A0A6I8QGD3.1
#=GS A0A3Q3CEY0_HAPBU/299-432    AC A0A3Q3CEY0.1
#=GS A0A667Y0Y5_9TELE/321-455    AC A0A667Y0Y5.1
#=GS A0A4W4GEL3_ELEEL/330-406    AC A0A4W4GEL3.1
#=GS A0A3P9C798_9CICH/297-377    AC A0A3P9C798.1
#=GS A0A4W3JI20_CALMI/299-381    AC A0A4W3JI20.1
#=GS A0A673XZ50_SALTR/228-306    AC A0A673XZ50.1
#=GS A0A3P8S1G4_AMPPE/286-367    AC A0A3P8S1G4.1
#=GS A0A3Q3RYC8_9TELE/246-374    AC A0A3Q3RYC8.1
#=GS A0A091NKY1_APAVI/102-223    AC A0A091NKY1.1
#=GS A0A672JQ91_SALFA/184-291    AC A0A672JQ91.1
#=GS A0A673C6K4_9TELE/282-419    AC A0A673C6K4.1
#=GS A0A337SUR0_FELCA/299-381    AC A0A337SUR0.1
#=GS A0A315UYF9_GAMAF/318-397    AC A0A315UYF9.1
#=GS A0A673XYL6_SALTR/278-356    AC A0A673XYL6.1
#=GS TYK2_HUMAN/285-432          AC P29597.3
#=GS TYK2_HUMAN/285-432          DR PDB; 4PO6 A; 285-432;
#=GS A0A1U7U068_CARSF/284-420    AC A0A1U7U068.1
#=GS A0A2K5WFZ1_MACFA/260-344    AC A0A2K5WFZ1.1
#=GS A0A340WTZ3_LIPVE/299-381    AC A0A340WTZ3.1
#=GS H0YE41_HUMAN/64-117         AC H0YE41.8
#=GS A0A452QRK9_URSAM/299-381    AC A0A452QRK9.1
#=GS A0A402FXK3_9SAUR/267-319    AC A0A402FXK3.1
#=GS A0A6Q2Y6V9_ESOLU/243-384    AC A0A6Q2Y6V9.1
#=GS M3Y0T4_MUSPF/297-379        AC M3Y0T4.1
#=GS A0A673YX36_SALTR/283-410    AC A0A673YX36.1
#=GS A0A4W5JGW4_9TELE/230-370    AC A0A4W5JGW4.1
#=GS A0A4W6C1L4_LATCA/283-400    AC A0A4W6C1L4.1
#=GS A0A2K5WFY6_MACFA/273-357    AC A0A2K5WFY6.1
#=GS F1R5C7_DANRE/282-417        AC F1R5C7.1
#=GS A0A5F4C8Z3_CANLF/299-381    AC A0A5F4C8Z3.1
#=GS A0A060VVA2_ONCMY/278-415    AC A0A060VVA2.1
#=GS A0A674HCE1_TAEGU/292-416    AC A0A674HCE1.1
#=GS A0A5F4DAD4_CANLF/191-299    AC A0A5F4DAD4.1
#=GS A0A672IWS2_SALFA/282-396    AC A0A672IWS2.1
#=GS A0A3Q7R7F6_VULVU/299-440    AC A0A3Q7R7F6.1
#=GS A0A672J911_SALFA/273-369    AC A0A672J911.1
#=GS A0A662YPR4_ACIRT/296-378    AC A0A662YPR4.1
#=GS A0A673WE61_SALTR/264-343    AC A0A673WE61.1
#=GS A0A671VHJ7_SPAAU/277-355    AC A0A671VHJ7.1
#=GS A0A3S2M0Z0_ORYJA/295-375    AC A0A3S2M0Z0.1
#=GS A0A673UT14_SURSU/284-420    AC A0A673UT14.1
#=GS A0A2K5IHF1_COLAP/284-421    AC A0A2K5IHF1.1
#=GS F6TJE9_HORSE/286-431        AC F6TJE9.2
#=GS A0A2U3W8S8_ODORO/273-357    AC A0A2U3W8S8.1
#=GS A0A553NHL3_9TELE/238-346    AC A0A553NHL3.1
#=GS A0A5F9ZI39_HUMAN/284-421    AC A0A5F9ZI39.1
#=GS A0A4W5QF79_9TELE/282-419    AC A0A4W5QF79.1
#=GS A0A672IUK2_SALFA/243-379    AC A0A672IUK2.1
#=GS A0A672Z4J3_9TELE/263-390    AC A0A672Z4J3.1
#=GS L5LC09_MYODS/248-323        AC L5LC09.1
#=GS A0A2Y9IYY8_ENHLU/272-357    AC A0A2Y9IYY8.1
#=GS A0A672IX68_SALFA/294-425    AC A0A672IX68.1
#=GS A0A4W4GEN8_ELEEL/230-326    AC A0A4W4GEN8.1
#=GS A0A2R9C1D6_PANPA/285-432    AC A0A2R9C1D6.1
#=GS G3QWD9_GORGO/299-381        AC G3QWD9.2
#=GS G3PKV8_GASAC/280-413        AC G3PKV8.1
#=GS A0A4W4GJH3_ELEEL/258-334    AC A0A4W4GJH3.1
#=GS F7DRD4_MACMU/285-432        AC F7DRD4.3
#=GS A0A5J5MYP2_MUNRE/286-432    AC A0A5J5MYP2.1
#=GS A0A099YZG4_TINGU/293-430    AC A0A099YZG4.1
#=GS A0A437DEZ3_ORYJA/297-434    AC A0A437DEZ3.1
#=GS G1KI54_ANOCA/284-424        AC G1KI54.2
#=GS A0A671VIY1_SPAAU/212-283    AC A0A671VIY1.1
#=GS A0A091UD74_PHORB/296-380    AC A0A091UD74.1
#=GS A0A665VNN0_ECHNA/264-342    AC A0A665VNN0.1
#=GS A0A091K588_COLST/252-323    AC A0A091K588.1
#=GS A0A4W3JUX4_CALMI/281-419    AC A0A4W3JUX4.1
#=GS A0A673XY40_SALTR/291-367    AC A0A673XY40.1
#=GS A0A2I3NI09_PAPAN/299-381    AC A0A2I3NI09.1
#=GS A0A452QRI0_URSAM/282-360    AC A0A452QRI0.1
#=GS A0A6Q2ZJP0_ESOLU/227-356    AC A0A6Q2ZJP0.1
#=GS A0A6I8RFQ0_XENTR/266-333    AC A0A6I8RFQ0.1
#=GS A0A091GNU7_BUCRH/285-415    AC A0A091GNU7.1
#=GS A0A668A690_9TELE/246-341    AC A0A668A690.1
#=GS A0A672Z5D3_9TELE/279-398    AC A0A672Z5D3.1
#=GS A0A4W5QP54_9TELE/273-382    AC A0A4W5QP54.1
#=GS A0A096P1M0_PAPAN/299-381    AC A0A096P1M0.2
#=GS A0A3Q0GUV9_ALLSI/297-379    AC A0A3Q0GUV9.1
#=GS A0A485MWR0_LYNPA/299-381    AC A0A485MWR0.1
#=GS A0A2Y9P436_DELLE/284-421    AC A0A2Y9P436.1
#=GS JAK3_RAT/277-354            AC Q63272.1
#=GS A0A3Q2E5B9_CYPVA/304-383    AC A0A3Q2E5B9.1
#=GS A0A093HE63_STRCA/298-380    AC A0A093HE63.1
#=GS A0A2Y9LBB1_ENHLU/299-442    AC A0A2Y9LBB1.1
#=GS A0A091Q3A9_LEPDC/295-380    AC A0A091Q3A9.1
#=GS A0A2I3RSB7_PANTR/285-432    AC A0A2I3RSB7.1
#=GS A0A669DPT6_ORENI/310-382    AC A0A669DPT6.1
#=GS A0A6Q2ZAK6_ESOLU/228-306    AC A0A6Q2ZAK6.1
#=GS A0A2Y9LL96_ENHLU/299-442    AC A0A2Y9LL96.1
#=GS A0A4W3JVC8_CALMI/279-417    AC A0A4W3JVC8.1
#=GS G3V9W2_RAT/284-421          AC G3V9W2.1
#=GS A0A310U8T2_XENLA/297-377    AC A0A310U8T2.1
#=GS A0A3Q7STG4_VULVU/282-357    AC A0A3Q7STG4.1
#=GS A0A672Z379_9TELE/279-405    AC A0A672Z379.1
#=GS A0A669D9G9_ORENI/233-308    AC A0A669D9G9.1
#=GS A0A3B1K0A2_ASTMX/250-383    AC A0A3B1K0A2.1
#=GS A0A452QRG3_URSAM/290-368    AC A0A452QRG3.1
#=GS A0A672IVE2_SALFA/260-365    AC A0A672IVE2.1
#=GS A0A674D887_SALTR/282-416    AC A0A674D887.1
#=GS H2P0I2_PONAB/130-194        AC H2P0I2.1
#=GS A0A669CF70_ORENI/213-318    AC A0A669CF70.1
#=GS A0A4W5JJL4_9TELE/247-385    AC A0A4W5JJL4.1
#=GS U3IAY8_ANAPP/294-379        AC U3IAY8.2
#=GS A0A2Y9IGV8_NEOSC/286-429    AC A0A2Y9IGV8.1
#=GS A0A3P8XPU7_ESOLU/293-375    AC A0A3P8XPU7.2
#=GS A0A5F7ZPU9_MACMU/294-441    AC A0A5F7ZPU9.1
#=GS A0A493SXP1_ANAPP/275-348    AC A0A493SXP1.1
#=GS A0A674PNA5_TAKRU/293-451    AC A0A674PNA5.1
#=GS A0A2Y9M105_DELLE/286-432    AC A0A2Y9M105.1
#=GS A0A667XWN7_9TELE/289-423    AC A0A667XWN7.1
#=GS A0A0A0MVD8_PAPAN/296-380    AC A0A0A0MVD8.2
#=GS A0A060ZAS2_ONCMY/32-150     AC A0A060ZAS2.1
#=GS A0A1S3LTD3_SALSA/291-369    AC A0A1S3LTD3.1
#=GS G3T029_LOXAF/299-381        AC G3T029.1
#=GS H3DMJ5_TETNG/107-223        AC H3DMJ5.1
#=GS A0A4W4ENR1_ELEEL/128-254    AC A0A4W4ENR1.1
#=GS A0A2Y9TGK4_PHYMC/286-432    AC A0A2Y9TGK4.1
#=GS A0A5F8G8A0_MONDO/308-338    AC A0A5F8G8A0.1
#=GS A0A667XPX5_9TELE/303-374    AC A0A667XPX5.1
#=GS A0A4W6BTP8_LATCA/308-380    AC A0A4W6BTP8.1
#=GS A0A4W3H198_CALMI/303-378    AC A0A4W3H198.1
#=GS A0A4W5QG72_9TELE/237-367    AC A0A4W5QG72.1
#=GS A0A452S1S4_URSAM/308-449    AC A0A452S1S4.1
#=GS A0A672H7E8_SALFA/280-396    AC A0A672H7E8.1
#=GS L8IF56_9CETA/273-357        AC L8IF56.1
#=GS A0A674D799_SALTR/282-414    AC A0A674D799.1
#=GS E2RG40_CANLF/272-357        AC E2RG40.3
#=GS A0A4W3J8K3_CALMI/315-465    AC A0A4W3J8K3.1
#=GS W5MVJ9_LEPOC/291-373        AC W5MVJ9.1
#=GS A0A2K5H7M5_COLAP/273-357    AC A0A2K5H7M5.1
#=GS A0A3P9C6V1_9CICH/293-373    AC A0A3P9C6V1.1
#=GS A0A091ULX3_NIPNI/296-380    AC A0A091ULX3.1
#=GS A0A5N5NIA0_PANHP/280-369    AC A0A5N5NIA0.1
#=GS A0A4W3IYT8_CALMI/260-397    AC A0A4W3IYT8.1
#=GS A0A4W5Q4S5_9TELE/336-471    AC A0A4W5Q4S5.1
#=GS A0A6Q2YX46_ESOLU/195-320    AC A0A6Q2YX46.1
#=GS A0A673XYZ4_SALTR/291-367    AC A0A673XYZ4.1
#=GS A0A5F4BUS1_CANLF/179-280    AC A0A5F4BUS1.1
#=GS A0A674MFU4_TAKRU/338-410    AC A0A674MFU4.1
#=GS A0A6I8R020_XENTR/237-313    AC A0A6I8R020.1
#=GS H2LLN7_ORYLA/284-416        AC H2LLN7.2
#=GS F1NQU4_CHICK/297-379        AC F1NQU4.2
#=GS G1SQL4_RABIT/284-421        AC G1SQL4.2
#=GS A0A226MYM3_COLVI/208-319    AC A0A226MYM3.1
#=GS A0A093QTD9_PYGAD/295-380    AC A0A093QTD9.1
#=GS A0A6A5ETV4_PERFL/299-432    AC A0A6A5ETV4.1
#=GS A0A669C4P2_ORENI/305-375    AC A0A669C4P2.1
#=GS A0A6Q2ZJM5_ESOLU/307-388    AC A0A6Q2ZJM5.1
#=GS A0A452S2S7_URSAM/286-427    AC A0A452S2S7.1
#=GS A0A3Q7R7F2_VULVU/299-440    AC A0A3Q7R7F2.1
#=GS A0A3Q2C6B5_CYPVA/261-362    AC A0A3Q2C6B5.1
#=GS A0A669CL91_ORENI/291-411    AC A0A669CL91.1
#=GS A0A673WPD6_SALTR/233-311    AC A0A673WPD6.1
#=GS A0A4W5MH14_9TELE/291-369    AC A0A4W5MH14.1
#=GS G3PZA6_GASAC/297-378        AC G3PZA6.1
#=GS A0A401RSJ1_CHIPU/283-419    AC A0A401RSJ1.1
#=GS A0A6I8P500_ORNAN/298-432    AC A0A6I8P500.1
#=GS H2M2B1_ORYLA/303-383        AC H2M2B1.2
#=GS A0A673WPG6_SALTR/290-368    AC A0A673WPG6.1
#=GS L5K8D1_PTEAL/297-379        AC L5K8D1.1
#=GS A0A2K6U928_SAIBB/273-357    AC A0A2K6U928.1
#=GS A0A3Q3G7R5_9LABR/276-415    AC A0A3Q3G7R5.1
#=GS A0A2Y9IAA7_NEOSC/118-261    AC A0A2Y9IAA7.1
#=GS A0A673YGV7_SALTR/288-423    AC A0A673YGV7.1
#=GS A0A4W3IYU9_CALMI/272-410    AC A0A4W3IYU9.1
#=GS L9KPJ3_TUPCH/299-381        AC L9KPJ3.1
#=GS A0A4W3H2D5_CALMI/325-365    AC A0A4W3H2D5.1
#=GS A0A3Q1C5G3_AMPOC/286-367    AC A0A3Q1C5G3.1
#=GS A0A4W5JJM1_9TELE/247-385    AC A0A4W5JJM1.1
#=GS A0A6I8RHJ1_XENTR/256-399    AC A0A6I8RHJ1.1
#=GS A0A669B4I1_ORENI/264-375    AC A0A669B4I1.1
#=GS A0A4W5MKF7_9TELE/280-357    AC A0A4W5MKF7.1
#=GS A0A3Q3AHA0_KRYMA/290-423    AC A0A3Q3AHA0.1
#=GS A0A3Q2LLF4_HORSE/274-357    AC A0A3Q2LLF4.1
#=GS A0A2Y9GDB3_NEOSC/284-421    AC A0A2Y9GDB3.1
#=GS A0A665VMB3_ECHNA/259-337    AC A0A665VMB3.1
#=GS JAK2_RAT/299-381            AC Q62689.1
#=GS A0A3Q7WQ56_URSAR/299-381    AC A0A3Q7WQ56.1
#=GS D3ZD03_RAT/290-433          AC D3ZD03.1
#=GS A0A6Q2ZIB1_ESOLU/221-299    AC A0A6Q2ZIB1.1
#=GS A0A3Q3LW26_9TELE/304-432    AC A0A3Q3LW26.1
#=GS A0A673A6T3_9TELE/272-346    AC A0A673A6T3.1
#=GS A0A452C7C9_BALAS/286-423    AC A0A452C7C9.1
#=GS G1NGZ6_MELGA/284-417        AC G1NGZ6.2
#=GS A0A669CBN7_ORENI/308-387    AC A0A669CBN7.1
#=GS A0A2Y9N3T7_DELLE/299-381    AC A0A2Y9N3T7.1
#=GS H3DL74_TETNG/306-422        AC H3DL74.1
#=GS G5E852_MOUSE/299-381        AC G5E852.1
#=GS A0A5N5M2M0_PANHP/285-363    AC A0A5N5M2M0.1
#=GS A0A0N8K0F6_SCLFO/295-375    AC A0A0N8K0F6.1
#=GS A0A091DCH8_FUKDA/286-431    AC A0A091DCH8.1
#=GS A0A6I8NFI0_ORNAN/331-468    AC A0A6I8NFI0.1
#=GS A0A5F9D5Z1_RABIT/301-354    AC A0A5F9D5Z1.1
#=GS A0A2R8RWH2_DANRE/234-342    AC A0A2R8RWH2.1
#=GS V8NXT0_OPHHA/271-413        AC V8NXT0.1
#=GS A0A4W5QMA6_9TELE/359-429    AC A0A4W5QMA6.1
#=GS H0YE41_HUMAN/108-145        AC H0YE41.8
#=GS A0A667ZWL7_9TELE/268-347    AC A0A667ZWL7.1
#=GS A0A669CVA8_ORENI/280-414    AC A0A669CVA8.1
#=GS A0A665WVC5_ECHNA/293-375    AC A0A665WVC5.1
#=GS G3VR92_SARHA/282-357        AC G3VR92.1
#=GS A0A672J5N6_SALFA/256-376    AC A0A672J5N6.1
#=GS A0A286XLG2_CAVPO/273-357    AC A0A286XLG2.1
#=GS A0A673C3A4_9TELE/307-339    AC A0A673C3A4.1
#=GS A0A672IT07_SALFA/244-350    AC A0A672IT07.1
#=GS A0A026WQI1_OOCBI/221-300    AC A0A026WQI1.1
#=GS A0A3Q3LUN7_9TELE/281-418    AC A0A3Q3LUN7.1
#=GS JAK3_MOUSE/275-354          AC Q62137.2
#=GS A0A315V4F5_GAMAF/278-409    AC A0A315V4F5.1
#=GS A0A2U9BTF6_SCOMX/281-363    AC A0A2U9BTF6.1
#=GS A0A4W6D9I3_LATCA/221-343    AC A0A4W6D9I3.1
#=GS A0A672JDT9_SALFA/245-330    AC A0A672JDT9.1
#=GS A0A212D0T1_CEREH/141-252    AC A0A212D0T1.1
#=GS A0A669BUY0_ORENI/235-369    AC A0A669BUY0.1
#=GS A0A3B1ILK7_ASTMX/279-367    AC A0A3B1ILK7.1
#=GS JAK2_PIG/299-381            AC O19064.1
#=GS A0A4Z2FS45_9TELE/294-372    AC A0A4Z2FS45.1
#=GS A0A673Y620_SALTR/283-421    AC A0A673Y620.1
#=GS A0A6Q2XC04_ESOLU/239-322    AC A0A6Q2XC04.1
#=GS A0A669B0U9_ORENI/257-362    AC A0A669B0U9.1
#=GS A0A672HA16_SALFA/286-399    AC A0A672HA16.1
#=GS A0A4W6EKW9_LATCA/287-367    AC A0A4W6EKW9.1
#=GS A0A091FRB5_CORBR/279-375    AC A0A091FRB5.1
#=GS A0A4W4FC90_ELEEL/276-412    AC A0A4W4FC90.1
#=GS A0A0N8JZU0_SCLFO/261-394    AC A0A0N8JZU0.1
#=GS A0A669BYD1_ORENI/241-328    AC A0A669BYD1.1
#=GS A0A4U5V9W5_COLLU/295-375    AC A0A4U5V9W5.1
#=GS H2V1W4_TAKRU/292-370        AC H2V1W4.3
#=GS H0X195_OTOGA/273-357        AC H0X195.1
#=GS JAK1_HUMAN/284-421          AC P23458.2
#=GS JAK1_HUMAN/284-421          DR PDB; 5IXD A; 284-421;
#=GS JAK1_HUMAN/284-421          DR PDB; 5IXI A; 284-421;
#=GS JAK1_HUMAN/284-421          DR PDB; 5L04 A; 284-421;
#=GS A0A5F9CC30_RABIT/286-339    AC A0A5F9CC30.1
#=GS A0A3Q4I087_NEOBR/293-373    AC A0A3Q4I087.1
#=GS A0A2K5WAG8_MACFA/290-427    AC A0A2K5WAG8.1
#=GS A0A672IVH9_SALFA/222-324    AC A0A672IVH9.1
#=GS A0A3Q2VC30_HAPBU/293-373    AC A0A3Q2VC30.1
#=GS A0A096LUR2_POEFO/279-411    AC A0A096LUR2.1
#=GS A0A3B5KB22_TAKRU/292-370    AC A0A3B5KB22.2
#=GS A0A4W2GNE8_BOBOX/284-421    AC A0A4W2GNE8.1
#=GS A0A1D2NKP5_ORCCI/212-304    AC A0A1D2NKP5.1
#=GS A0A2K6P3C9_RHIRO/240-322    AC A0A2K6P3C9.1
#=GS A0A5F8HLF7_MONDO/307-339    AC A0A5F8HLF7.1
#=GS A0A093H4Q9_STRCA/284-421    AC A0A093H4Q9.1
#=GS T0M5G5_CAMFR/286-430        AC T0M5G5.1
#=GS A0A2K5XZM0_MANLE/285-432    AC A0A2K5XZM0.1
#=GS H0X486_OTOGA/284-421        AC H0X486.1
#=GS A0A670K7C6_PODMU/256-343    AC A0A670K7C6.1
#=GS A0A4W3JVE5_CALMI/287-359    AC A0A4W3JVE5.1
#=GS A0A667ZU67_9TELE/282-409    AC A0A667ZU67.1
#=GS A0A444U8C5_ACIRT/265-403    AC A0A444U8C5.1
#=GS A0A4W5R1M1_9TELE/229-310    AC A0A4W5R1M1.1
#=GS A0A2K6P3E3_RHIRO/247-329    AC A0A2K6P3E3.1
#=GS A0A674D826_SALTR/282-414    AC A0A674D826.1
#=GS F7BLF9_HORSE/250-387        AC F7BLF9.2
#=GS A0A4W4HE47_ELEEL/278-365    AC A0A4W4HE47.1
#=GS A0A5F9ZH32_HUMAN/284-421    AC A0A5F9ZH32.1
#=GS A0A665WVP5_ECHNA/285-372    AC A0A665WVP5.1
#=GS A0A4W5QQQ5_9TELE/154-229    AC A0A4W5QQQ5.1
#=GS H3B0L6_LATCH/290-364        AC H3B0L6.1
#=GS A0A5F4BSS7_CANLF/185-309    AC A0A5F4BSS7.1
#=GS A0A2K5YD24_MANLE/299-381    AC A0A2K5YD24.1
#=GS A0A091GZ50_9AVES/294-379    AC A0A091GZ50.1
#=GS A0A673WSS0_SALTR/246-324    AC A0A673WSS0.1
#=GS A0A2K5F006_AOTNA/285-427    AC A0A2K5F006.1
#=GS A0A452RVH2_URSAM/283-357    AC A0A452RVH2.1
#=GS A0A3P4REC0_GULGU/299-381    AC A0A3P4REC0.1
#=GS A0A4D9DKB4_9SAUR/286-428    AC A0A4D9DKB4.1
#=GS H0V2Z6_CAVPO/278-425        AC H0V2Z6.2
#=GS A0A2I3MPX7_PAPAN/285-432    AC A0A2I3MPX7.1
#=GS A0A4W6ELH9_LATCA/303-373    AC A0A4W6ELH9.1
#=GS A0A665UQR4_ECHNA/283-413    AC A0A665UQR4.1
#=GS A0A401RTD8_CHIPU/279-353    AC A0A401RTD8.1
#=GS A0A4X2M7I5_VOMUR/267-414    AC A0A4X2M7I5.1
#=GS A0A2I4AUZ4_9TELE/294-373    AC A0A2I4AUZ4.1
#=GS A0A5F4C2M3_CANLF/202-314    AC A0A5F4C2M3.1
#=GS A0A3Q1JI88_ANATE/282-419    AC A0A3Q1JI88.1
#=GS A0A672JE22_SALFA/242-322    AC A0A672JE22.1
#=GS F6V3I2_MONDO/286-433        AC F6V3I2.2
#=GS H2PZ66_PANTR/284-421        AC H2PZ66.1
#=GS A0A4W3JI38_CALMI/242-324    AC A0A4W3JI38.1
#=GS A0A673WDI7_SALTR/222-300    AC A0A673WDI7.1
#=GS A0A2Y9IE55_NEOSC/286-429    AC A0A2Y9IE55.1
#=GS A0A1S3GKJ0_DIPOR/132-273    AC A0A1S3GKJ0.1
#=GS A0A3Q7SHZ4_VULVU/286-427    AC A0A3Q7SHZ4.1
#=GS A0A060W8K3_ONCMY/350-485    AC A0A060W8K3.1
#=GS H3ABD2_LATCH/295-377        AC H3ABD2.1
#=GS B1ASP2_MOUSE/284-421        AC B1ASP2.1
#=GS A0A5K1UN95_CALJA/284-421    AC A0A5K1UN95.1
#=GS A0A6I8QTW1_XENTR/214-345    AC A0A6I8QTW1.1
#=GS A0A3P9NKF3_POERE/279-409    AC A0A3P9NKF3.1
#=GS A0A6Q2YW87_ESOLU/234-307    AC A0A6Q2YW87.1
#=GS A0A673YV50_SALTR/107-233    AC A0A673YV50.1
#=GS A0A4W3JCH4_CALMI/272-410    AC A0A4W3JCH4.1
#=GS E9QJS1_MOUSE/311-454        AC E9QJS1.1
#=GS A0A3N0YU55_ANAGA/281-408    AC A0A3N0YU55.1
#=GS A0A673YV75_SALTR/285-422    AC A0A673YV75.1
#=GS A0A6Q2YTL8_ESOLU/260-348    AC A0A6Q2YTL8.1
#=GS A0A671UNH9_SPAAU/288-364    AC A0A671UNH9.1
#=GS A0A6Q2X8L3_ESOLU/283-412    AC A0A6Q2X8L3.1
#=GS A0A3Q7R5E6_VULVU/189-330    AC A0A3Q7R5E6.1
#=GS A0A5J5CSC9_9PERO/253-389    AC A0A5J5CSC9.1
#=GS A0A1S3PI02_SALSA/295-373    AC A0A1S3PI02.1
#=GS A0A3P4P1S6_GULGU/284-421    AC A0A3P4P1S6.1
#=GS A0A4W5RTM0_9TELE/293-428    AC A0A4W5RTM0.1
#=GS A0A2K5NH39_CERAT/284-421    AC A0A2K5NH39.1
#=GS E2RPW6_CANLF/299-381        AC E2RPW6.2
#=GS A0A2K6P919_RHIRO/285-432    AC A0A2K6P919.1
#=GS A0A672J939_SALFA/173-304    AC A0A672J939.1
#=GS A0A673BZQ3_9TELE/282-420    AC A0A673BZQ3.1
#=GS A0A5F8ATC5_MACMU/299-381    AC A0A5F8ATC5.1
#=GS W5PK80_SHEEP/284-421        AC W5PK80.1
#=GS A0A674DY64_SALTR/281-384    AC A0A674DY64.1
#=GS A0A2K6JTR0_RHIBE/284-421    AC A0A2K6JTR0.1
#=GS A0A6I8S5L3_XENTR/283-359    AC A0A6I8S5L3.1
#=GS A0A5F9ZI01_HUMAN/284-345    AC A0A5F9ZI01.1
#=GS G1KHZ7_ANOCA/289-431        AC G1KHZ7.2
#=GS A0A672ZKC6_9TELE/281-351    AC A0A672ZKC6.1
#=GS A0A384A4L9_BALAS/299-381    AC A0A384A4L9.1
#=GS A0A672ITZ4_SALFA/282-415    AC A0A672ITZ4.1
#=GS A0A4W5PRP9_9TELE/322-394    AC A0A4W5PRP9.1
#=GS A0A4W5QDZ7_9TELE/291-369    AC A0A4W5QDZ7.1
#=GS A0A4W3JJ69_CALMI/287-405    AC A0A4W3JJ69.1
#=GS A0A0P7UXN8_SCLFO/280-413    AC A0A0P7UXN8.1
#=GS W5LAY4_ASTMX/259-335        AC W5LAY4.2
#=GS A0A484H2J8_SOUCH/299-381    AC A0A484H2J8.1
#=GS A0A671VY17_SPAAU/285-415    AC A0A671VY17.1
#=GS A0A4W6BU27_LATCA/302-415    AC A0A4W6BU27.1
#=GS A0A2K6T829_SAIBB/262-409    AC A0A2K6T829.1
#=GS A0A3P9NSD5_POERE/130-233    AC A0A3P9NSD5.1
#=GS A0A6I8RHG1_XENTR/210-286    AC A0A6I8RHG1.1
#=GS A0A151P6W0_ALLMI/54-130     AC A0A151P6W0.1
#=GS A0A6I8SBZ3_XENTR/212-343    AC A0A6I8SBZ3.1
#=GS I3M210_ICTTR/299-443        AC I3M210.2
#=GS A0A287ASU9_PIG/285-431      AC A0A287ASU9.1
#=GS A0A3P8SFP8_AMPPE/282-385    AC A0A3P8SFP8.1
#=GS A0A452HKY4_9SAUR/297-439    AC A0A452HKY4.1
#=GS A0A6Q2YP72_ESOLU/184-257    AC A0A6Q2YP72.1
#=GS A0A060X1Z7_ONCMY/279-415    AC A0A060X1Z7.1
#=GS A0A6Q2XZE1_ESOLU/196-283    AC A0A6Q2XZE1.1
#=GS A0A093GHG5_DRYPU/284-417    AC A0A093GHG5.1
#=GS A0A2U3ZSA9_ODORO/284-421    AC A0A2U3ZSA9.1
#=GS A0A2K5WAH4_MACFA/284-421    AC A0A2K5WAH4.1
#=GS A0A6J3R6N7_TURTR/398-428    AC A0A6J3R6N7.1
#=GS A0A667XVH4_9TELE/279-363    AC A0A667XVH4.1
#=GS U3KDU1_FICAL/283-413        AC U3KDU1.1
#=GS A0A3Q1B0E3_AMPOC/282-385    AC A0A3Q1B0E3.1
#=GS A0A3Q3C4Z2_HAPBU/283-366    AC A0A3Q3C4Z2.1
#=GS A0A4W6D9P7_LATCA/277-405    AC A0A4W6D9P7.1
#=GS A0A060WH89_ONCMY/172-249    AC A0A060WH89.1
#=GS A0A4W6BYG7_LATCA/295-419    AC A0A4W6BYG7.1
#=GS A0A4W3JB89_CALMI/280-402    AC A0A4W3JB89.1
#=GS A0A556U5B1_BAGYA/283-364    AC A0A556U5B1.1
#=GS U3K7L6_FICAL/297-379        AC U3K7L6.1
#=GS A0A667ZC10_9TELE/251-281    AC A0A667ZC10.1
#=GS A0A674DYQ8_SALTR/294-404    AC A0A674DYQ8.1
#=GS A0A3P8SS90_AMPPE/301-397    AC A0A3P8SS90.1
#=GS A0A643BS30_BALPH/216-298    AC A0A643BS30.1
#=GS W5Q3B2_SHEEP/286-432        AC W5Q3B2.1
#=GS A0A669CJR3_ORENI/281-361    AC A0A669CJR3.1
#=GS A0A3Q2X356_HAPBU/280-414    AC A0A3Q2X356.1
#=GS A0A5J5N876_MUNRE/273-357    AC A0A5J5N876.1
#=GS A0A1U8DCB6_ALLSI/365-505    AC A0A1U8DCB6.2
#=GS A0A4W4FC22_ELEEL/277-404    AC A0A4W4FC22.1
#=GS JAK1_MOUSE/284-421          AC P52332.1
#=GS A0A2K5Q760_CEBCA/285-431    AC A0A2K5Q760.1
#=GS A0A667XE84_9TELE/264-365    AC A0A667XE84.1
#=GS A0A6A5DXK3_PERFL/301-437    AC A0A6A5DXK3.1
#=GS A0A672GXG3_SALFA/353-469    AC A0A672GXG3.1
#=GS A0A2K6LIE0_RHIBE/285-432    AC A0A2K6LIE0.1
#=GS A0A667ZWJ0_9TELE/298-377    AC A0A667ZWJ0.1
#=GS A0A2Y9J6S5_ENHLU/272-357    AC A0A2Y9J6S5.1
#=GS A0A674DYK3_SALTR/283-427    AC A0A674DYK3.1
#=GS A0A3Q2V3W2_HAPBU/293-373    AC A0A3Q2V3W2.1
#=GS A0A6I8PGC1_ORNAN/209-346    AC A0A6I8PGC1.1
#=GS A0A1S3MPK9_SALSA/291-366    AC A0A1S3MPK9.1
#=GS A0A093QCV4_9PASS/283-413    AC A0A093QCV4.1
#=GS G3H6C9_CRIGR/286-429        AC G3H6C9.1
#=GS M3W7U9_FELCA/408-483        AC M3W7U9.4
#=GS G5BSN6_HETGA/452-583        AC G5BSN6.1
#=GS A0A093EPV8_GAVST/284-417    AC A0A093EPV8.1
#=GS A0A673YG05_SALTR/283-418    AC A0A673YG05.1
#=GS A0A3B1JD68_ASTMX/207-283    AC A0A3B1JD68.1
#=GS A0A341BII3_NEOAA/303-449    AC A0A341BII3.1
#=GS A0A3P9NS13_POERE/293-373    AC A0A3P9NS13.1
#=GS A0A553Q2R1_9TELE/275-359    AC A0A553Q2R1.1
#=GS A0A673YVA3_SALTR/284-422    AC A0A673YVA3.1
#=GS A0A4W3GYM5_CALMI/301-376    AC A0A4W3GYM5.1
#=GS A0A663FLT2_AQUCH/284-417    AC A0A663FLT2.1
#=GS A0A060Y9J4_ONCMY/305-376    AC A0A060Y9J4.1
#=GS A0A5A9PB32_9TELE/81-156     AC A0A5A9PB32.1
#=GS A0A2R9BS87_PANPA/285-432    AC A0A2R9BS87.1
#=GS A0A1S3WF45_ERIEU/290-420    AC A0A1S3WF45.1
#=GS A0A665UR13_ECHNA/288-410    AC A0A665UR13.1
#=GS A0A2K5KJN0_CERAT/285-432    AC A0A2K5KJN0.1
#=GS A0A3Q3NIL0_9LABR/291-369    AC A0A3Q3NIL0.1
#=GS A0A2J8LTH4_PANTR/273-357    AC A0A2J8LTH4.1
#=GS A0A2K5IU17_COLAP/285-432    AC A0A2K5IU17.1
#=GS A0A674PJB1_TAKRU/317-399    AC A0A674PJB1.1
#=GS A0A6I8QEE3_XENTR/276-407    AC A0A6I8QEE3.1
#=GS A0A673UFI5_SURSU/285-357    AC A0A673UFI5.1
#=GS A0A2U3VU82_ODORO/299-450    AC A0A2U3VU82.1
#=GS A0A5N4CL97_CAMDR/256-400    AC A0A5N4CL97.1
#=GS A0A3Q0DNG1_CARSF/285-430    AC A0A3Q0DNG1.1
#=GS A0A667Y8V1_9TELE/295-427    AC A0A667Y8V1.1
#=GS A0A669CBX6_ORENI/236-348    AC A0A669CBX6.1
#=GS A0A6I8Q069_XENTR/235-311    AC A0A6I8Q069.1
#=GS G1TCI4_RABIT/299-381        AC G1TCI4.2
#=GS A0A2K6P3D0_RHIRO/261-343    AC A0A2K6P3D0.1
#=GS A0A4W5QXA5_9TELE/295-373    AC A0A4W5QXA5.1
#=GS A0A673YVF4_SALTR/242-372    AC A0A673YVF4.1
#=GS L5LTA8_MYODS/286-435        AC L5LTA8.1
#=GS A0A2K5DBQ1_AOTNA/299-381    AC A0A2K5DBQ1.1
#=GS A0A673BZQ8_9TELE/282-418    AC A0A673BZQ8.1
#=GS A0A4U5ULJ4_COLLU/268-361    AC A0A4U5ULJ4.1
#=GS A0A4W5MIY4_9TELE/291-369    AC A0A4W5MIY4.1
#=GS A0A4W4FBZ9_ELEEL/273-412    AC A0A4W4FBZ9.1
#=GS A0A653DWY0_CALMS/141-209    AC A0A653DWY0.1
#=GS A0A4W4GFZ3_ELEEL/148-224    AC A0A4W4GFZ3.1
#=GS A0A3Q3ELU2_9LABR/303-421    AC A0A3Q3ELU2.1
#=GS A0A452HXS2_9SAUR/299-375    AC A0A452HXS2.1
#=GS A0A4W4H717_ELEEL/195-296    AC A0A4W4H717.1
#=GS A0A384DH94_URSMA/267-309    AC A0A384DH94.1
#=GS A0A673YF29_SALTR/291-366    AC A0A673YF29.1
#=GS A0A0Q3QCQ8_AMAAE/285-421    AC A0A0Q3QCQ8.1
#=GS A0A2U3VU74_ODORO/299-442    AC A0A2U3VU74.1
#=GS A0A2I0TZT4_LIMLA/354-437    AC A0A2I0TZT4.1
#=GS A0A093J647_EURHL/284-417    AC A0A093J647.1
#=GS H2NY19_PONAB/279-356        AC H2NY19.2
#=GS A0A226N5B7_CALSU/340-424    AC A0A226N5B7.1
#=GS A0A668A5D5_9TELE/272-399    AC A0A668A5D5.1
#=GS A0A672JTL4_SALFA/253-333    AC A0A672JTL4.1
#=GS A0A4W6EJX3_LATCA/284-364    AC A0A4W6EJX3.1
#=GS F6RLI3_CALJA/299-381        AC F6RLI3.2
#=GS A0A0Q3QW93_AMAAE/273-352    AC A0A0Q3QW93.1
#=GS A0A673YF46_SALTR/280-360    AC A0A673YF46.1
#=GS A0A667XYG3_9TELE/287-421    AC A0A667XYG3.1
#=GS A0A673VD79_SURSU/299-381    AC A0A673VD79.1
#=GS A0A553QRE2_9TELE/280-413    AC A0A553QRE2.1
#=GS A0A665UP63_ECHNA/301-429    AC A0A665UP63.1
#=GS A0A672GXG2_SALFA/300-431    AC A0A672GXG2.1
#=GS A0A673WD29_SALTR/295-374    AC A0A673WD29.1
#=GS A0A091DWB5_FUKDA/299-381    AC A0A091DWB5.1
#=GS A0A665UV06_ECHNA/271-403    AC A0A665UV06.1
#=GS A0A2K5IGU5_COLAP/290-427    AC A0A2K5IGU5.1
#=GS A0A1U7RXD8_ALLSI/284-421    AC A0A1U7RXD8.1
#=GS A0A151N0Y0_ALLMI/287-427    AC A0A151N0Y0.1
#=GS A0A2K5BXU8_AOTNA/282-357    AC A0A2K5BXU8.1
#=GS A0A4W5JH01_9TELE/247-385    AC A0A4W5JH01.1
#=GS A0A673C2X0_9TELE/290-427    AC A0A673C2X0.1
#=GS A0A673Y8X8_SALTR/263-396    AC A0A673Y8X8.1
#=GS F1PIY7_CANLF/245-382        AC F1PIY7.3
#=GS A0A1S3S4Y6_SALSA/285-422    AC A0A1S3S4Y6.1
#=GS A0A3Q3XJJ1_MOLML/283-364    AC A0A3Q3XJJ1.1
#=GS JAK2_HUMAN/299-381          AC O60674.2
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 F; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2P B; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 A; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2Q B; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2Q C; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 H; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 E; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 B; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2Q D; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 C; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 G; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2P A; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 6E2Q A; 299-381;
#=GS JAK2_HUMAN/299-381          DR PDB; 4Z32 D; 299-381;
#=GS L5L284_PTEAL/299-357        AC L5L284.1
#=GS A0A087R0W7_APTFO/284-417    AC A0A087R0W7.1
#=GS A0A4W5PYV7_9TELE/285-422    AC A0A4W5PYV7.1
#=GS A0A4W2EXR7_BOBOX/350-434    AC A0A4W2EXR7.1
#=GS K7FRH1_PELSI/285-423        AC K7FRH1.1
#=GS A0A3P8XKU1_ESOLU/282-415    AC A0A3P8XKU1.2
#=GS A0A672V1N8_STRHB/294-379    AC A0A672V1N8.1
#=GS A0A4W6BYM9_LATCA/297-410    AC A0A4W6BYM9.1
#=GS H2TCV2_TAKRU/244-364        AC H2TCV2.3
#=GS A0A4W5QPI2_9TELE/232-307    AC A0A4W5QPI2.1
#=GS A0A151M8K3_ALLMI/292-374    AC A0A151M8K3.1
#=GS A0A2U4BAV6_TURTR/334-416    AC A0A2U4BAV6.1
#=GS A0A671W106_SPAAU/298-393    AC A0A671W106.1
#=GS A0A452DZ23_CAPHI/273-357    AC A0A452DZ23.1
#=GS A0A672JB17_SALFA/223-301    AC A0A672JB17.1
#=GS A0A670KG51_PODMU/259-360    AC A0A670KG51.1
#=GS A0A1S3KKN4_SALSA/282-419    AC A0A1S3KKN4.1
#=GS A0A3Q3WHN4_MOLML/259-370    AC A0A3Q3WHN4.1
#=GS A0A6Q2ZF90_ESOLU/263-366    AC A0A6Q2ZF90.1
#=GS A0A2R8P2H7_CALJA/282-357    AC A0A2R8P2H7.2
#=GS A0A669D6F4_ORENI/252-386    AC A0A669D6F4.1
#=GS A0A670KEC6_PODMU/315-385    AC A0A670KEC6.1
#=GS A0A1S3LUJ9_SALSA/291-369    AC A0A1S3LUJ9.1
#=GS A0A6I8PJX5_ORNAN/249-386    AC A0A6I8PJX5.1
#=GS A0A0A0AT86_CHAVO/295-380    AC A0A0A0AT86.1
#=GS A0A2K6BRZ3_MACNE/299-381    AC A0A2K6BRZ3.1
#=GS A0A2Y9HEH0_NEOSC/297-379    AC A0A2Y9HEH0.1
#=GS A0A4W5JVP2_9TELE/358-389    AC A0A4W5JVP2.1
#=GS A0A673WAM3_SALTR/291-370    AC A0A673WAM3.1
#=GS A0A5A9NAP8_9TELE/272-399    AC A0A5A9NAP8.1
#=GS A0A3Q3FP56_KRYMA/294-373    AC A0A3Q3FP56.1
#=GS G1T864_RABIT/287-340        AC G1T864.2
#=GS A0A4W5QX41_9TELE/229-310    AC A0A4W5QX41.1
#=GS A0A553Q2S4_9TELE/275-359    AC A0A553Q2S4.1
#=GS A0A4W3HIY3_CALMI/270-345    AC A0A4W3HIY3.1
#=GS A0A3Q1EEQ9_9TELE/294-429    AC A0A3Q1EEQ9.1
#=GS A0A4W4GFV2_ELEEL/279-362    AC A0A4W4GFV2.1
#=GS A0A673YFH5_SALTR/292-427    AC A0A673YFH5.1
#=GS A0A4Z2F267_9TELE/286-417    AC A0A4Z2F267.1
#=GS A0A091P2W8_APAVI/299-380    AC A0A091P2W8.1
#=GS A0A1S3G4P2_DIPOR/277-354    AC A0A1S3G4P2.1
#=GS S7MWR8_MYOBR/299-436        AC S7MWR8.1
#=GS A0A2I3LH42_PAPAN/98-235     AC A0A2I3LH42.1
#=GS A0A2Y9LFZ4_ENHLU/299-445    AC A0A2Y9LFZ4.1
#=GS A0A667ZY75_9TELE/265-342    AC A0A667ZY75.1
#=GS F6YLX1_MACMU/284-421        AC F6YLX1.2
#=GS A0A455BLI6_PHYMC/299-381    AC A0A455BLI6.1
#=GS A0A4W6BTH0_LATCA/294-423    AC A0A4W6BTH0.1
#=GS H2TCV4_TAKRU/216-336        AC H2TCV4.2
#=GS T1I9L6_RHOPR/233-300        AC T1I9L6.1
#=GS M3XFX5_FELCA/299-381        AC M3XFX5.3
#=GS A0A5N5PXD8_PANHP/279-416    AC A0A5N5PXD8.1
#=GS A0A2I4BPV4_9TELE/289-423    AC A0A2I4BPV4.1
#=GS A0A3M0IYK1_HIRRU/286-420    AC A0A3M0IYK1.1
#=GS A0A2U4BAY9_TURTR/119-201    AC A0A2U4BAY9.1
#=GS A0A673YH76_SALTR/284-316    AC A0A673YH76.1
#=GS A0A4W3J886_CALMI/288-418    AC A0A4W3J886.1
#=GS G1R1P8_NOMLE/209-288        AC G1R1P8.3
#=GS A0A5N4B7D4_PHOPY/234-299    AC A0A5N4B7D4.1
#=GS A0A672Z5C1_9TELE/295-431    AC A0A672Z5C1.1
#=GS A0A2I0MC95_COLLI/284-417    AC A0A2I0MC95.1
#=GS A0A0D9R4G8_CHLSB/285-432    AC A0A0D9R4G8.1
#=GS F6X8E5_ORNAN/287-363        AC F6X8E5.2
#=GS A0A3Q1AVJ6_AMPOC/282-419    AC A0A3Q1AVJ6.1
#=GS A0A673A582_9TELE/258-362    AC A0A673A582.1
#=GS A0A384D6N1_URSMA/286-357    AC A0A384D6N1.1
#=GS A0A5C6MY48_9TELE/286-364    AC A0A5C6MY48.1
#=GS A0A672IW61_SALFA/281-412    AC A0A672IW61.1
#=GS A0A4W3J8N8_CALMI/272-405    AC A0A4W3J8N8.1
#=GS A0A6I8QXJ0_XENTR/231-307    AC A0A6I8QXJ0.1
#=GS A0A341BIN6_NEOAA/303-449    AC A0A341BIN6.1
#=GS A0A4W4EDS4_ELEEL/299-436    AC A0A4W4EDS4.1
#=GS A0A672IH18_SALFA/290-372    AC A0A672IH18.1
#=GS A0A2I4CI67_9TELE/298-377    AC A0A2I4CI67.1
#=GS A0A6G0HW98_LARCR/283-419    AC A0A6G0HW98.1
#=GS A0A452HWJ7_9SAUR/325-400    AC A0A452HWJ7.1
#=GS A0A484D1S3_PERFV/299-432    AC A0A484D1S3.1
#=GS A0A643CJ88_BALPH/297-354    AC A0A643CJ88.1
#=GS I3J7Z7_ORENI/252-330        AC I3J7Z7.2
#=GS A0A5G2QGG0_PIG/299-381      AC A0A5G2QGG0.1
#=GS A0A096LWM8_POEFO/258-364    AC A0A096LWM8.1
#=GS A0A673YAB0_SALTR/223-358    AC A0A673YAB0.1
#=GS A0A672ISS2_SALFA/280-393    AC A0A672ISS2.1
#=GS A0A673Y9Z1_SALTR/238-376    AC A0A673Y9Z1.1
#=GS A0A672JDT5_SALFA/236-314    AC A0A672JDT5.1
#=GS A0A384A4U9_BALAS/119-201    AC A0A384A4U9.1
#=GS A0A4W3J8A7_CALMI/286-404    AC A0A4W3J8A7.1
#=GS A0A4W3H2W4_CALMI/288-363    AC A0A4W3H2W4.1
#=GS A0A673WP02_SALTR/230-311    AC A0A673WP02.1
#=GS A0A6I8S7S7_XENTR/283-418    AC A0A6I8S7S7.1
#=GS A0A3Q3KUX2_9TELE/255-362    AC A0A3Q3KUX2.1
#=GS A0A673YSW6_SALTR/284-410    AC A0A673YSW6.1
#=GS A0A4W5MIG8_9TELE/279-357    AC A0A4W5MIG8.1
#=GS A0A091QIP2_9GRUI/1-29       AC A0A091QIP2.1
#=GS H0ZIA6_TAEGU/283-413        AC H0ZIA6.2
#=GS A0A093F367_TYTAL/295-380    AC A0A093F367.1
#=GS A0A1L8H2U7_XENLA/287-427    AC A0A1L8H2U7.1
#=GS A0A4W4FAF7_ELEEL/271-391    AC A0A4W4FAF7.1
#=GS A0A670K578_PODMU/295-380    AC A0A670K578.1
#=GS M3VXL7_FELCA/284-420        AC M3VXL7.3
#=GS A0A4W6CM91_LATCA/239-319    AC A0A4W6CM91.1
#=GS A0A093CGK4_TAUER/178-311    AC A0A093CGK4.1
#=GS A0A556V7T0_BAGYA/283-361    AC A0A556V7T0.1
#=GS A0A665VNC4_ECHNA/281-356    AC A0A665VNC4.1
#=GS A0A6G0IKB7_LARCR/222-333    AC A0A6G0IKB7.1
#=GS A0A2Y9GN84_NEOSC/272-357    AC A0A2Y9GN84.1
#=GS A0A674DZX2_SALTR/275-413    AC A0A674DZX2.1
#=GS A0A671VX46_SPAAU/298-429    AC A0A671VX46.1
#=GS A0A494BBB9_MOUSE/299-381    AC A0A494BBB9.1
#=GS A0A2I0LJ08_COLLI/314-452    AC A0A2I0LJ08.1
#=GS A0A6I8RPN1_XENTR/292-437    AC A0A6I8RPN1.1
#=GS A0A4W5K0F1_9TELE/247-385    AC A0A4W5K0F1.1
#=GS A0A2Y9R049_TRIMA/286-430    AC A0A2Y9R049.1
#=GS G1M9G8_AILME/284-421        AC G1M9G8.1
#=GS A0A1A6GPP0_NEOLE/215-351    AC A0A1A6GPP0.1
#=GS A0A665UX81_ECHNA/278-410    AC A0A665UX81.1
#=GS A0A4W6C5M5_LATCA/307-386    AC A0A4W6C5M5.1
#=GS A0A665WVV7_ECHNA/313-350    AC A0A665WVV7.1
#=GS A0A670KDY6_PODMU/318-388    AC A0A670KDY6.1
#=GS A0A4W4EMY2_ELEEL/164-302    AC A0A4W4EMY2.1
#=GS A0A096N179_PAPAN/283-420    AC A0A096N179.2
#=GS A0A3P9AN96_ESOLU/262-385    AC A0A3P9AN96.2
#=GS A0A452I649_9SAUR/268-383    AC A0A452I649.1
#=GS A0A673YFU0_SALTR/277-409    AC A0A673YFU0.1
#=GS A0A341BHA0_NEOAA/303-449    AC A0A341BHA0.1
#=GS A0A4W6C5Q3_LATCA/251-330    AC A0A4W6C5Q3.1
#=GS A0A3Q2UXG2_HAPBU/267-311    AC A0A3Q2UXG2.1
#=GS A0A2Y9L8X3_ENHLU/299-442    AC A0A2Y9L8X3.1
#=GS A0A673A545_9TELE/261-362    AC A0A673A545.1
#=GS H3C837_TETNG/179-258        AC H3C837.1
#=GS A0A4W6EJX8_LATCA/248-326    AC A0A4W6EJX8.1
#=GS A0A672IV44_SALFA/273-386    AC A0A672IV44.1
#=GS A0A3Q7SHZ9_VULVU/299-440    AC A0A3Q7SHZ9.1
#=GS A0A6Q2Z698_ESOLU/280-367    AC A0A6Q2Z698.1
#=GS S5RRC4_SALSA/285-422        AC S5RRC4.1
#=GS A0A556TZT5_BAGYA/309-381    AC A0A556TZT5.1
#=GS H9H0M3_MELGA/148-220        AC H9H0M3.1
#=GS A0A4W4HEZ0_ELEEL/242-329    AC A0A4W4HEZ0.1
#=GS A0A665VJ15_ECHNA/280-362    AC A0A665VJ15.1
#=GS A0A674PRY4_TAKRU/285-331    AC A0A674PRY4.1
#=GS A0A2K5L3K1_CERAT/260-344    AC A0A2K5L3K1.1
#=GS M7AIF3_CHEMY/201-305        AC M7AIF3.1
#=GS A0A2U3ZNI2_ODORO/297-379    AC A0A2U3ZNI2.1
#=GS A0A1V4KXU7_PATFA/314-450    AC A0A1V4KXU7.1
#=GS A0A2I0T5J9_LIMLA/105-247    AC A0A2I0T5J9.1
#=GS A0A2Y9K4R8_ENHLU/299-381    AC A0A2Y9K4R8.1
#=GS A0A671DXL1_RHIFE/284-421    AC A0A671DXL1.1
#=GS A0A673WDA3_SALTR/285-368    AC A0A673WDA3.1
#=GS A0A4Z2HWR3_9TELE/281-413    AC A0A4Z2HWR3.1
#=GS A0A672H0Y6_SALFA/321-426    AC A0A672H0Y6.1
#=GS A0A672Z392_9TELE/280-405    AC A0A672Z392.1
#=GS A0A5N5PL17_PANHP/269-400    AC A0A5N5PL17.1
#=GS A0A087QSD3_APTFO/298-379    AC A0A087QSD3.1
#=GS M3ZDE9_XIPMA/278-409        AC M3ZDE9.1
#=GS A0A673YFN7_SALTR/227-304    AC A0A673YFN7.1
#=GS A0A4W6DA05_LATCA/288-407    AC A0A4W6DA05.1
#=GS A0A672UUB6_STRHB/257-373    AC A0A672UUB6.1
#=GS A0A670KIG7_PODMU/291-431    AC A0A670KIG7.1
#=GS A0A6I8P3T8_ORNAN/335-469    AC A0A6I8P3T8.1
#=GS A0A665VN89_ECHNA/313-391    AC A0A665VN89.1
#=GS A0A2I3T122_PANTR/280-357    AC A0A2I3T122.1
#=GS A0A6Q2XQ37_ESOLU/191-295    AC A0A6Q2XQ37.1
#=GS M7AKN2_CHEMY/607-749        AC M7AKN2.1
#=GS A0A2R8QJ02_DANRE/286-409    AC A0A2R8QJ02.1
#=GS A0A087XMA3_POEFO/279-409    AC A0A087XMA3.1
#=GS A0A6I8QAF1_XENTR/298-443    AC A0A6I8QAF1.1
#=GS A0A212D239_CEREH/169-254    AC A0A212D239.1
#=GS A0A5A9P5C0_9TELE/259-365    AC A0A5A9P5C0.1
#=GS A0A665WVT6_ECHNA/263-361    AC A0A665WVT6.1
#=GS A0A672J907_SALFA/311-405    AC A0A672J907.1
#=GS A0A3Q1GXZ2_9TELE/304-400    AC A0A3Q1GXZ2.1
#=GS A0A674D7T5_SALTR/282-419    AC A0A674D7T5.1
#=GS A0A674DXX0_SALTR/295-399    AC A0A674DXX0.1
#=GS A0A0D9R8Z9_CHLSB/297-379    AC A0A0D9R8Z9.1
#=GS A0A673YXS6_SALTR/283-418    AC A0A673YXS6.1
#=GS A0A2K6D4H6_MACNE/285-432    AC A0A2K6D4H6.1
#=GS G1RCI3_NOMLE/299-381        AC G1RCI3.1
#=GS A0A401PFC1_SCYTO/297-378    AC A0A401PFC1.1
#=GS A0A4W5R6Q6_9TELE/158-185    AC A0A4W5R6Q6.1
#=GS A0A6J3R4U3_TURTR/282-357    AC A0A6J3R4U3.1
#=GS L5L7Y5_PTEAL/272-357        AC L5L7Y5.1
#=GS A0A674EB82_SALTR/245-385    AC A0A674EB82.1
#=GS A0A337SI69_FELCA/299-381    AC A0A337SI69.1
#=GS A0A3B1K723_ASTMX/250-383    AC A0A3B1K723.1
#=GS G3TF05_LOXAF/258-329        AC G3TF05.1
#=GS A0A674NZS1_TAKRU/293-439    AC A0A674NZS1.1
#=GS A0A671UPZ4_SPAAU/288-364    AC A0A671UPZ4.1
#=GS A0A671FXV6_RHIFE/273-357    AC A0A671FXV6.1
#=GS A0A093GIU2_DRYPU/295-380    AC A0A093GIU2.1
#=GS A0A2K6EKT2_PROCO/285-427    AC A0A2K6EKT2.1
#=GS A0A226MBH8_CALSU/237-374    AC A0A226MBH8.1
#=GS A0A2K5VPR0_MACFA/285-432    AC A0A2K5VPR0.1
#=GS A0A452HXW3_9SAUR/288-363    AC A0A452HXW3.1
#=GS A0A315VE90_GAMAF/299-434    AC A0A315VE90.1
#=GS A0A3P8XGS0_ESOLU/272-402    AC A0A3P8XGS0.2
#=GS A0A673YFA8_SALTR/283-418    AC A0A673YFA8.1
#=GS A0A673WQT3_SALTR/294-372    AC A0A673WQT3.1
#=GS A0A0G2K636_RAT/276-353      AC A0A0G2K636.1
#=GS A0A3M0K6K0_HIRRU/305-435    AC A0A3M0K6K0.1
#=GS A0A1S3LTU5_SALSA/113-191    AC A0A1S3LTU5.1
#=GS A0A093CU52_TAUER/295-380    AC A0A093CU52.1
#=GS A0A1V4J8Q4_PATFA/290-374    AC A0A1V4J8Q4.1
#=GS A0A673YFL1_SALTR/277-363    AC A0A673YFL1.1
#=GS A0A1S3P9N7_SALSA/283-418    AC A0A1S3P9N7.1
#=GS A0A2K6BRT5_MACNE/299-381    AC A0A2K6BRT5.1
#=GS A0A667XE06_9TELE/283-364    AC A0A667XE06.1
#=GS A0A3Q3W8T4_MOLML/249-364    AC A0A3Q3W8T4.1
#=GS A0A673WAY1_SALTR/283-366    AC A0A673WAY1.1
#=GS A0A672JCB5_SALFA/280-416    AC A0A672JCB5.1
#=GS A0A2I3SYV7_PANTR/299-381    AC A0A2I3SYV7.1
#=GS A0A4D9EHX2_9SAUR/307-445    AC A0A4D9EHX2.1
#=GS A0A672JE31_SALFA/307-387    AC A0A672JE31.1
#=GS A0A6Q2ZA61_ESOLU/124-202    AC A0A6Q2ZA61.1
#=GS F7CMB7_XENTR/287-415        AC F7CMB7.3
#=GS A0A4W5R2Q6_9TELE/223-301    AC A0A4W5R2Q6.1
#=GS A0A3M0JPJ6_HIRRU/277-360    AC A0A3M0JPJ6.1
#=GS A0A452RVA1_URSAM/283-357    AC A0A452RVA1.1
#=GS A0A672IV60_SALFA/258-363    AC A0A672IV60.1
#=GS A0A091HKF2_BUCRH/298-380    AC A0A091HKF2.1
#=GS A0A2K5RM58_CEBCA/283-357    AC A0A2K5RM58.1
#=GS A0A2K5NHQ0_CERAT/290-427    AC A0A2K5NHQ0.1
#=GS A0A2K6N0P8_RHIBE/259-341    AC A0A2K6N0P8.1
#=GS M3WBF6_FELCA/286-428        AC M3WBF6.2
#=GS A0A6I8RRC8_XENTR/289-410    AC A0A6I8RRC8.1
#=GS A0A3P8X4V0_CYNSE/319-413    AC A0A3P8X4V0.1
#=GS A0A671XSC4_SPAAU/256-284    AC A0A671XSC4.1
#=GS A0A673WQA8_SALTR/288-366    AC A0A673WQA8.1
#=GS A0A3Q7SBI6_VULVU/299-381    AC A0A3Q7SBI6.1
#=GS A0A671UPB8_SPAAU/251-353    AC A0A671UPB8.1
#=GS A0A4W2DG60_BOBOX/284-331    AC A0A4W2DG60.1
#=GS A0A3P9Q7L9_POERE/292-393    AC A0A3P9Q7L9.1
#=GS A0A672IDG5_SALFA/277-359    AC A0A672IDG5.1
#=GS A0A667ZNH8_9TELE/232-306    AC A0A667ZNH8.1
#=GS A0A665WVS3_ECHNA/280-361    AC A0A665WVS3.1
#=GS A0A4W4FCQ1_ELEEL/275-411    AC A0A4W4FCQ1.1
#=GS A0A3Q1J6K0_ANATE/303-434    AC A0A3Q1J6K0.1
#=GS G3HY52_CRIGR/272-408        AC G3HY52.1
#=GS A0A4W5QNM6_9TELE/291-366    AC A0A4W5QNM6.1
#=GS H2R6D4_PANTR/285-432        AC H2R6D4.2
#=GS A0A401S5B6_CHIPU/213-295    AC A0A401S5B6.1
#=GS A0A4W3JI33_CALMI/295-377    AC A0A4W3JI33.1
#=GS A0A673YVX1_SALTR/284-418    AC A0A673YVX1.1
#=GS A0A2U3Z702_LEPWE/284-421    AC A0A2U3Z702.1
#=GS A0A484D098_PERFV/285-365    AC A0A484D098.1
#=GS A0A6G0IR04_LARCR/283-415    AC A0A6G0IR04.1
#=GS A0A2K6EQQ8_PROCO/283-358    AC A0A2K6EQQ8.1
#=GS A0A665UXJ5_ECHNA/294-413    AC A0A665UXJ5.1
#=GS A0A674HF29_TAEGU/283-413    AC A0A674HF29.1
#=GS A0A6Q2YP12_ESOLU/283-397    AC A0A6Q2YP12.1
#=GS A0A674D8C2_SALTR/282-419    AC A0A674D8C2.1
#=GS A0A2K5XZN6_MANLE/285-432    AC A0A2K5XZN6.1
#=GS A0A672IRM0_SALFA/282-416    AC A0A672IRM0.1
#=GS A0A663FJ91_AQUCH/284-417    AC A0A663FJ91.1
#=GS H3DDQ1_TETNG/171-255        AC H3DDQ1.1
#=GS A0A452CH73_BALAS/55-137     AC A0A452CH73.1
#=GS A0A452HXA0_9SAUR/288-363    AC A0A452HXA0.1
#=GS A0A6Q2Y7B2_ESOLU/298-376    AC A0A6Q2Y7B2.1
#=GS JAK3_HUMAN/273-357          AC P52333.2
#=GS A0A2K6ARR6_MACNE/290-427    AC A0A2K6ARR6.1
#=GS F7F934_MONDO/313-354        AC F7F934.2
#=GS A0A6Q2YUG5_ESOLU/273-422    AC A0A6Q2YUG5.1
#=GS A0A663DQP8_AQUCH/342-484    AC A0A663DQP8.1
#=GS A0A1W4XLI2_AGRPL/234-299    AC A0A1W4XLI2.1
#=GS A0A6I8STR8_XENTR/232-368    AC A0A6I8STR8.1
#=GS A0A091N4F9_9PASS/1-70       AC A0A091N4F9.1
#=GS A0A452S2R5_URSAM/286-434    AC A0A452S2R5.1
#=GS A0A673YY56_SALTR/266-384    AC A0A673YY56.1
#=GS A0A672IVF5_SALFA/276-381    AC A0A672IVF5.1
#=GS A0A6I8PMK1_ORNAN/335-469    AC A0A6I8PMK1.1
#=GS H2PS83_PONAB/299-381        AC H2PS83.1
#=GS A0A4W3JB95_CALMI/288-408    AC A0A4W3JB95.1
#=GS A0A3Q7Y8G7_URSAR/119-201    AC A0A3Q7Y8G7.1
#=GS A0A669BRF3_ORENI/280-359    AC A0A669BRF3.1
#=GS A0A5N4DDS4_CAMDR/339-476    AC A0A5N4DDS4.1
#=GS A0A3Q3B343_KRYMA/281-416    AC A0A3Q3B343.1
#=GS A0A3Q3W3K4_MOLML/264-361    AC A0A3Q3W3K4.1
#=GS A0A673YFK4_SALTR/287-362    AC A0A673YFK4.1
#=GS A0A672JFF5_SALFA/280-412    AC A0A672JFF5.1
#=GS A0A383YNH1_BALAS/260-397    AC A0A383YNH1.1
#=GS A0A4W4GJ36_ELEEL/268-348    AC A0A4W4GJ36.1
#=GS A0A3Q2VQ94_HAPBU/283-366    AC A0A3Q2VQ94.1
#=GS M3ZMT4_XIPMA/297-376        AC M3ZMT4.1
#=GS A0A665VMU9_ECHNA/284-359    AC A0A665VMU9.1
#=GS A0A668A593_9TELE/276-401    AC A0A668A593.1
#=GS A0A226MI72_COLVI/279-355    AC A0A226MI72.1
#=GS A0A4W6CM45_LATCA/303-338    AC A0A4W6CM45.1
#=GS H3CXH8_TETNG/239-354        AC H3CXH8.1
#=GS A0A4W5K0G5_9TELE/223-366    AC A0A4W5K0G5.1
#=GS A0A3L8SPZ8_CHLGU/313-417    AC A0A3L8SPZ8.1
#=GS A0A670KEE7_PODMU/302-375    AC A0A670KEE7.1
#=GS A0A672JQ74_SALFA/259-365    AC A0A672JQ74.1
#=GS A0A673WI02_SALTR/249-321    AC A0A673WI02.1
#=GS A0A2K5JYU7_COLAP/299-381    AC A0A2K5JYU7.1
#=GS A0A091I984_CALAN/283-418    AC A0A091I984.1
#=GS A0A4D9E8Q5_9SAUR/459-534    AC A0A4D9E8Q5.1
#=GS A0A6I8SWL0_XENTR/228-307    AC A0A6I8SWL0.1
#=GS A0A3Q3L884_9TELE/286-364    AC A0A3Q3L884.1
#=GS A0A6J3R654_TURTR/325-471    AC A0A6J3R654.1
#=GS A0A5F4DBF0_CANLF/184-317    AC A0A5F4DBF0.1
#=GS A0A1S3QZS8_SALSA/275-413    AC A0A1S3QZS8.1
#=GS A0A4W6DA83_LATCA/235-338    AC A0A4W6DA83.1
#=GS A0A3P8T0K1_AMPPE/283-363    AC A0A3P8T0K1.1
#=GS L8IT24_9CETA/299-381        AC L8IT24.1
#=GS A0A672Z4I4_9TELE/280-405    AC A0A672Z4I4.1
#=GS W5PZ17_SHEEP/240-324        AC W5PZ17.1
#=GS A0A3P8WK53_CYNSE/297-375    AC A0A3P8WK53.1
#=GS W5M4D5_LEPOC/290-365        AC W5M4D5.1
#=GS M7B3B8_CHEMY/295-433        AC M7B3B8.1
#=GS A0A2K5L3H2_CERAT/273-357    AC A0A2K5L3H2.1
#=GS A0A3Q3NCK8_9LABR/299-378    AC A0A3Q3NCK8.1
#=GS A0A4W4FCG3_ELEEL/268-393    AC A0A4W4FCG3.1
#=GS A0A452EDI9_CAPHI/284-421    AC A0A452EDI9.1
#=GS A0A671XZ75_SPAAU/280-363    AC A0A671XZ75.1
#=GS R0LK59_ANAPL/258-384        AC R0LK59.1
#=GS A0A4W3GXG1_CALMI/1-70       AC A0A4W3GXG1.1
#=GS A0A2Y9M4G7_DELLE/282-357    AC A0A2Y9M4G7.1
#=GS A0A672IVB5_SALFA/108-242    AC A0A672IVB5.1
#=GS A0A2Y9ITG3_ENHLU/284-421    AC A0A2Y9ITG3.1
#=GS A0A1L8GLW3_XENLA/270-406    AC A0A1L8GLW3.1
#=GS A0A2R8ZHT5_PANPA/299-381    AC A0A2R8ZHT5.1
#=GS A0A4W4GEQ0_ELEEL/227-303    AC A0A4W4GEQ0.1
#=GS A0A556VWA6_BAGYA/123-214    AC A0A556VWA6.1
#=GS A0A3Q3E7L5_9LABR/275-364    AC A0A3Q3E7L5.1
#=GS A0A3P9CSX7_9CICH/280-414    AC A0A3P9CSX7.1
#=GS A0A673C5E6_9TELE/268-341    AC A0A673C5E6.1
#=GS A0A3Q3LI18_9LABR/303-421    AC A0A3Q3LI18.1
#=GS A0A2K5Q1Z3_CEBCA/299-381    AC A0A2K5Q1Z3.1
#=GS A0A672IVC6_SALFA/282-387    AC A0A672IVC6.1
#=GS A0A226N3Z6_COLVI/1-29       AC A0A226N3Z6.1
#=GS A0A091KK52_9GRUI/296-380    AC A0A091KK52.1
#=GS A0A452DQ72_CAPHI/299-381    AC A0A452DQ72.1
#=GS E1BEL4_BOVIN/273-357        AC E1BEL4.2
#=GS A0A2K5KJN2_CERAT/285-432    AC A0A2K5KJN2.1
#=GS A0A4W4HF24_ELEEL/278-365    AC A0A4W4HF24.1
#=GS A0A2R8MSL1_CALJA/282-357    AC A0A2R8MSL1.2
#=GS A0A5F7ZDF4_MACMU/294-441    AC A0A5F7ZDF4.1
#=GS A0A2Y9HKP7_NEOSC/297-379    AC A0A2Y9HKP7.1
#=GS A0A2K5ZKJ6_MANLE/272-409    AC A0A2K5ZKJ6.1
#=GS A0A669FCU2_ORENI/197-267    AC A0A669FCU2.1
#=GS A0A2P4TB51_BAMTH/141-225    AC A0A2P4TB51.1
#=GS A0A670IXY0_PODMU/285-420    AC A0A670IXY0.1
#=GS A0A452HXQ7_9SAUR/289-364    AC A0A452HXQ7.1
#=GS A0A667ZXS7_9TELE/137-212    AC A0A667ZXS7.1
#=GS A0A3P9CB25_9CICH/299-432    AC A0A3P9CB25.1
#=GS V8P909_OPHHA/149-259        AC V8P909.1
#=GS A0A452S2G3_URSAM/288-401    AC A0A452S2G3.1
#=GS A0A674DZ95_SALTR/280-390    AC A0A674DZ95.1
#=GS T1JVU0_TETUR/251-324        AC T1JVU0.1
#=GS A0A091T8G5_PHALP/244-373    AC A0A091T8G5.1
#=GS A0A667ZTY7_9TELE/304-433    AC A0A667ZTY7.1
#=GS A0A3Q1G7R6_9TELE/282-419    AC A0A3Q1G7R6.1
#=GS A0A674GF85_TAEGU/283-413    AC A0A674GF85.1
#=GS F6QBA9_CALJA/285-432        AC F6QBA9.3
#=GS A0A2P4T3X3_BAMTH/174-305    AC A0A2P4T3X3.1
#=GS A0A673A8C1_9TELE/292-379    AC A0A673A8C1.1
#=GS A0A087V8Q7_BALRE/224-306    AC A0A087V8Q7.1
#=GS A0A3Q4GXJ1_NEOBR/307-386    AC A0A3Q4GXJ1.1
#=GS H0VSL1_CAVPO/273-354        AC H0VSL1.2
#=GS A0A452QRM6_URSAM/239-321    AC A0A452QRM6.1
#=GS A0A2K5JYV7_COLAP/299-381    AC A0A2K5JYV7.1
#=GS A0A4W3H1F7_CALMI/264-339    AC A0A4W3H1F7.1
#=GS A0A6I8S3U7_XENTR/338-409    AC A0A6I8S3U7.1
#=GS A0A3Q3XGW4_MOLML/298-374    AC A0A3Q3XGW4.1
#=GS A0A286ZVG5_PIG/285-431      AC A0A286ZVG5.2
#=GS A0A2U9C6E2_SCOMX/297-430    AC A0A2U9C6E2.1
#=GS A0A673Y5I3_SALTR/285-422    AC A0A673Y5I3.1
#=GS A0A662YQC4_ACIRT/289-363    AC A0A662YQC4.1
#=GS A0A672UQL4_STRHB/271-404    AC A0A672UQL4.1
#=GS A0A1V4KQA1_PATFA/327-400    AC A0A1V4KQA1.1
#=GS A0A315W9S3_GAMAF/313-419    AC A0A315W9S3.1
#=GS A0A3P8YG87_ESOLU/239-326    AC A0A3P8YG87.1
#=GS A0A3P8WN14_CYNSE/275-361    AC A0A3P8WN14.1
#=GS A0A087YP74_POEFO/300-380    AC A0A087YP74.2
#=GS A0A093FE34_GAVST/214-299    AC A0A093FE34.1
#=GS A0A673C5C4_9TELE/283-418    AC A0A673C5C4.1
#=GS A0A226F4F6_FOLCA/233-323    AC A0A226F4F6.1
#=GS A0A1V4JXL8_PATFA/284-417    AC A0A1V4JXL8.1
#=GS A0A4W5QC95_9TELE/199-336    AC A0A4W5QC95.1
#=GS A0A3P4RY19_GULGU/286-428    AC A0A3P4RY19.1
#=GS F6RE38_HORSE/298-380        AC F6RE38.1
#=GS A0A2Y9D774_TRIMA/284-421    AC A0A2Y9D774.1
#=GS A0A2Y9L8L7_ENHLU/189-332    AC A0A2Y9L8L7.1
#=GS A0A2K5YD03_MANLE/299-381    AC A0A2K5YD03.1
#=GS A0A452QRR1_URSAM/241-319    AC A0A452QRR1.1
#=GS M3YWH9_MUSPF/272-357        AC M3YWH9.1
#=GS A0A402EKZ3_9SAUR/294-379    AC A0A402EKZ3.1
#=GS A0A671UQ49_SPAAU/328-402    AC A0A671UQ49.1
#=GS A0A668A5U0_9TELE/243-325    AC A0A668A5U0.1
#=GS A0A5N4E978_CAMDR/252-334    AC A0A5N4E978.1
#=GS A0A2U9C4U7_SCOMX/285-384    AC A0A2U9C4U7.1
#=GS A0A226NGA7_CALSU/300-433    AC A0A226NGA7.1
#=GS A0A4W5R648_9TELE/252-362    AC A0A4W5R648.1
#=GS H2LQD3_ORYLA/283-367        AC H2LQD3.2
#=GS A0A672IGX7_SALFA/289-372    AC A0A672IGX7.1
#=GS F7DKS0_XENTR/270-406        AC F7DKS0.3
#=GS I3MJ48_ICTTR/284-421        AC I3MJ48.2
#=GS A0A674EB10_SALTR/281-420    AC A0A674EB10.1
#=GS A0A6I8S6C9_XENTR/283-359    AC A0A6I8S6C9.1
#=GS A0A3P8YGA9_ESOLU/209-292    AC A0A3P8YGA9.2
#=GS A0A2K6LIB7_RHIBE/285-432    AC A0A2K6LIB7.1
#=GS A0A2I4BES6_9TELE/290-368    AC A0A2I4BES6.1
#=GS A0A452R045_URSAM/284-421    AC A0A452R045.1
#=GS A0A6J3R659_TURTR/286-432    AC A0A6J3R659.1
#=GS A0A151NJE5_ALLMI/284-421    AC A0A151NJE5.1
#=GS A0A665UQU3_ECHNA/305-367    AC A0A665UQU3.1
#=GS A0A091EJU9_CORBR/297-379    AC A0A091EJU9.1
#=GS G3STB4_LOXAF/290-434        AC G3STB4.1
#=GS A0A4W4EQ74_ELEEL/158-296    AC A0A4W4EQ74.1
#=GS A0A452S2S9_URSAM/296-437    AC A0A452S2S9.1
#=GS A0A671V986_SPAAU/279-405    AC A0A671V986.1
#=GS A0A2K5EZD2_AOTNA/327-366    AC A0A2K5EZD2.1
#=GS A0A672ZL25_9TELE/268-338    AC A0A672ZL25.1
#=GS A0A671V4M3_SPAAU/279-418    AC A0A671V4M3.1
#=GS A0A2K6DGB5_MACNE/260-344    AC A0A2K6DGB5.1
#=GS A0A665WVL5_ECHNA/288-370    AC A0A665WVL5.1
#=GS F1N0D6_BOVIN/284-421        AC F1N0D6.3
#=GS A0A671UNQ4_SPAAU/287-364    AC A0A671UNQ4.1
#=GS A0A673XZB3_SALTR/239-314    AC A0A673XZB3.1
#=GS A0A3Q4G6U3_NEOBR/271-356    AC A0A3Q4G6U3.1
#=GS A0A671UU79_SPAAU/332-409    AC A0A671UU79.1
#=GS K7G2T9_PELSI/280-386        AC K7G2T9.1
#=GS A0A6Q2Y1N8_ESOLU/387-468    AC A0A6Q2Y1N8.1
#=GS A0A667ZNJ5_9TELE/226-301    AC A0A667ZNJ5.1
#=GS A0A3B5R571_XIPMA/299-434    AC A0A3B5R571.1
#=GS A0A4U5V9B1_COLLU/295-375    AC A0A4U5V9B1.1
#=GS A0A218VAM0_9PASE/297-379    AC A0A218VAM0.1
#=GS A0A667XMS8_9TELE/252-374    AC A0A667XMS8.1
#=GS A0A674DYH7_SALTR/275-415    AC A0A674DYH7.1
#=GS L5L344_PTEAL/9-102          AC L5L344.1
#=GS A0A6Q2WQ50_ESOLU/298-376    AC A0A6Q2WQ50.1
#=GS A0A4W2DI55_BOBOX/286-432    AC A0A4W2DI55.1
#=GS A0A340XN66_LIPVE/286-433    AC A0A340XN66.1
#=GS G1N138_MELGA/258-304        AC G1N138.2
#=GS I3K428_ORENI/253-365        AC I3K428.2
#=GS A0A669E0D1_ORENI/300-434    AC A0A669E0D1.1
#=GS A0A665VNA1_ECHNA/309-387    AC A0A665VNA1.1
#=GS A0A673Y7L2_SALTR/268-402    AC A0A673Y7L2.1
#=GS A0A643BRQ1_BALPH/289-426    AC A0A643BRQ1.1
#=GS A0A4W5QMG0_9TELE/231-366    AC A0A4W5QMG0.1
#=GS A0A672USC0_STRHB/210-326    AC A0A672USC0.1
#=GS A0A672J5V0_SALFA/265-395    AC A0A672J5V0.1
#=GS A0A4W5MKJ5_9TELE/272-350    AC A0A4W5MKJ5.1
#=GS JAK2_MOUSE/299-381          AC Q62120.2
#=GS A0A3Q3W2U8_MOLML/250-376    AC A0A3Q3W2U8.1
#=GS G5B4Y4_HETGA/299-381        AC G5B4Y4.1
#=GS A0A4W5RE27_9TELE/166-281    AC A0A4W5RE27.1
#=GS A0A2U4A1Y4_TURTR/284-421    AC A0A2U4A1Y4.1
#=GS A0A5A9NTV3_9TELE/282-420    AC A0A5A9NTV3.1
#=GS A0A673YFD4_SALTR/287-365    AC A0A673YFD4.1
#=GS I3JQC0_ORENI/285-420        AC I3JQC0.2
#=GS A0A4Z2F1C0_9TELE/1-40       AC A0A4Z2F1C0.1
#=GS G1RNJ0_NOMLE/285-432        AC G1RNJ0.3
#=GS A0A2K6LW12_RHIBE/273-357    AC A0A2K6LW12.1
#=GS A0A669EVS9_ORENI/293-373    AC A0A669EVS9.1
#=GS A0A6I8RC10_XENTR/314-445    AC A0A6I8RC10.1
#=GS A0A3Q4MT05_NEOBR/298-432    AC A0A3Q4MT05.1
#=GS A0A4W5QQE8_9TELE/252-330    AC A0A4W5QQE8.1
#=GS A0A2I4CIS9_9TELE/281-413    AC A0A2I4CIS9.1
#=GS A0A672IGX9_SALFA/273-354    AC A0A672IGX9.1
#=GS M7B4M9_CHEMY/377-462        AC M7B4M9.1
#=GS A0A665UVI9_ECHNA/282-415    AC A0A665UVI9.1
#=GS L8I7D4_9CETA/290-436        AC L8I7D4.1
#=GS A0A672J8H5_SALFA/311-405    AC A0A672J8H5.1
#=GS A0A4W4EQU3_ELEEL/104-227    AC A0A4W4EQU3.1
#=GS F1NMJ9_CHICK/284-415        AC F1NMJ9.2
#=GS A0A553QH06_9TELE/258-374    AC A0A553QH06.1
#=GS A0A484DCM4_PERFV/285-370    AC A0A484DCM4.1
#=GS A0A670K542_PODMU/277-358    AC A0A670K542.1
#=GS J9P349_CANLF/284-421        AC J9P349.2
#=GS A0A1D5PK82_CHICK/315-451    AC A0A1D5PK82.2
#=GS A0A4W2DC00_BOBOX/273-357    AC A0A4W2DC00.1
#=GS A0A498MS24_LABRO/277-361    AC A0A498MS24.1
#=GS A0A670KD11_PODMU/278-368    AC A0A670KD11.1
#=GS A0A5F4D099_CANLF/302-384    AC A0A5F4D099.1
#=GS A0A673A6D4_9TELE/259-363    AC A0A673A6D4.1
#=GS A0A672H6X3_SALFA/280-412    AC A0A672H6X3.1
#=GS W5M4B2_LEPOC/298-380        AC W5M4B2.1
#=GS A0A2I3RU79_PANTR/282-419    AC A0A2I3RU79.1
#=GS A0A671FD71_RHIFE/295-440    AC A0A671FD71.1
#=GS D2HMR9_AILME/224-306        AC D2HMR9.1
#=GS A0A665VQ00_ECHNA/309-387    AC A0A665VQ00.1
#=GS A0A1L8HXG0_XENLA/284-359    AC A0A1L8HXG0.1
#=GS A0A671VYV8_SPAAU/278-400    AC A0A671VYV8.1
#=GS A0A484H163_SOUCH/357-494    AC A0A484H163.1
#=GS G3WQ34_SARHA/299-381        AC G3WQ34.1
#=GS A0A2K5BXX9_AOTNA/282-357    AC A0A2K5BXX9.1
#=GS A0A673XZ19_SALTR/291-366    AC A0A673XZ19.1
#=GS H2N755_PONAB/284-421        AC H2N755.1
#=GS A0A4W5QQN5_9TELE/203-280    AC A0A4W5QQN5.1
#=GS A0A341BFN8_NEOAA/295-441    AC A0A341BFN8.1
#=GS A0A1S3P9S9_SALSA/298-433    AC A0A1S3P9S9.1
#=GS A0A2I3LGP0_PAPAN/284-421    AC A0A2I3LGP0.1
#=GS A0A3Q7UA82_URSAR/286-429    AC A0A3Q7UA82.1
#=GS A0A2I2Y6E6_GORGO/299-381    AC A0A2I2Y6E6.1
#=GS A0A3P4LTX5_GULGU/1-35       AC A0A3P4LTX5.1
#=GS A0A4W6BZX8_LATCA/270-345    AC A0A4W6BZX8.1
#=GS A0A341D0I0_NEOAA/284-421    AC A0A341D0I0.1
#=GS A0A3Q3LLI2_9TELE/286-364    AC A0A3Q3LLI2.1
#=GS A0A665VJY0_ECHNA/285-361    AC A0A665VJY0.1
#=GS A0A672ZGE6_9TELE/296-375    AC A0A672ZGE6.1
#=GS A0A672ZIP5_9TELE/282-352    AC A0A672ZIP5.1
#=GS A0A3Q3W2N2_MOLML/259-392    AC A0A3Q3W2N2.1
#=GS A0A4W6CM24_LATCA/263-363    AC A0A4W6CM24.1
#=GS A0A672Z4E9_9TELE/249-375    AC A0A672Z4E9.1
#=GS A0A673YAN1_SALTR/292-429    AC A0A673YAN1.1
#=GS A0A4W5PYA2_9TELE/340-455    AC A0A4W5PYA2.1
#=GS A0A672J8G8_SALFA/266-386    AC A0A672J8G8.1
#=GS G1P7K0_MYOLU/170-254        AC G1P7K0.1
#=GS A0A5J5CVA9_9PERO/328-406    AC A0A5J5CVA9.1
#=GS A0A091W7X1_NIPNI/274-349    AC A0A091W7X1.1
#=GS A0A4W6C0F6_LATCA/253-370    AC A0A4W6C0F6.1
#=GS A0A674EBB7_SALTR/268-405    AC A0A674EBB7.1
#=GS A0A2K6LIG0_RHIBE/285-432    AC A0A2K6LIG0.1
#=GS A0A3L8R124_CHLGU/329-404    AC A0A3L8R124.1
#=GS A0A674D891_SALTR/282-419    AC A0A674D891.1
#=GS A0A3P9AQE5_ESOLU/259-363    AC A0A3P9AQE5.1
#=GS A0A1S3WAF8_ERIEU/284-421    AC A0A1S3WAF8.1
#=GS A0A2K5L5K0_CERAT/299-381    AC A0A2K5L5K0.1
#=GS A0A060XTD4_ONCMY/104-182    AC A0A060XTD4.1
#=GS G1PKC8_MYOLU/290-434        AC G1PKC8.1
#=GS A0A4W3K5R6_CALMI/203-333    AC A0A4W3K5R6.1
#=GS A0A672JUC3_SALFA/270-372    AC A0A672JUC3.1
#=GS A0A0D9S727_CHLSB/284-421    AC A0A0D9S727.1
#=GS A0A452HKY2_9SAUR/239-381    AC A0A452HKY2.1
#=GS F7GT47_MACMU/299-381        AC F7GT47.2
#=GS A0A667Z364_9TELE/270-342    AC A0A667Z364.1
#=GS A0A4W5R2Y6_9TELE/160-263    AC A0A4W5R2Y6.1
#=GS A0A091TQI1_PHALP/295-380    AC A0A091TQI1.1
#=GS A0A669BYF6_ORENI/252-360    AC A0A669BYF6.1
#=GS A0A673C3A9_9TELE/282-418    AC A0A673C3A9.1
#=GS A0A663FK25_AQUCH/284-420    AC A0A663FK25.1
#=GS A0A4W4H6Z1_ELEEL/273-366    AC A0A4W4H6Z1.1
#=GS A0A672J848_SALFA/301-436    AC A0A672J848.1
#=GS A0A402G644_9SAUR/3-107      AC A0A402G644.1
#=GS H0X425_OTOGA/285-430        AC H0X425.1
#=GS A0A6I8QP40_XENTR/189-274    AC A0A6I8QP40.1
#=GS A0A4W5JJK5_9TELE/247-385    AC A0A4W5JJK5.1
#=GS A0A672H3C2_SALFA/280-416    AC A0A672H3C2.1
#=GS A0A671W408_SPAAU/285-403    AC A0A671W408.1
#=GS A0A3Q1GI07_9TELE/290-367    AC A0A3Q1GI07.1
#=GS A0A4W3JVH4_CALMI/223-293    AC A0A4W3JVH4.1
#=GS A0A4W4EEC1_ELEEL/283-420    AC A0A4W4EEC1.1
#=GS A0A553R5W2_9TELE/246-383    AC A0A553R5W2.1
#=GS G3WN84_SARHA/284-421        AC G3WN84.1
#=GS A0A4W5MKX0_9TELE/193-271    AC A0A4W5MKX0.1
#=GS A0A4W5JGQ0_9TELE/285-421    AC A0A4W5JGQ0.1
#=GS A0A4W4EG50_ELEEL/281-398    AC A0A4W4EG50.1
#=GS A0A4W6EKZ3_LATCA/292-370    AC A0A4W6EKZ3.1
#=GS A0A672Z5C9_9TELE/270-395    AC A0A672Z5C9.1
#=GS A0A2K5XZL8_MANLE/285-432    AC A0A2K5XZL8.1
#=GS A0A4U5UL97_COLLU/299-431    AC A0A4U5UL97.1
#=GS A0A5E4CD02_MARMO/299-381    AC A0A5E4CD02.1
#=GS A0A6Q2XEE3_ESOLU/255-393    AC A0A6Q2XEE3.1
#=GS A0A5F9CQX7_RABIT/286-339    AC A0A5F9CQX7.1
#=GS A0A673YF21_SALTR/291-366    AC A0A673YF21.1
#=GS A0A4W2I4Q1_BOBOX/299-381    AC A0A4W2I4Q1.1
#=GS A0A670KEB6_PODMU/285-355    AC A0A670KEB6.1
#=GS A0A4W3JKL6_CALMI/269-351    AC A0A4W3JKL6.1
#=GS A0A2Y9I9Q1_NEOSC/286-429    AC A0A2Y9I9Q1.1
#=GS F1MCX4_BOVIN/286-432        AC F1MCX4.3
#=GS A0A2K6NJZ8_RHIRO/281-357    AC A0A2K6NJZ8.1
#=GS A0A091SDR0_NESNO/283-416    AC A0A091SDR0.1
#=GS F8W4H3_DANRE/286-409        AC F8W4H3.1
#=GS A0A3Q2ZY34_KRYMA/276-365    AC A0A3Q2ZY34.1
#=GS A0A6Q2ZI19_ESOLU/283-421    AC A0A6Q2ZI19.1
#=GS A0A6I8S906_XENTR/237-313    AC A0A6I8S906.1
#=GS A0A673A7H8_9TELE/281-368    AC A0A673A7H8.1
#=GS A0A0D9QZJ5_CHLSB/218-302    AC A0A0D9QZJ5.1
#=GS A0A2K6RHP9_RHIRO/284-421    AC A0A2K6RHP9.1
#=GS A0A668AFF5_9TELE/251-368    AC A0A668AFF5.1
#=GS B0V237_DANRE/259-360        AC B0V237.1
#=GS A0A4W5RHB5_9TELE/284-419    AC A0A4W5RHB5.1
#=GS A0A1B0GTR9_HUMAN/299-381    AC A0A1B0GTR9.1
#=GS A0A669CDA1_ORENI/254-386    AC A0A669CDA1.1
#=GS A0A091K588_COLST/208-260    AC A0A091K588.1
#=GS A0A4W5QAT6_9TELE/226-304    AC A0A4W5QAT6.1
#=GS A0A669DTX6_ORENI/275-319    AC A0A669DTX6.1
#=GS H1A3H7_TAEGU/287-361        AC H1A3H7.2
#=GS G3P1H3_GASAC/255-366        AC G3P1H3.1
#=GS A0A6I8Q6Y7_XENTR/266-399    AC A0A6I8Q6Y7.1
#=GS W5LHR3_ASTMX/268-407        AC W5LHR3.2
#=GS A0A669BI32_ORENI/299-432    AC A0A669BI32.1
#=GS A0A4W5RDI0_9TELE/289-366    AC A0A4W5RDI0.1
#=GS A0A5F9DNU8_RABIT/100-153    AC A0A5F9DNU8.1
#=GS A0A087VNE1_BALRE/244-373    AC A0A087VNE1.1
#=GS A0A6I8S2H9_XENTR/287-416    AC A0A6I8S2H9.1
#=GS A0A6Q2YIW7_ESOLU/294-426    AC A0A6Q2YIW7.1
#=GS A0A2K5RM66_CEBCA/326-400    AC A0A2K5RM66.1
#=GS A0A672Z387_9TELE/284-404    AC A0A672Z387.1
#=GS A0A668A5H1_9TELE/281-408    AC A0A668A5H1.1
#=GS A0A4W6D9S5_LATCA/307-440    AC A0A4W6D9S5.1
#=GS A0A401PUU4_SCYTO/117-246    AC A0A401PUU4.1
#=GS A0A485N9K6_LYNPA/284-420    AC A0A485N9K6.1
#=GS A0A6Q2XWB4_ESOLU/221-299    AC A0A6Q2XWB4.1
#=GS A0A669DXS1_ORENI/284-362    AC A0A669DXS1.1
#=GS A0A3B5K3X8_TAKRU/282-327    AC A0A3B5K3X8.2
#=GS A0A665VK31_ECHNA/283-359    AC A0A665VK31.1
#=GS A0A669CQW4_ORENI/272-342    AC A0A669CQW4.1
#=GS F1Q6A2_DANRE/283-365        AC F1Q6A2.3
#=GS A0A674MBD1_TAKRU/315-420    AC A0A674MBD1.1
#=GS H2M2I1_ORYLA/292-430        AC H2M2I1.2
#=GS A0A4W4EE62_ELEEL/332-403    AC A0A4W4EE62.1
#=GS A0A669DYS8_ORENI/345-389    AC A0A669DYS8.1
#=GS A0A4W3JN40_CALMI/300-424    AC A0A4W3JN40.1
#=GS A0A3Q3B2A8_CHICK/333-415    AC A0A3Q3B2A8.1
#=GS A0A1S3LVA6_SALSA/284-421    AC A0A1S3LVA6.1
#=GS A0A3Q3LY54_9TELE/281-418    AC A0A3Q3LY54.1
#=GS A0A4W5R2P0_9TELE/292-366    AC A0A4W5R2P0.1
#=GS A0A669EYA9_ORENI/313-383    AC A0A669EYA9.1
#=GS G3PKW3_GASAC/285-418        AC G3PKW3.1
#=GS S7NZR3_MYOBR/299-443        AC S7NZR3.1
#=GS A0A4W5RHB9_9TELE/284-415    AC A0A4W5RHB9.1
#=GS A0A673XZC8_SALTR/233-308    AC A0A673XZC8.1
#=GS A0A3Q2CA66_CYPVA/274-412    AC A0A3Q2CA66.1
#=GS A0A667Y3U0_9TELE/281-362    AC A0A667Y3U0.1
#=GS G3RIC1_GORGO/280-357        AC G3RIC1.2
#=GS A0A553QH03_9TELE/267-383    AC A0A553QH03.1
#=GS A0A672GXK4_SALFA/351-470    AC A0A672GXK4.1
#=GS G1PL96_MYOLU/299-380        AC G1PL96.1
#=GS A0A6I8N3R9_ORNAN/176-313    AC A0A6I8N3R9.1
#=GS A0A672IHG4_SALFA/296-378    AC A0A672IHG4.1
#=GS A0A091EVH4_CORBR/282-412    AC A0A091EVH4.1
#=GS A0A669BNX7_ORENI/320-440    AC A0A669BNX7.1
#=GS A0A674DZL2_SALTR/243-377    AC A0A674DZL2.1
#=GS A0A671VHK2_SPAAU/309-387    AC A0A671VHK2.1
#=GS I3MAE0_ICTTR/280-357        AC I3MAE0.2
#=GS A0A2U4BB84_TURTR/299-381    AC A0A2U4BB84.1
#=GS A0A4W2GAR3_BOBOX/218-300    AC A0A4W2GAR3.1
#=GS A0A667XPA3_9TELE/274-360    AC A0A667XPA3.1
#=GS F7B2N9_HORSE/274-357        AC F7B2N9.2
#=GS A0A1U8D4W6_ALLSI/407-547    AC A0A1U8D4W6.2
#=GS A0A482VXW3_9CUCU/233-301    AC A0A482VXW3.1
#=GS A0A667XVD7_9TELE/289-370    AC A0A667XVD7.1
#=GS TYK2_MOUSE/288-431          AC Q9R117.3
#=GS G3U3K6_LOXAF/299-381        AC G3U3K6.1
#=GS A0A3P8X4U7_CYNSE/283-418    AC A0A3P8X4U7.1
#=GS A0A674E0A1_SALTR/284-394    AC A0A674E0A1.1
#=GS A0A3Q4GD16_NEOBR/255-360    AC A0A3Q4GD16.1
#=GS U3IXD0_ANAPP/284-417        AC U3IXD0.2
#=GS A0A091USR2_NIPNI/284-417    AC A0A091USR2.1
#=GS A0A3Q4H958_NEOBR/279-392    AC A0A3Q4H958.1
#=GS A0A673YFV2_SALTR/283-418    AC A0A673YFV2.1
#=GS A0A674E9P1_SALTR/266-398    AC A0A674E9P1.1
#=GS A0A670KAF9_PODMU/295-380    AC A0A670KAF9.1
#=GS A0A1S3FBE8_DIPOR/255-286    AC A0A1S3FBE8.1
#=GS A0A669ENZ9_ORENI/242-371    AC A0A669ENZ9.1
#=GS A0A484CG55_PERFV/300-437    AC A0A484CG55.1
#=GS A0A4W4H722_ELEEL/285-367    AC A0A4W4H722.1
#=GS A0A091PZE8_LEPDC/284-417    AC A0A091PZE8.1
#=GS A0A665UQG0_ECHNA/301-432    AC A0A665UQG0.1
#=GS W5KTH7_ASTMX/282-420        AC W5KTH7.2
#=GS A0A286ZLI2_PIG/284-420      AC A0A286ZLI2.1
#=GS A0A3P9CMB0_9CICH/283-366    AC A0A3P9CMB0.1
A0A2K5ZKJ8_MANLE/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A5C6MSB8_9TELE/194-327               ..................................................fnggyygycn---------------.KTS.SH...D.QN...TQASRDMQVLVTGTTGISWRKKPDT.......................T..SVVSK..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A452QRX6_URSAM/251-292               .................................................teqvilndtfs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-----FF..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2U9CRA6_SCOMX/281-416               ...............................................gngsssysdstna---------------.-QG.VS...K.DN...FVAPATHEIVVSGTKGIQWRTVSIQ.......................K..AQANA..YLRS.YY.MN.TT...K..S..KHQS..S..Q..AT..AK.....TPNKL.SSFCDFHEITHI.........AL.S..........G..........A..N................VCIS.....TQDNQCM..........V.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A3Q1C5B6_AMPOC/302-433               ......................................................gyfgyy------------NQS.QEQ.GQ...T.QN...METSHDMQVLVTGTTGISWRKKPAM.......................T..PVISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..NK..EA.....-NEGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A4W5QJQ8_9TELE/269-347               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A671VH66_SPAAU/276-354               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2Y9SI10_PHYMC/284-421               ............................................................EIFETSMLLISSENE.MNL.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5RDZ8_9TELE/269-351               ...................................................gesgiqfsg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....HCPEW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
D6WT73_TRICA/226-300                   .................................................hptepgikfls---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-E.....SNKDW.QRICTIEELGFI.........SI.R..........D..........DdgT................VEIS.....RKNGIPF..........Y.LK...........F....NSN.QLMFSFISLLDGYYRLTC----kw................
A0A673Y8E2_SALTR/295-368               .......................................................tqspl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........V.RA...........P....ASQlLEALSFVSLLDGYFRLTADAHH..................
A0A4W6BZX2_LATCA/289-423               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................K.aQANSY..LRND.YM.SY.MR...K..T..KHQS..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A498NV82_LABRO/355-385               ..........................................................ap---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LD...........L....FYR.DAALSFAALVDGYFRLTVDAHH..................
A0A667Y3P0_9TELE/276-360               ..................................................adsgiqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..HK.....DSEQL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A4W6DA93_LATCA/288-412               ..............................................pvslsvtqegeian---------------.---.--...-.--...----GGYHVLVTGTTGISWRKKPAA.......................T..SVISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A218U7X2_9PASE/256-385               ..rseeifhvrspgsaapvaihvsgdggvawscggsevlrgggprcgalrdglvtrsvps---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QSR.QHFCDFPDIADI.........SI.K..........Q..........A..Asrdgg.....pvenrlVTVT.....KADNRVL..........E.VE...........F....ATL.REARSFVALLDGYYRLTADAQH..................
G3QT84_GORGO/285-430                   ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvskg...............ssgsS..GRNPQ..SSLS.GK.KA.KA...H..-..KAAG..Q..P..AD..RP.....REPLW.VYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A093QW73_PHACA/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A096P1L9_PAPAN/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0JM01_XENTR/297-379                   ......................................................skgkpk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..RE..SL.....ADMDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A2R9C372_PANPA/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A384B744_BALAS/273-357               ...........................................vaggsgiawspgehkvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprigpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A5F4CCQ3_CANLF/166-267               ................................................laprlrhgards---------------.---.--...-.--...-------------------------.......................S..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A5J5DGU8_9PERO/307-352               ........................................................aaes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTSDAHH..................
A0A455BLA3_PHYMC/55-137                .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriITIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
A0A060Z6D0_ONCMY/2-135                 .....................................................lepralv---------VTQEVE.TNG.EL...S.HR...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..--GK..Q..T..KK..ND.....ASEGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A2K6NJX6_RHIRO/303-333               .....................................................sqeaefp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....-GL.PEALSFVALVDGYFRLTTDSQH..................
A0A672Z5C6_9TELE/276-408               ...................................................llepksvsv--------------K.QEE.DQ...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A673V4B2_SURSU/333-469               ............................................................EIFETSMLLISSENE.MNW.FN...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A670KEH3_PODMU/259-360               ...........................qawvpaqaatgsawtihvssekgiltshsgakg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----T.HLFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A663FK24_AQUCH/184-317               ............................................................EIFETSFLLISSENE.INI.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..QK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A4W5QM70_9TELE/246-380               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQ.......................K..VCLPI..RLFD.WN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A556VYC7_BAGYA/273-410               ........................................tvepkslrvcgegevfptht---------------.---.--...P.SI...GDEGQTYEVQVCGTTGILWRKKQYQ.......................N..ALTFK..EKSR.SK.KA.KT...D..S..KQKN..D..N..-K..ND.....ANNEW.ILFSDFYEITHI.........VT.K..........E..........A..G................VTVY.....RQDNKTM..........E.LQ...........M....DYR.EEALAFAALVDGYFRLTVDAHH..................
A0A553QGZ8_9TELE/267-383               ...................................................ssgsylits---------------.---.QT...Q.SE...EAINATHEVRVSGCSGISWRKFSAQ.......................-..-RVND..Y---.--.--.--...-..-..IPSQ..N..R..ET..ES.....VDDGW.NSFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IC...........L....GSS.MQARSLVSLIDGYFRLTTDAHH..................
A0A665UU38_ECHNA/277-409               ................................................dggssyanttha---------------.-QG.VS...K.DN...FTASITHEIRVSGTQGIQWRKASAQ.......................R..VSQTA..RFLN.DY.--.MS...T..T..EQQP..S..Q..QK..AN.....TPDEL.TTFCDFPEITHI.........AI.S..........G..........A..T................VCIS.....TQDNRCM..........V.RA...........L....VYP.FEARSFISLLDGYYRLTADAHH..................
A0A6I8QLR1_XENTR/267-346               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..PK..ER.....ESLDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A1U7SPN9_CARSF/298-380               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nkegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W6BT82_LATCA/285-419               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................K.aQANSY..LRND.YM.SY.MR...K..T..KHQS..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4U5VUR7_COLLU/283-419               ................................................gdgsssysnmth---------------.AQG.VS...K.DT...FRAPTTHEIMVTGTKGIQWREVSSQ.......................K.aQANTY..FRND.PL.NY.MR...K..T..KQQS..S..Q..LS..AN.....TPNKW.TFFCDFPDIIHI.........GI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A498MD09_LABRO/277-355               ......................................................srvkea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-R.....DREDP.QVYCDFSDVIDI.........SI.Kqgtk.dgsveN..........R..I................VSIN.....RQDGQTL..........E.LE...........F....HSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A1A6HMC7_NEOLE/290-433               ..........................................................qp--ERDPCCIQNSGQS.MGD.PG...P.EL...ATRLPTHEVLVTGTRGIQWHPLQIQese.................rgnS..RGNPQ..GNRS.GK.KA.KD...P..-..EAGE..Q..L..AK..SP.....GEPPW.TYFCDFQDISHV.........VL.K..........E..........C..H................VCIH.....LQDNKCL..........K.LC...........L....RSR.AEALSFVALVDGYFRLTTDSSH..................
A0A060Z5I9_ONCMY/1-70                  ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A091KC07_COLST/296-380               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A5F7ZH35_MACMU/286-423               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A669BX01_ORENI/80-158                ........................................................crel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A674D956_SALTR/283-420               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A665VLH1_ECHNA/288-370               ....................................................iqtrgsch---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TE.....SSLEW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A087XVK1_POEFO/301-432               .....................................................gyygyyn----------QSQ-L.QTK.CQ...N.QN...LEASSDMQVLVIGTTGISWRQKPAA.......................V..PVMPK..DKSK.SK.SK.QD...E..-..--KQ..K..N..RN..KE.....TDDGW.VVFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A5F9ZH07_HUMAN/123-260               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
G1MVV3_MELGA/252-388                   ...............................................gekaqpcgngghe-------------MA.ERG.DA...A.AP...GDSSVSHEVLVSGTTGIQWRPVPSE.......................QsvEVISH..RGYF.GR.RS.--...-..-..RRKD..P..E..PP..AP.....PEPPW.VHFCDFQEITHI.........VV.Q..........D..........C..R................VCVH.....RQDNKCM..........E.VL...........L....PSH.PSALSFISLLDGYFRLTADSNH..................
A0A667ZAK0_9TELE/300-378               .....................................................skgkegd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....AAEEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A2K5L5N3_CERAT/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A674D947_SALTR/269-406               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A3Q2DNL9_CYPVA/301-434               ...............................................gyygnynqgqvqi---------------.--K.GQ...N.QN...FEASQGMQVLITGTTGISWRQKPAP.......................V..PSTLK..DKSK.LK.KS.KQ...D..-..EKQK..N..G..RN..KE.....LNDGW.VLFCDFHEITHT.........II.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.EEALSFAALVDGYFRLIVDAHH..................
M3ZWG4_XIPMA/258-364                   .........................setfrvnrssshseatftllrvcgetgiqtgqldg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-ALEW.QTFCDFHEIVDI.........SI.KrilnemvpqdS..........R..M................VTIT.....RKDDRCL..........E.AS...........F....QSR.KEALSFMSLIDGYFRLITDSSH..................
A0A6I8S889_XENTR/270-403               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................-..----K..KDRK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
A0A665UPJ0_ECHNA/304-365               ........................................................lcic---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----W.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........-.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A1S3KQH9_SALSA/326-404               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A452QRS4_URSAM/267-339               ......................................................vpiddl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A671VY45_SPAAU/285-411               .....................................................lsvqege---------------.---.--...-.-N...METSHDMQVRVTGTTGISWRKKPPTvs...................gtA..NVICK..EKGK.SK.KN.KQ...D..G..KQKN..D..-..KN..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A673WDD6_SALTR/295-378               .................................................crdghkdseqv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-L.....TAQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A1V4KY01_PATFA/314-449               .......................................ldtssegeraqlganggrspp---------------.---.--...-.--...KEPLVTHELLVTGTSGIQWRPVPAE.......................S.lEGFSQ..RGYF.GR.RS.GS...Q..-..-EAE..T..K..AE..QR.....NEAKW.AHFCDFREITHV.........VV.K..........D..........N..R................VSVH.....RQDNKCL..........E.LL...........L....PSA.PVALSLVSLLDGYFRLTADSSH..................
A0A2Y9F7X6_PHYMC/279-357               .................................................iawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprigpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A452F668_CAPHI/286-433               ............................................................QAEGEPCYLRDGGQP.PAD.PG...S.ES...AAGPPTHEVLVSGTKGIRWRLVTAEvsevp.............lpsnsG..GTMPD..ADPS.GK.RM.KA...K..-..EAGG..E..P..VD..RP.....RETPW.SYFCDFQDITHM.........VL.K..........E..........C..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
I3M8D2_ICTTR/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQNL.QLYCDFPEVIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3P8ZAR2_ESOLU/263-366               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A672IUT4_SALFA/286-411               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQPSWTSI-.......................-..--TND..YLNY.TK.KT.KQ...Q..-..QAGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A672ISH7_SALFA/276-362               .................................................aadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A1U7S0K0_ALLSI/305-445               ........................................................eddr----TPLYVNGEPPM.PVD.AP...-.PH...GDCLPTHEVLVTGADGIRWRPVPVE.......................V.tESPPH..RGYF.GR.KG.RS...K..E..PGSR..E..P..PTlaEH.....NKPKW.VQFCDFQEITHV.........VL.T..........G..........A..C................VGIH.....RQDNQCL..........E.LV...........L....PSP.EVALSLVSLVDGYFRLTADASH..................
M3ZJ44_XIPMA/286-410                   ..................................................fepvslaitq---------------.---.--...-.EK...ELSTGGYYVLVTGTTGISWRQKPVP.......................-..-VMPK..DKSK.SK.KS.KQ...D..-..EKQK..N..N..RN..KE.....TGDGW.VLFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A671FA08_RHIFE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3N0Y8G7_ANAGA/283-364               ........................................................qwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..HK..DT.....QSEDL.QTYCDFAEVVDI.........SI.R..........Q..........A..Skegt.......nmnriVSIN.....RQDGKIL..........E.LV...........F....STS.MEALSFVSLIDGYYRLTTDAHH..................
A0A3Q4ATP0_MOLML/261-387               ................................................sglgcelfepis---------------.---.--...-.QN...METSHDTQVLVTGTTGISWRKKPTP.......................-..-VNSK..EKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A4X2K9Z9_VOMUR/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..D..SE..TL.....TEQDL.QMYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nenrvVTIH.....KQDSKNL..........E.IE...........F....HSL.REALSFVSLIDGYYRLTADAHH..................
A0A665VND6_ECHNA/312-387               .......................................................rgkve---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EGEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A672UZA3_STRHB/216-297               .....................................................tgnggiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..SK.....SRDDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A091RTW2_9GRUI/294-380               ..................................................giqcsrgklk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A087XSD4_POEFO/294-373               ......................................................wcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFHDVTDI.........SI.K..........Qacke.gntesR..L................VTIN.....KQDGKNL..........E.LE...........F....PSL.FEALSFASLVDGYYRLTTDAHH..................
A0A1L8GFQ7_XENLA/168-293               ....................................vheieneclgmavlaishyamkrn---------------.---.--...-.--...----------------IQLHDLPKDi.....................gL..CTASE..KDRK.IK.WK.KT...E..S..KSKN..S..D..KK..GK.....SKDEW.HCFSYFPEITHI.........VI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....STP.EEALSFAALIDGYFRLTADAHH..................
A0A665VN97_ECHNA/292-367               .......................................................rgkve---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EGEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A4W4HE42_ELEEL/278-365               ..................................................sadqgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..QK..EA.....QPEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A2Y9TJT6_PHYMC/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEspsd..............gggggG..GRIPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VV..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........D..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A4W3GYQ6_CALMI/315-357               ..............................................sgsvvvdclpsllq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A4W6CM35_LATCA/265-365               ................................ashsksafslikvtgetgiqtsgschpd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....SALEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A2K5H7P1_COLAP/281-357               ......................................................wtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A671W3Z8_SPAAU/314-409               ....................................................clslkqan---------------.---.--...-.--...-------------------------.......................-..-VICK..EKGK.SK.KN.KQ...D..G..KQKN..D..K..-N..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A3N0YKL0_ANAGA/281-359               ........................................................srgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..AR.....DREDL.QVYCDFSDVIDI.........SI.Kqgtk.dgsveN..........R..I................VSIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2I2U8B7_FELCA/284-420               ............................................................EIFETSMLLISSENE.MNW.FH...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A665WV78_ECHNA/284-366               ...................................................giqwcreki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQAL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A6J3R6M8_TURTR/325-471               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtasd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VY..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A3P8SS74_AMPPE/302-433               .....................................................gyfgyyn-------------QS.QEQ.GQ...T.QN...MKTSHDMQVLVTGTTGISWRKKPAM.......................T..LVISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..NK..EA.....-NEGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A667XI82_9TELE/285-367               ....................................................iqtsgncq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SD.....SVLEW.QTFCDFQEIVDI.........SI.KracheqvppdS..........R..M................VTLT.....RKDDRCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
H2L7P7_ORYLA/295-373                   .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....ADEEL.QTLCDFPDITDI.........GI.K..........Qaskd.gtsesR..T................VTLN.....KQDGKNL..........E.LE...........F....SSL.PEALSFVSLVDGYYRLTTDAYH..................
A0A5E4ACQ3_MARMO/280-357               ......................................................swspaa---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PEALSFLALVDGYFRLICDSRH..................
A0A3Q3W2M5_MOLML/288-419               ....................................................nggyygcy------------NQS.QGQ.GQ...S.QN...METSHDTQVLVTGTTGISWRKKPTP.......................-..-VNSK..EKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
F1QWX8_DANRE/272-347                   .....................................................aaapepe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---DL.QVYCDFSDVIDI.........SI.Kqgtk.dgsveN..........R..I................VTIN.....RQDSQTL..........E.LE...........F....QSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A665WV51_ECHNA/282-364               ...................................................giqwcreki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQAL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A226PM45_COLVI/325-409               ...................................................qcsrgklkn---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A096MCU2_POEFO/292-377               ......................................................iqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KL..K..D..SD..EV.....CEQEL.QTLCDFHDVTDI.........SI.K..........Qacke.gntesR..L................VTIN.....KQDGKNL..........E.LE...........F....PSL.FEALSFASLVDGYYRLTTDAHH..................
A0A5C6NT12_9TELE/964-1077              ...............................................retweesgslpnk---------------.-TH.P-...Q.CD...CKAPATHEIMVNGNKGISWRISTQK.......................-..-----..----.--.--.-A...Q..-..----..-..S..PQ..PD.....TPNDW.TAFCDFPEIAHI.........AI.T..........E..........T..N................VCIS.....TQDNHCM..........E.VQ...........M....SST.QEAHSFISLLDGYYRLTADAH-n.................
A0A4W4FCC5_ELEEL/266-398               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPAE.......................Y..CPLRF..VNIY.SK.E-.-L...A..-..KPME..Q..P..S-..EE.....EINGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
J9JIK9_PIG/299-381                     .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A6G1B418_CROCR/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3Q0GV11_ALLSI/297-379               .......................................................srgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......sesriVTIH.....KQDSKNM..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W4GJ75_ELEEL/219-299               .................................................iqtpniqllav---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
G1LYZ3_AILME/290-433                   ..........................................................qa--GGEPYYIRDGGQA.PPE.PG...P.DL...APGPPTHEVLVTGTGGIQWRPVQAEgpr.................gdgS..SRNPH..AGPT.GK.KT.KA...P..-..EVVN..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A665VK46_ECHNA/262-367               .................................tetfqvdahsksavsllrvsgetgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..R..G..SC..HT.....ESSLW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W4FCJ5_ELEEL/256-386               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPAE.......................V..RG---..DTCL.DL.AQ.AI...-..-..-YNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A4V6AQT0_COLLU/295-373               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDCKTL..........E.LE...........F....STL.SEALSFVSLIDGYYRLTTDAHH..................
A0A674EB63_SALTR/258-394               ....................................................epevlrvt----------DSEGE.IEG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.NTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A4W5JGS2_9TELE/274-410               ....................................................evcmlrvt----------DSEGE.IEG.TP..tS.CN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A0P7WCB5_SCLFO/275-363               ...............................................kvlqvsgesgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..TT.....DTLEW.QTFCDFPEVTEI.........SI.K..........QayreqvplesR..V................VTVT.....RQDDRCL..........E.AE...........F....QTL.AEALSFVALIDGYFRLTTDSSH..................
W5ML83_LEPOC/303-443                   .......................................eraafyvrdfwnlgppgpegc---------------.---.--...-.EP...PDGRATHEVKVSGMEGIQWRVARTEv....................seG..CGGGC..HTRK.SK.RA.KG...R..-..TKLP..Q..Q..VE..YR.....SEPQW.SFFCDFPEITHI.........VI.N..........G..........Y..R................VSVS.....RQDNKSM..........E.LT...........L....RSA.LEARSFVSLLDGYYRLTADSHH..................
A0A452ID23_9SAUR/307-445               ............................................................EIFETSSLQILTENE.KHG.FN...F.GD...SGIIPQYEVMVTGNNGIQWRRKPNV.......................V..QPERE..KHNK.LK.RK.KS...D..S..KNKK..D..E..EK..NK.....MREEW.NNFSYFPEITLL.........VI.K..........E..........S..T................ININ.....KQNHEKM..........E.LK...........L....SSH.EEALSFASLVDGYFRLTADAH-l.................
A0A2I4CI85_9TELE/203-282               ......................................................wcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Q..........V..Skega.......gesrlVTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A091W206_NIPNI/244-369               ............................................................EGEKVQLYVNGGHSQ.LEH.GH...A.LL..pKDQPVTHEVLITGTTGIQWRPVPVE.......................-..-----..----.--.-V.EL...E..P..KGPT..Q..P..AE..-R.....SEPKW.AHFCDFREITHI.........VI.K..........D..........C..R................VSIN.....RQDNKCL..........E.VV...........L....PSS.ESALSLVSLVDGYFRLTADSSH..................
A0A6Q2XW72_ESOLU/240-369               ............................................pevlrvmdsegeiegt---------------.---.PL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................-..-----..VRKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
JAK2_CHICK/297-379                     ....................................................srgklknc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A671V6H3_SPAAU/190-323               ................................................rkdgvvsssysd------------TNH.AQG.VS...K.AS...YIAPATHEIMVSGTKGIQWRDAPGP.......................K..VRQQM..--SS.LS.R-.-P...H..S..QQSS..Q..-..PN..EN.....TPSTW.TSFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFVSLLDGYYRLTADAHH..................
A0A4W4FTP6_ELEEL/300-372               ......................................................gdvqdl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QVYCDFPDVIDI.........SV.K..........Q..........A..Skdga.......ierriVTIN.....RQDGQTL..........E.LE...........F....QSL.TEALSFVSLIDGYYRLTTDAHH..................
A0A672UZA7_STRHB/264-345               ..............................................qcsrgklkdcetld---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5MPR9_9TELE/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KL...E..-..GKQT..K..P..KK..KD.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A4W5MMZ0_9TELE/290-427               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KL...E..-..GKQT..K..P..KK..KD.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A672IFT7_SALFA/268-350               .....................................................giqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A4W5R1G2_9TELE/295-374               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A4W4EN58_ELEEL/164-302               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................N..VLNVK..DKSK.SR.KS.KV...D..S..KQKN..E..K..-K..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A401SHL5_CHIPU/299-438               .......................................................etykp-----TSLLISAENE.RVM.SNhepI.EK...EQKEREHEVMIAGSIGIKWRRVPKE.......................S..AVGLK..EKSK.LK.KS.K-...-..S..KKKS..G..E..NK..RV.....LNEDW.NLFSHFCEITHI.........VI.K..........D..........S..I................VIIN.....KQDNKKL..........E.LN...........L....SSY.EEALSLVSLIDGYFRLTVDAHH..................
A0A2Y9QSG0_TRIMA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QIYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSVIDGYYRLTADAHH..................
A0A671VHY6_SPAAU/279-357               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A3Q2H1C4_HORSE/284-421               ............................................................EIFETSELLISSENE.MNR.FH...L.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KYKK..D..E..EK..NK.....IREEW.NNFSYFPEITHV.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672Z4I1_9TELE/236-377               ...........kkflnefnhrtvkdsnitpydlkikylatleglttglgwellepksvsv---------------.---.--...-.--...---------------------KQEE.......................E..LCNGF..EKNK.SK.KN.KH...D..S..KQ-K..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........-.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A3Q3ADB6_KRYMA/298-377               ......................................................wcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Q..........V..Skega.......gesrlVTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A5J5N9Z2_MUNRE/282-418               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHI.......................-..-VPVE..KEKK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671XVD8_SPAAU/305-375               ........................................................lqel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A4W5RQ50_9TELE/284-419               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..K..-K..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A3Q1E9V9_9TELE/306-385               .........................................................stg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..ED..KG.....AEEEL.KTYCDFPAVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....RQDNHIL..........E.LE...........F....HSL.AEALSFVSLVDGYYRLVADAHH..................
A0A4W3K5Q3_CALMI/291-401               ...........................................rsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................-..-----..----.--.-V.KV...W..-..----..-..V..AR..PR.....GQQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A3Q3WTR8_MOLML/286-419               ...................................................sgsfsntth---------------.AEG.NS...K.DS...FRAPATHEIMVTGPHGIQWRKLSSQ.......................K.aQENAY..FRND.PL.NY.TR...K..T..KQLP..S..Q..PK..AN.....TPNKW.SSFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VE...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A672Z4N3_9TELE/281-402               .......................................................ellep---------------.-KS.VS...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................-..----V..KKNK.SK.KN.KH...D..S..KQ-K..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A2K5PWB1_CEBCA/284-421               ............................................................EIFETSMLRISSENE.MNW.FY...S.ND...SGNVQYYEVMVTGNLGIQWRQKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....VREEW.SSFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q1ITJ4_ANATE/288-365               ....................................................tchpdgal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---DW.QTFCNFQEITDI.........NI.KrvchehvpqdS..........R..I................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A402ESW3_9SAUR/285-420               ............................................................EIFETSSLLISSENE.KS-.FN...L.ND...SDPLPQYEVMVTGNHGIQWRLKPQV.......................-..TPYEK..EKHK.IK.RK.KS...D..S..KVKK..N..E..DK..NK.....-KEEW.NSFSYFLEITHI.........VI.K..........D..........C..T................VCTY.....RQDNNRM..........E.LV...........L....SSH.EEALSFAALVDGYFRLTADAHH..................
A0A060Z096_ONCMY/204-282               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADQGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A2K5WBL6_MACFA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
W5L4R3_ASTMX/248-383                   ..........................................nlealdsgfytehfqvke---------------.---.--...-.--...-PSAGQVTIIVSADQGIQWCREKQK.......................-..-----..DEQS.ED.KT.AF...S..L..IPLN..L..T..EV..FF.....FIQDL.QTYCDFPHVIDI.........SI.R..........Qaske.gsnksR..V................VSIN.....KQDGKTL..........E.LE...........F....SSH.AEALSFVSLIDGYYRLTVDAH-y.................
A0A667XGV8_9TELE/277-401               .........................................gsssylstthaigdagdsf---------------.---.--...-.--...-GAPVTHEIMVSGTKGIQWRKVSGP.......................-..----G..DTDY.MR.KA.KQ...Q..-..---P..S..Q..SN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A2Y9SYZ0_PHYMC/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriITIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
H2TE39_TAKRU/290-403                   ...............................................retweesgslpnk---------------.-TH.P-...Q.CD...CRAPATHEIMVNGNKGISWRISTQK.......................-..-----..----.--.--.-A...Q..-..----..-..S..PQ..PD.....TPNDW.TAFCDFPEIAHI.........AI.T..........E..........T..N................VCIS.....TQDNHCM..........E.VQ...........M....SST.QEAHSFISLLDGYYRLTADAH-n.................
A0A669ERW6_ORENI/274-394               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................-..-----..----.--.RV.CI...D..-..TDAG..I..Y..VD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A4W5QQN9_9TELE/283-420               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A6I8S3U7_XENTR/290-346               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................S..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vyrgnkgk..........
A0A667XEA2_9TELE/290-371               ......................................................iqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..RH..KD.....SEQEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A671UPH5_SPAAU/290-364               ........................................................ppdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ALW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A672J8T1_SALFA/285-420               ........................................................gysg------YYNQSQGQN.QGQ.NQ...S.QN...VETSHDMQVLVAGTSGISWRSKPSV.......................M..PVISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A670KCQ3_PODMU/295-380               .......................................................iqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..D..SE..TL.....AEQEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
A0A662YT38_ACIRT/308-390               .......................................................srgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SN..SL.....SDQEL.QTYCDFPDVIDV.........GI.K..........Q..........A..Nkdgs.......tesriVTIS.....KQDGNSL..........E.VE...........F....SSL.QEALSFVSLIDGYYRLTADAHH..................
A0A4W2DG60_BOBOX/327-359               ...........................................................q---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....----KPH..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W3HIY6_CALMI/290-365               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A4W3JB84_CALMI/331-402               .....................................................sspsalg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A671XZ85_SPAAU/272-347               ........................................................kgkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EEGEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A091IV20_EGRGA/295-380               ....................................................iqcsrgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A6I8QWJ3_XENTR/237-313               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A673A5U9_9TELE/296-384               ................................................qtngssdpddgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..WR..NQ.....KTLEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A3Q3LH92_9TELE/305-383               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..EG.....EEEEL.QTYCDFPEVIDI.........SI.K..........Q..........S..Nkegs.......vesriVTLT.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADTHH..................
A0A6I8QQW9_XENTR/246-325               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..PK..ER.....ESLDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A6I8P5T5_ORNAN/308-446               ................................................ltpdarsgppap---------------.---.--...-.--...GDQTATHEVLVTGTGGIAWRPLPAQvsgmga...........ggggggG..WMLPL..LLPS.SS.P-.AL...A..R..RVEC..W..E..PG..VG.....QEAPW.ERFCDFQEITHV.........VL.T..........G..........S..R................VTIH.....QRDNQSL..........E.LA...........L....PTP.AAALSLISLVDGYFRLTTDASH..................
A0A3P8SSF8_AMPPE/282-419               ...................................................dadgsssys---------NTTYAQ.G--.AS...K.DN...FQAPATHEIMVSGTKGIQWREVSAH.......................R..AQANT.yLRND.YM.NY.MK...K..A..KQQP..R..Q..PN..AN.....TLNKW.TFFCDFPEITHI.........AI.T..........E..........A..N................VCIS.....TQDNQYM..........E.VQ...........M....NSS.QEAHSFISLLDGFYRLTADAHH..................
A0A672JQG9_SALFA/222-303               .....................................................qtsgsdq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..PD.....EDLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A6Q2ZE69_ESOLU/294-377               .....................................................hgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..QQ..KD.....SEQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
S9X5J1_CAMFR/400-537                   ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NSFSYFPEITHI.........VI.K..........E..........S..V................VSVN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A665VPK8_ECHNA/313-385               ......................................................vclcel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A2K5F005_AOTNA/285-427               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGTPTHEVLVTGTGGIQWWPVQEEgs..................irgS..SRNLQ..ASLS.RK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPW.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A674EB72_SALTR/374-404               ..........................................................pq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A672ZI98_9TELE/297-376               ........................................................stvk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..ES.....SEEGL.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A672JDP8_SALFA/230-303               .....................................................keepgee---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.ETYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A4W6CM65_LATCA/264-368               ...................................avdpsashsksafslikvtgetgiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---T..S..G..SC..HP.....DSALW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
E1BCP6_BOVIN/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
I3N6E8_ICTTR/284-421                   ............................................................EIFETSMLLISSENE.MNW.LH...S.ND...SGNVLSYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITHI.........VI.K..........E..........S..M................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6Q2Y8A7_ESOLU/263-382               ..................................................gisalskrer---------------.--T.PL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................-..-----..---V.RN.KY.KI...S..-..-SKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A498NAB0_LABRO/247-384               .....................................................evfepts-------LVIHENEE.VI-.-T...D.SS...SAADVQYKILVSGTSGIHWCEVSKE.......................A..DSDPW..TNQE.RR.KS.KR...D..S..KKLR..K..A.vLH..DA.....GEDRW.TLFSDFNEITHL.........LI.K..........S..........T..V................VTIH.....KQDNKNM..........E.LK...........L....AAH.EEALSFASLVDGYFRLTVDAHH..................
A0A3N0XJD9_ANAGA/835-933               .....................................................wleqseq---------------.---.--...-.--...-------------------------.......................-..-----..--QR.IR.AV.QV...S..G..-EGG..I..Q..IQ..TT.....ESQEW.QTFCDFPQITDI.........SI.KrlcqeqmpleG..........R..V................VTLT.....RQDDQCM..........E.AE...........F....HNL.TEALSFVSLVDGYFRLTTDSTH..................
G1P9Z2_MYOLU/284-421                   ............................................................EIFETSMLLISSENE.MNW.LN...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A485NGP8_LYNPA/275-357               .............................................gdsgmhwspggheal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A672J853_SALFA/284-414               ...............................................fepvsfsvkqegd---------------.---.--...L.QN...VETSHDMQVLVAGTSGISWRSKPSV.......................M..PVISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A2K6ARQ3_MACNE/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHRK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A674MA01_TAKRU/293-452               ........................................................wvnt------CMVILGYCN.KTS.SQ...D.QK...TQTSRDMQVLVTGTTGISWRKKPDTvsetvcdqeshsklllyniynfqT..SVVSK..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A672JFN9_SALFA/257-390               ..........................................gdassshsnaahaqgisk---------------.---.--...-.DY...FGAPATHEIMVSGTKGIQWRKAPTQ.......................D..NPDLR..NDCL.NY.TK.KT...K..R..QPGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A6I8QGV3_XENTR/287-363               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A4W4ECE2_ELEEL/283-402               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ.......................-..-----..-RHR.GQ.QV.RQ...-..-..----..Q..E..MD..--.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDN--Y..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A6I8S133_XENTR/235-311               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KP.....KERES.LTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A3Q2DQ66_CYPVA/301-434               ...............................................gyygnynqgqvqi---------------.--K.GQ...N.QN...FEASQGMQVLITGTTGISWRQKPAP.......................V..PSTLK..DKSK.LK.KS.KQ...D..-..EKQK..N..G..RN..KE.....LNDGW.VLFCDFHEITHT.........II.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.EEALSFAALVDGYFRLIVDAHH..................
A0A4W5RTQ8_9TELE/284-419               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..K..-K..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A6I8N379_ORNAN/328-395               .......................................................gpgvg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....QEAPW.ERFCDFQEITHV.........VL.T..........G..........S..R................VTIH.....QRDNQSL..........E.LA...........L....PTP.AAALSLISLVDGYFRLTTDASH..................
A0A4W4EQ80_ELEEL/88-226                ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................N..VLNVK..DKSK.SR.KS.KV...D..S..KQKN..E..K..-K..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
F6WH53_MONDO/297-379                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..D..SE..TL.....TEQDL.QMYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nenrvVTIH.....KQDGKNL..........E.IE...........F....HSL.REALSFVSLIDGYYRLIADAHH..................
A0A5N5KL54_PANHP/283-418               ......................................................dgsgsy--------LNASRAH.--E.PP...E.EM...TCSQPTHEVMVSGTTGIQWRKIPAQ.......................R.aQENNY..MGND.YL.NK.RK...R..E..KHEV..T..Q..QE..NN.....TPESW.KVFCDFPEISHI.........AI.A..........G..........A..N................VCIS.....RQDNLAM..........D.LR...........L....KST.LEARSLVSLLDGYFRLTADAHH..................
A0A672ZIB2_9TELE/288-367               ........................................................stvk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..ES.....SEEGL.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A670K8H6_PODMU/259-340               ....................................................ggiqcsrg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KH.....KDSET.LTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
S9YWR6_CAMFR/290-374                   ............................................vaggsgiawspgeqev---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSQH..................
A0A3Q0FYA4_ALLSI/340-370               ..........................................................aq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.VE...........F....PSL.REALSFVSLLDGYYRLTADAHH..................
A0A315VU87_GAMAF/377-457               ......................................................wskgkg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.EIYCDFPEVIDI.........SI.K..........Qgske.gsaesR..I................VSLT.....RQDNQIL..........E.LE...........F....QLL.SEALSFVSLVDGYYRLVADAHH..................
L9L1A5_TUPCH/206-296                   .......................................................sfvtr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..RI.....RRTAF.QPFGDFPEILDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNHILvartdalpvqE.AE...........F....PGL.LQALSFVALVDGYFRLTTDSQH..................
A0A3Q1I9B4_ANATE/290-370               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W3J8R4_CALMI/278-416               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRPV--.......................-..-VNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A1U7STL7_CARSF/298-380               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nkegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A5E4AAK5_MARMO/286-430               ............................................................QAEGEPCYIQDSRRA.SVD.HS...L.EP...AVGSPTHEVLVTGTGGIQWRPVQVEgss................dindS..SRNSQ..THLS.GK.KA.KA...R..-..EAGG..Q..T..AD..RP.....REPPW.TYFCDFQDITHL.........VL.K..........G..........C..R................VTIY.....QQDNKCL..........E.LR...........L....PSR.AAALSFVALVDGYFRLTADSSH..................
A0A669F017_ORENI/267-406               .................................................egdlcngryyn-------------QS.LGH.AQ...S.QN...MEVSRDMQVLVTGTTGISWRKKPATvs...................knL..KVADK..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W4HF05_ELEEL/257-381               ..................................................ytecfqvkea---------------.---.--...-.--...--SAGQVTIIVSADQGIQWCRERQK.......................-..----E..AQPE.VR.QE.Y-...-..-..LLFP..A..D..VS..VL.....LAQDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A665UQW1_ECHNA/318-389               .......................................................kknlq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CR..NE.....PNEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
K7FRF6_PELSI/307-445                   ............................................................EIFETSSLQISTENE.KHG.FN...L.GD...NGIMPQYEVMVTGNNGIQWRRKPNV.......................I..QPERE..KHNK.LK.RK.KM...D..S..KNRK..G..E..EK..NK.....SREEW.NSFSYFPEITLL.........VI.K..........E..........S..T................ININ.....KQNHEKM..........E.IK...........L....SSH.EEALSFASLVDGYFRLTADAH-l.................
A0A4W5MRJ6_9TELE/230-355               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................-..-----..--VS.GH.WV.LF...Y..-..-VKK..D..V..WD..LN.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........-.--...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A4W4GEM0_ELEEL/286-366               ......................................................rsgvkm---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-A..HN.....LTQTW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A3Q7TQE3_VULVU/216-298               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A674DZJ8_SALTR/295-399               ................................................tlrkkiapgqrq---------------.---.--...-.--...---------------------NQV-.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A2K5EZD2_AOTNA/272-331               ............................................................EIFETSMLRISSENE.MNW.FY...S.ND...SGNVQYYEVMVTGNLGIQWRQKPNV.......................I..HLKKI..K---.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------snkcf.............
A0A6Q2YV58_ESOLU/272-375               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A670IZT7_PODMU/284-419               ...........................................................e-ILETASLLISSENE.KI-.FD...T.GY...SEIIPCYQVMVTGNNGIQWRLKPIV.......................-..TQSER..EKHK.TK.RK.RS...D..G..KAKK..N..E..EK..SK.....-KEEW.NSFCYFPEITHL.........VI.K..........E..........S..T................VCIY.....KQDNKRM..........E.FK...........L....SSC.EEALSFAALIDGYFRLTADAHH..................
A0A3P8WTB1_CYNSE/298-422               ...................................................sigyngyyn---------------.---.-Q...M.QS...QSQNQNMEVLVSGTVGISWREKPVL.......................-..-VSVK..EKSK.SK.KN.KS...D..G..KQQS..-..D..AK..KE.....AYEGW.VVFCDFHEIIHT.........AI.K..........E..........A..T................VSIY.....RQD-KKM..........E.MQ...........M....SSR.TEALSFLALVDGYFRLTVDAHH..................
A0A384C412_URSMA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5QDY5_9TELE/295-370               ........................................................sree---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....DKEAD.KTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W5QLH3_9TELE/231-309               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A5E4ALU8_MARMO/272-409               ............................................................EIFETSMLLISSENE.MNW.LH...S.ND...SGNVLSYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITHI.........VI.K..........E..........S..M................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3S2PRF2_ORYJA/275-363               ...............................................qvaantgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KL..KD.....SEEEL.QTLCDFPDVTDI.........SI.K..........Qaskd.gtsesR..T................VTLN.....KQDGKNL..........E.LE...........F....SSL.PEALSFVSLIDGYYRLTTDANH..................
A0A672UTK9_STRHB/277-410               ............................................................EIFETSFLLISSENE.INR.SN...C.GD...NEVLPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KT...D..G..KTRK..D..E..EK..HK.....IRDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
G3SSY6_LOXAF/281-418                   ............................................................EIFETSMLLISSENE.MNR.FH...S.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..LPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A091GBI7_9AVES/244-384               ............................................................EGEKTQLYVNGGHSQ.AEH.GH...A.LL..pKDPPVTHEVLITGTSGIQWRPVPVEv.....................gL..VLVLP..TSRK.SR.NK.EL...E..A..KGSA..Q..P..V-..ER.....NEPKW.VHFCDFREITHI.........VL.K..........D..........R..R................VCVH.....RQDNKCL..........E.VV...........L....PSS.ETALSLVALLDGYFRLTADSSH..................
A0A672ISU6_SALFA/267-372               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A669EKS1_ORENI/229-354               .................................................egdlcngryyn-------------QS.LGH.AQ...S.QN...MEVSRDMQVLVTGTTGISWRKKPSS.......................-..-VACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........-.--...........-....---.-VRLVCVSLVDGYFRLTVDAHH..................
A0A673XR93_SALTR/274-352               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A673UGX1_SURSU/181-324               ...........................................................q-AAGGPCYVCDGSPS.PPE.LG...P.EL...APGPCTHEVLVTGTGGIRWRPVQAEgpr................gddgS..SRNPR..AGPS.GK.KT.KA...P..-..DGGS..Q..P..VD..RP.....QEAPW.ACFCDFQDITHV.........VL.K..........E..........C..R................VSIH.....CQD-KCL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A2K5EZ81_AOTNA/284-421               ............................................................EIFETSMLRISSENE.MNW.FY...S.ND...SGNVQYYEVMVTGNLGIQWRQKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....VREEW.SSFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A340XM97_LIPVE/284-421               ............................................................EIFETSTLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2U3WH50_ODORO/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3Q1ANZ7_AMPOC/302-397               ...................................................gyfgkntpv---------------.---.--...-.--...-------------------------.......................-..--ISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..NK..EA.....-NEGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A6I8NMG4_ORNAN/284-421               ............................................................EVFEATLLQISSENE.KNR.SH...F.GD...HGEVLHFEVMVTGNQGIQWRQKCNV.......................-..VPVEK..EKSK.PK.RK.KL...E..S..KTKK..E..E..EK..IK.....LREEW.ISFSYFPEITHI.........VI.K..........E..........A..T................VSIN.....KQDNKRM..........E.LQ...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A1U7R5X2_MESAU/284-420               ............................................................EIFETSMLLISSENE.LSR.SH...S.-N...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..Y..KHKK..D..E..EK..NK.....LREDW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
G3RK14_GORGO/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A667XPA8_9TELE/315-359               ............................................friqlmymfvlclssq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A4W6EKQ7_LATCA/290-370               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A091L3K5_CATAU/175-308               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IRDSW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A672V266_STRHB/205-290               ...........................................vfevkepggdpsgeesf---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---DL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A3Q1IH21_ANATE/288-365               ....................................................tchpdgal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---DW.QTFCNFQEITDI.........NI.KrvchehvpqdS..........R..I................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
G5B225_HETGA/286-430                   ............................................................QADREPCYIRDSGQP.P-E.AD...P.MS...APGPPTHEVLVTGTRGIQWRPVQPEsss................angsD..SWNPK..ARLP.GK.KA.SA...H..E..EAGK..Q..P..VD..KP.....QEPSW.TYFCDFQDITHV.........VL.K..........E..........C..R................ISIH.....RQDNKCL..........E.LS...........L....SSP.AAALSFAALVDGYFRLTTDSSH..................
H0V6S7_CAVPO/284-422                   ............................................................EIFETSMLLISSENE.MSW.FH...S.SD..gGSAPLCYEVMVTGNLGIQWRQKPNV.......................-..VPAEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..SR.....IREEW.SNFSYFPEITHI.........VI.K..........E..........A..L................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q0GQF4_ALLSI/297-379               .......................................................srgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......sesriVTIH.....KQDSKNM..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
Q9TTJ0_PIG/299-381                     .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
F7BLR3_HORSE/272-409                   ............................................................EIFETSELLISSENE.MNR.FH...L.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KYKK..D..E..EK..NK.....IREEW.NNFSYFPEITHV.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672H5T4_SALFA/115-248               ............................................gdassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPTQ.......................D..NPDLR..NDCL.NY.TK.KT...K..R..QPGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A0P7V4D3_SCLFO/281-418               ...............................................enfgsevyepral-------------QI.CSE.SE...G.TL...QGDHSLYEVQVLGNKGIFWRKKPVS.......................S..PLITK..EKQK.SK.KN.KG...V..S..KLE-..K..E..KR..RN.....ASDDW.VLFSDFHEITHI.........VT.R..........E..........S..T................VTIC.....KQDNKNM..........E.LQ...........L....TCR.EKALALAALVDGYFRLTVDAHH..................
A0A3P8WKX7_CYNSE/303-381               .....................................................krieedg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GKEEL.QTYCDFPEVIDI.........SI.K..........Q..........S..Nkegs.......adsriVTLS.....KQDGKVL..........E.LE...........F....HSP.SEALSFVSLVDGYYRLVADAHH..................
A0A2R8ZP32_PANPA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A673Y892_SALTR/259-393               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQ.......................K..VCLSV..SLDV.YQ.AV.SClcvF..F..VQSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........-.--...........-....-VR.APALSFVSLLDGYFRLTADAHH..................
A0A2I0MG33_COLLI/295-379               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5MM92_9TELE/283-359               .....................................................slsrfls---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W5MQC8_9TELE/282-416               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KL...E..-..GKQT..K..P..KK..KD.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........-.--...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A2K6P3E5_RHIRO/240-322               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A673WTA2_SALTR/290-368               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W6EJS4_LATCA/295-375               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A452S2T0_URSAM/271-393               ..................................................fgtervpvyp---------------.---.-G...P.EL...APGPPTHEVLVTGMGGIQWRPVQRS.......................R..--LGW..GWGS.--.--.-C...L..A..LASD..G..G..CS..EP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A4W4EQ69_ELEEL/162-297               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................-..--VSE..DKSK.SR.KS.KV...D..S..KQKN..E..K..-K..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A5N5KDW2_PANHP/282-361               .........................................................cre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..QK..DA.....QLEDL.QTYCDFPHVIDI.........SI.R..........Qaske.gahksR..V................VSIS.....KQDGKTL..........E.LE...........F....SSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A4W6DA82_LATCA/302-434               ....................................................ggyhgyyn-------------QS.QGQ.SQ...S.QN...METSSDMQVLVTGTTGISWRKKPAA.......................T..SVISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A2R8ZF74_PANPA/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W3IYJ2_CALMI/281-423               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNE.......................P..VVNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A670KG06_PODMU/314-384               ........................................................qgth---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-LFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
I3KJT0_ORENI/284-364                   ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A094L2N6_PODCR/222-306               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......gerriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A674D745_SALTR/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A1S3KQI9_SALSA/326-404               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
E9PPF2_HUMAN/285-432                   ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A0Q3V9G8_AMAAE/296-378               ...................................................srgklkdce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sxegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
L5K6W6_PTEAL/291-428                   ............................................................EIFETSMLLISSENE.LNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KQKK..D..E..EK..NK.....IREEW.SNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q2D026_CYPVA/277-409               .........................................................dge---ESSSYSNVSQS-.-AD.VS...K.DS...FKAPLTHELMVSGIKGIQWRILKTQ.......................-..---KA..EDNS.YH.RS.GY...A..N..MKTP..K..Q..TP..SN.....PPDKW.TSFCDFREITHI.........AI.T..........E..........A..N................VFIS.....TQNNHCM..........E.VQ...........M....NSS.QEARSFISLVDGYYRLTADAHH..................
A0A665UQZ8_ECHNA/270-367               .................................pislsvtqegevcnggyhgkisekigi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--RT..N..D..KN..KE.....PNEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A341BFL7_NEOAA/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A3P9ANB0_ESOLU/282-413               ..................................................gdgsnsqahg---------------.--A.SD...S.DN...FVTPASYEVTVSGTNGIQWRKIVVQ.......................K..--AKE..NNYF.GN.DY.FG...N..R..KSVK..K..P..AEgvPK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSL..........E.IQ...........M....KSN.MEARSFVSLLDGYFRLTADAHH..................
G3H4C8_CRIGR/83-112                    .....................................................qeaefpg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....--L.PEALSFLALVDGYFRLTCDSRH..................
A0A4W6CM15_LATCA/263-363               ..................................psashsksafslikvtgetgiqtsgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..CH.....PDSEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A452DQ67_CAPHI/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W3JY01_CALMI/252-334               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A663FA97_AQUCH/295-379               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W4ENT3_ELEEL/128-254               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................-..--VSE..GVPL.L-.--.--...-..-..---K..N..E..KK..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A3Q3RYN4_9TELE/305-383               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..EG.....EEEEL.QTYCDFPEVIDI.........SI.K..........Q..........S..Nkegs.......vesriVTLT.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADTHH..................
A0A4W4ED95_ELEEL/283-420               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ......................rA..QENSY..LGND.YL.DN.RK...H..R..GQQV..R..Q..QE..MD.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
W5L4W4_ASTMX/257-358                   ...................................ftrwlqrsgtqsvtvvrvsgeggiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..TR..AE.....EGQDW.QTFCDFPQITDI.........SI.KrvgqeqlpaeG..........R..M................VTLT.....RQDDRCL..........E.VE...........F....QTL.AEALSFVSLIDGYFRLTTDSSH..................
A0A4U1FJH6_MONMO/332-407               ....................................................spgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A1A6HG24_NEOLE/226-306               ...................................................sgvawspgd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTIT.....RMDSHXL..........E.AE...........F....PAL.PEALSFVALVDGYFRLTCDSRH..................
A0A5F7ZBH2_MACMU/274-358               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A2K5ITF8_COLAP/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A6Q2Z3C9_ESOLU/263-366               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A671V4P1_SPAAU/257-396               ................................................rkdgvvsssysd------------TNH.AQG.VS...K.AS...YIAPATHEIMVSGTKGIQWRDAPGP.......................K.aQANSY..LRND.PL.NY.IR...R..P..KQQS..S..Q..PN..EN.....TPSTW.TSFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFVSLLDGYYRLTADAHH..................
A0A3L8R0H9_CHLGU/329-404               ......................................................cggses---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADI.........SI.K..........Q..........A..Asrdgg.....pvenrlVTVT.....KADNRVL..........E.VE...........F....ATL.REAHSFVALLDGYYRLTADAQH..................
A0A672JTN1_SALFA/198-330               .................................................vpvvgsetfrv---------------.---.NN...S.SS...QSKPPFSLVRVTGETGIQTSGSDQP.......................-..----D..EDLV.RT.I-.--...-..M..RVMI..F..P..KT..DN.....ETLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A4U1FH19_MONMO/350-487               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...D..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6Q2WUD5_ESOLU/243-392               ............................................epevlrvmdsegeieg---------------.--T.PL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQNvrvwnl..........sfdgdsyT..CYYFR..NKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A2K5F071_AOTNA/285-427               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGTPTHEVLVTGTGGIQWWPVQEEgs..................irgS..SRNLQ..ASLS.RK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPW.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
B7ZU18_XENTR/283-359                   ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A665UQH3_ECHNA/282-411               .................................................lepislsvtqe---------------.---.GE...I.QN...IEKSRDVQVLVTGTTGISWRKKPSV.......................-..SLVSK..EKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
L8YCU2_TUPCH/278-350                   .....................................................aevsggs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-D..SG.....REAPW.TYFCDFQDISHV.........VL.K..........E..........R..D................VTIH.....RQDNKCL..........E.LS...........L....PSR.GAALSFVSLVDGYFRLTADSSH..................
A0A3Q0GJJ7_ALLSI/407-547               ........................................................eddr----TPLYVNGEPPM.PVD.AP...-.PH...GDCLPTHEVLVTGADGIRWRPVPVE.......................V.tESPPH..RGYF.GR.KG.RS...K..E..PGSR..E..P..PTlaEH.....NKPKW.VQFCDFQEITHV.........VL.T..........G..........A..C................VGIH.....RQDNQCL..........E.LV...........L....PSP.EVALSLVSLVDGYFRLTADASH..................
A0A6Q2WZL3_ESOLU/247-380               ..................................................gdgsnsqahg---------------.--A.SD...S.DN...FVTPASYEVTVSGTNGIQWRKIVVQ.......................K.eNNYFG..NDYF.GN.RK.SV...K..-..-KPA..E..G..V-..PK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSLvr......mpE.IQ...........M....KSN.MEARSFVSLLDGYFRLTADAHH..................
A0A672IF37_SALFA/245-382               ............................klkylismeslekafytetfpvkepssgqvil---------------.---.--...-.--...---------HVAADTGIQWCRKKMK.......................-..----D..SDQL.SL.RV.FS...H..-..----..L..P..TL..AR.....PNREL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A669CSF9_ORENI/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A340XLT5_LIPVE/272-357               ..........................................hvaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprigpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A4D9F7U6_9SAUR/257-308               ........................................................segr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-----------I.........VT.S..........E..........S..R...............iVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVSLIDGYYRLTADAHH..................
A0A6I8QQ90_XENTR/291-439               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEEvgvvtq...........pswgesN..ESDQL..GRKP.KS.RV.KG...Q..K..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A2I0TMR2_LIMLA/390-523               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NENPQLYEVLVTGNNGIQWRLKPKS.......................-..----V..QREK.EK.KK.KS...D..S..KTKK..D..E..EK..HR.....IRDSW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A087VRZ8_BALRE/284-417               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NEIFPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.DK.KK.KS...D..G..KTKK..D..E..EK..HK.....IRDTW.NNFSYFPEITHI.........VI.R..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLVDGYFRLTADAHH..................
A0A671VL57_SPAAU/290-368               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A673WNR7_SALTR/295-378               .................................................crdghkdseqv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-L.....TAQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A4W3JVI8_CALMI/266-308               ......................................................sstegr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..I................VTIN.....RQH----..........S.ME...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
H2V1W5_TAKRU/292-370                   .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QSFCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNV..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A452S216_URSAM/267-394               ......................................................qvimvk-------YLATLEQL.APH.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAE.......................-..-----..----.VS.RV.AL...A..S..KVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A672ZG17_9TELE/307-386               ........................................................stvk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..ES.....SEEGL.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A669CFP9_ORENI/325-370               ........................................................saes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A3Q7VNC1_URSAR/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKHK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2F0AYP7_ESCRO/1-29                  .....................................................eaefpgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.PAALSFVALVDGYFRLTTDSGH..................
A0A2K6NJZ6_RHIRO/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A4W5RQ31_9TELE/284-419               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..K..-K..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
M3Y5N7_MUSPF/286-429                   ...........................................................q-AVGEPYYLRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEdpr.................gdgS..SRNPC..AGPS.GK.GT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSVH.....SQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A3Q4G7N9_NEOBR/273-355               ..............................................vrvtgetgiqtvls---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-RVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........-.--...........F....QSL.KKALSFVSLVDGYFRLTTDSSH..................
A0A1S2ZMB9_ERIEU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A671XT81_SPAAU/308-387               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..DE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A4W5RTU3_9TELE/228-367               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPNvs...................gkN..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..-..KK..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A671UPP1_SPAAU/198-269               .......................................................pdgal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-TFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W5MK90_9TELE/219-297               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A671XSJ1_SPAAU/301-376               ........................................................kgkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EEGEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A2K6LW13_RHIBE/281-357               ......................................................wtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
M3XNR7_MUSPF/284-421                   ............................................................EIFETSMLLISSENE.LNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLIDGYFRLTADAHH..................
A0A6I8SGI2_XENTR/287-427               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEEe.....................dT..ETSTQ..RHYF.SK.KS.RV...KgqK..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A5F9ZHN8_HUMAN/240-377               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A218UJX7_9PASE/283-413               ............................................................EIFEPSFLLISAENE.LNK.FS...C.GD...N---ERYEVMVSGNNGIQWRLKPSP.......................-..----V..PTEK.EK.RK.KS...D..G..RSRK..V..E..EK..HR.....VREAW.NSFSYFPEITHV.........VI.R..........D..........C..T................VSIN.....KQDNRRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
A0A4W5MQS6_9TELE/281-418               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KL...E..-..GKQT..K..P..KK..KD.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A2K6N0R1_RHIBE/226-308               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A5F8GX05_MONDO/261-304               ..........................................................pn---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........C..L................IHVG.....NGDGREA..........E.VE...........F....PTL.REALSFVSLVDGYYRLTTDAHH..................
JAK2_PONAB/299-381                     .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W3JVJ3_CALMI/222-292               .......................................................aqdlq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A667Y0C7_9TELE/282-396               ..........................................gsssylstthaigdagds---------------.---.--...-.--...FGAPVTHEIMVSGTKGIQWRKVSGQ.......................-..-----..----.--.KV.--...S..-..KQQP..S..Q..SN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........V.RA...........L....---.-EARSFISLLDGYFRLTADAHH..................
A0A673YFF4_SALTR/294-368               .......................................................padvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A093PY01_9PASS/295-379               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A672JDT2_SALFA/241-321               ......................................................wstgke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..PG.....EEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A0A0MUA2_PAPAN/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A2U3Y110_LEPWE/119-201               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A341BFK7_NEOAA/303-449               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A6I8SJW1_XENTR/190-266               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A4W4FCL1_ELEEL/276-414               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPNLp.....................nP..WSNLQ..KRKS.SR.GR.RP...Q..N..QQNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A671XVR3_SPAAU/201-340               ..............................................slyserfqvtdlsa---------------.---.--...-.--...----REVTIVVMGNKGIQWSKGKDE.......................E..GAEEV..RSRR.WE.CM.CV...H..A..SSSN..T..N..VK..DGfvlffGLQEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A341AKB6_NEOAA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
A0A6A5ENF9_PERFL/352-433               .........................................................qws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---K..G..K..EE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......vdsriVTLT.....RQDNQIL..........E.LE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A673WG24_SALTR/290-368               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A673A497_9TELE/262-363               ....................................npssseskssftllrvtgedgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..GS..SD.....PDDEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
H0X6H8_OTOGA/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........I....GSL.REALSFVSLIDGYYRLTVDAHH..................
A0A4W5MIY8_9TELE/229-307               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A452DZ12_CAPHI/273-357               ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFLALVDGYFRLTTDSRH..................
A0A2K5WBJ6_MACFA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A1S3KQJ9_SALSA/177-255               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A341D8D9_NEOAA/284-357               ......................................................gehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A6A5FHI0_PERFL/292-370               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.Krasr.egateS..........R..V................VTIN.....KQDGKNL..........E.LE...........F....SSL.SEALSFASLIDGYFRLTSDAHH..................
A0A3P9NV34_POERE/363-442               .......................................................skgkg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.ELYCDFPEVIDI.........SI.K..........Qgske.gsaesR..I................VSLT.....RQDNQIL..........E.LE...........F....QLL.SEALSFVSLVDGYYRLVADAHH..................
A0A4W4HE37_ELEEL/210-290               ..................................................sadqgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-ERQK.ETYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
L8YCU2_TUPCH/232-286                   ............................................................QAQDEPCYIRDNGQA.PAD.PC...P.EA...AAGPPTHEVLVTGTGGIQWRLRRAE.......................V..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------sggsds............
A0A2Y9DZP7_TRIMA/283-359               ......................................................wsprdh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ETL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSRH..................
A0A4W3H2H1_CALMI/269-344               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A673YH93_SALTR/238-367               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................-..----V..SGKV.GR.FK.EL...G..-..-KQK..K..D..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A0Q3U4V2_AMAAE/294-427               ............................................................EIFETSFLLISSEXE.INR.SN...C.GD...NEMLPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KT...D..G..KTRK..D..E..EK..LK.....LRDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A6Q2ZI16_ESOLU/273-376               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A6I8QIM9_XENTR/283-419               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................-..-TEKI..SIWK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
H0VRI8_CAVPO/202-284                   ........................................................srgr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---H..K..E..NE..TL.....TEQDL.QLYCDFPDIIDV.........SV.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
H3A1R3_LATCH/1-19                      ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.---MSFVSLIDGYFRLTVDGHH..................
A0A452QRG6_URSAM/302-378               ......................................................rgkhke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....ETLTE.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKN-..........-.LV...........S....FSL.REALSFVSLIDGYYRLTADAHH..................
A0A484CLG6_PERFV/307-386               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..EE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......vdsriVTLT.....TRDNQIL..........E.LE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A665WVI0_ECHNA/227-326               ...................................tfqvkdscngqviilvaadcgiqwc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..EK.....IKDSD.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W5QL77_9TELE/245-380               ................................klkylinmesleqafyterfqvressag---------------.---.--...-.--...-----QVTIIVTADYGIQWCRDGHK.......................-..-----..---D.SE.QI.ES...N..D..VLFS..H..-..--..LF.....PEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A673A3Z1_9TELE/283-365               ..................................................iqtngssdpd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....DVMEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A4W5QR99_9TELE/264-390               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQ.......................K..VWNR-..--KS.VK.Q-.--...-..-..--SP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
F6TJR2_ORNAN/297-379                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Nqeds.......tesrvVTIH.....KQDSKNL..........E.IE...........F....LSL.KEALSFVSLIDGYYRLTADAHH..................
A0A096MF50_POEFO/310-384               .......................................................wvqyl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFHEIVDI.........SI.KrilnemvpqdS..........R..M................VTIT.....RKDDRCL..........E.AS...........F....QSR.KEALSFMSLIDGYFRLITDSSH..................
A0A667XE92_9TELE/283-361               ........................................................crdr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-H..KD.....SEQEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A444UMW8_ACIRT/266-404               ............................................................EIYETSMLQICAENE.KSL.SK...H.FG...GADLPLYEVQVAGNVGIQWRLKPPN.......................T..VTFAK..EKNK.SR.KN.KM...E..S..RNKK..D..K..NK..DL.....VNEGW.TLFSDFYEITHI.........VI.K..........E..........A..T................VTIY.....KQDNKKM..........E.LE...........L....AFR.DEALSFVALVDGYFRLTVDAHH..................
A0A2K6T879_SAIBB/284-421               ............................................................EIFETSMLRISSENE.MNW.FY...S.ND...SGNVQYYEVMVTGNLGIQWRQKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....VREEW.SSFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671VZS2_SPAAU/285-415               ..................................................dpillsvqeg---------------.--E.SQ...S.QN...METSHDMQVRVTGTTGISWRKKPPT.......................A..NVICK..EKGK.SK.KN.KQ...D..G..KQKN..D..K..NK..-E.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
H2L7P4_ORYLA/295-373                   .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....ADEEL.QTLCDFPDITDI.........GI.K..........Qaskd.gtsesR..T................VTLN.....KQDGKNL..........E.LE...........F....SSL.PEALSFVSLVDGYYRLTTDAYH..................
A0A226PRN9_COLVI/392-525               ............................................................EIFETSSLLISSESE.INR.FN...C.GD...GEIIPLYEVIVTGNNGIQWRLKPTS.......................-..----V..QTEK.EK.KK.KS...D..G..KIKK..D..E..ER..YK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A5C6NGK3_9TELE/220-348               ................................................yserfqvadlsa---------------.---.--...-.--...----QEVTIVVTGNGGIQWSKGSAE.......................E..VEVRS..RATV.SR.GG.SC...G..-..---V..F..T..RC..PL.....LLQEL.QTYCDFPEVIDI.........SV.K..........Qasae.gsvesR..V................VTIT.....KQDNETL..........E.LE...........F....SAL.SQALSFVSLVDGYYRLVADAHH..................
A0A383Z2F5_BALAS/286-413               ............................................................QAEGEPCYIRVGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIRWRLVQAEgpsag.............gggggG..GRMPH..AGAS.GK.KA.KA...Q..-..EVGS..Q..P..VD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDYKCL..........T.VH...........-....---.----------------------cvgpav............
A0A485ND59_LYNPA/277-357               ...............................................sgmhwspggheal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A3P9Q7T0_POERE/301-434               .....................................................gyygyyn----------QSQ-L.QTK.CQ...N.QN...LEASSDMQVLVTGTTGISWRQKPAA.......................V..PVMPK..DKSK.SK.KS.KQ...D..-..EKQK..N..N..RN..KE.....TEDGW.VVFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A4W6C0R2_LATCA/269-391               ..................................................tetfsvshle---------------.--H.RE...D.GD...GGTPTTHEIMVSGTKGIQWRKVSGQ.......................-..----K..VCHY.MR.KT.KH...Q..-..---S..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A672IEU1_SALFA/281-363               .....................................................giqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A099ZDF1_TINGU/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A553QH32_9TELE/267-383               ...................................................ssgsylits---------------.---.QT...Q.SE...EAINATHEVRVSGCSGISWRKFSAQ.......................-..-RVND..Y---.--.--.--...-..-..IPSQ..N..R..ET..ES.....VDDGW.NSFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IC...........L....GSS.MQARSLVSLIDGYFRLTTDAHH..................
A0A5C6MXB5_9TELE/257-380               ..........................liyltelagiqpslgsetfhvdpssphsssrsav---------------.---.--...-.--...-------------------------.......................-..-----..----.-S.LV.RV...T..G..EFGI..Q..T..SE..SC.....DGPVW.QTFCDFKEITDI.........SI.RricrdqvphdS..........R..M................VTMT.....RKDDACL..........D.VE...........F....QSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A2R8MWV0_CALJA/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvskee.............gsirgS..GSNLQ..ASLS.GK.KA.KA...H..-..KAIA..Q..P..AD..KP.....REPPR.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A665VJZ6_ECHNA/284-366               ....................................................iqtrgsch---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TE.....SSLEW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4X2LVA4_VOMUR/268-415               ............................................................EAERDLCYVNSSEQG.PTV.PP...G.ATlslADQAPTHEVLVMGTSGIHWRLLQVEdpd.................ldlN..HPRSS..FGKK.SK.AR.EA...E..S..RKLS..Q..L..PT..ER.....KESPW.IYFCDFQDITHV.........VV.K..........E..........N..N................VSIH.....RQDNKCL..........E.LT...........L....PSP.MVALSLVSLVDGYFRLTADSSH..................
A0A1S3QZA5_SALSA/275-415               ....................................................eyepkvlr--------VTDSEGE.IQG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQNv.....................sN..AWTAK..EKNK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A4W6CM67_LATCA/255-365               .......................gsetfavdpsashsksafslikvtgetgiqtsgschp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....SALEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A553R0X8_9TELE/252-331               ..........................................................cr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..R..QK..DT.....QSEDL.QTYCDFGEVVDI.........SI.R..........Q..........A..Sqegt.......nlnriVSIN.....RQDGKSL..........E.LV...........F....STS.MEALSFVSLIDGYYRLTTDAHH..................
A0A5N3X2V0_MUNRE/223-305               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W6DA55_LATCA/280-397               ..............................................pvslsvtqegeian---------------.---.--...-.--...----GGYHVLVTGTTGISWRKKPAA.......................-..-----..VSEA.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........M.L-...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A5A9P0E1_9TELE/81-193                ..........................................veptygsecfsmhqsgwl---------------.---.--...-.--...-------------------------.......................-..--AQS..EQES.VK.SI.RV...S..G..EGGI..Q..I..Q-..TT.....EHQDW.QTFCDFPQITDI.........SI.K..........Hvcqe..hmegR..V................VTLT.....CQDDRCL..........E.AE...........F....HTL.TEALSFVSLVDGYFRLTTDSTH..................
A0A4W6CLW5_LATCA/285-365               ...................................................tsgschpds---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-ALEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A671XSI6_SPAAU/308-387               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..DE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A452QRF7_URSAM/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
I3IZB2_ORENI/280-414                   ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................R..AQANN..YMRN.GYlNY.MR...K..Q..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A668AEH8_9TELE/304-430               ....................................................gyhgyyns---------------.-SQ.GQ...S.QK...QEMSHDSQVLVTGTTGISWRKKPAT.......................-..--VIF..KKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A3Q3VYG3_MOLML/251-374               ....................................................islgqgqs---------------.---.--...-.QN...METSHDTQVLVTGTTGISWRKKPVT.......................-..VSETV..KKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A218U785_9PASE/37-172                ...................................................gaagsraep---------------.---.--...A.AP...RDRPVTHHVLVTGTGGIQWRPVPAEaagr...............fwnsP..LCSPQ..STES.LS.QR.GY...F..G..RKSG..N..E..EP..EP.....SEPPW.RRFCDFREITHV.........VV.K..........E..........A..R................ISIH.....RQDNESL..........E.VQ...........L....PGP.GSALALVSLVDGYFRLTADSSH..................
A0A6Q2ZI51_ESOLU/241-345               ..........................lnqpgsqlpqkeatasllrvsgesgiqisgclrp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EEV.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A672JFB2_SALFA/245-361               ..........................................gdassshsnaahaqgisk---------------.---.--...-.DY...FGAPATHEIMVSGTKGIQWRKAPVQ.......................-..-----..----.-K.KT.KR...Q..-..-PGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........V.RA...........L....---.-EARSFISLLDGYYRLTADAHH..................
A0A5J5DA65_9PERO/290-365               ......................................................lpdgsl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFKEIIDI.........ST.KrvchehvpqdS..........R..M................VTIT.....RKDDRCL..........E.AN...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A669BEQ1_ORENI/332-411               ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..DR.....AEEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A673YG77_SALTR/288-420               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................-..--VSG..KKTK.SK.KN.KH...E..G..KQKK..-..D..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A5E4AMF8_MARMO/272-409               ............................................................EIFETSMLLISSENE.MNW.LH...S.ND...SGNVLSYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITHI.........VI.K..........E..........S..M................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672JE28_SALFA/245-325               ......................................................wstgke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..PG.....EEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A674NBS3_TAKRU/296-429               ..................................................fnggyygycn---------------.KTS.SQ...D.QK...TQTSRDMQVLVTGTTGISWRKKPDT.......................T..SVVSK..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A672JTM0_SALFA/215-296               .....................................................qtsgsdq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..PD.....EDLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A091CVI5_FUKDA/735-764               .......................................................qeaef---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....PAL.PAALSFVALVDGYFRLTCDPRH..................
A0A2Y9LU92_DELLE/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...ATGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A671VHJ0_SPAAU/293-371               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A3Q7RA95_VULVU/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A5E4AA88_MARMO/286-430               ............................................................QAEGEPCYIQDSRRA.SVD.HS...L.EP...AVGSPTHEVLVTGTGGIQWRPVQVEgss................dindS..SRNSQ..THLS.GK.KA.KA...R..-..EAGG..Q..T..AD..RP.....REPPW.TYFCDFQDITHL.........VL.K..........G..........C..R................VTIY.....QQDNKCL..........E.LR...........L....PSR.AAALSFVALVDGYFRLTADSSH..................
A0A2Y9HKV9_NEOSC/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qasqe.gsnesR..V................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTTDAHH..................
A0A2Y9LBA5_ENHLU/299-442               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEgpr.................gdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A5F4D515_CANLF/202-314               .....................................grggvllhpgqragpsrsprgds---------------.---.--...-.--...-------------------------.......................S..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
G3U018_LOXAF/288-425                   ............................................................EIFETSMLLISSENE.MNR.FH...S.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..LPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5Q799_CEBCA/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvskee.............gsirgS..GRNLQ..ASLS.GK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPR.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A669C8K4_ORENI/268-397               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSAN.......................N..YMRNG..YLNY.MR.KQ.KQ...H..-..---S..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A3Q1FC04_9TELE/292-370               .......................................................yrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qvske.gaaesR..V................VTIN.....KQDGKNW..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A673A714_9TELE/168-272               .................................fkvnpssseskssftllrvtgedgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..GS..SD.....PDDEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A0A0MTV7_PAPAN/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
W5MIP2_LEPOC/280-415                   ............................................................EIFETSMLQICVENE.SCL.PY...-.--...NKEQPLYEIQVSGKMGIMLREKPIN.......................I..VFTQK..EKNK.SR.KI.RT...E..S..KKKN..E..R..KK..DN.....LSDGW.KLFSEFNNITHI.........VL.R..........D..........S..T................VTIY.....TQDNKRM..........E.LQ...........L....AFH.DEALSFTALIDGYFRLTVDAHH..................
A0A2K5VPQ0_MACFA/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A665WVV2_ECHNA/262-361               ...................................tfqvkdscngqviilvaadcgiqwc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..EK.....IKDSD.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A1U7QD80_MESAU/299-381               .......................................................srgrh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..E..SE..TL.....TEQGL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......nesrlVTIH.....KQDGKIL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
S7PNQ5_MYOBR/380-464                   ...............................................vaggsgiawspgt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EEVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PASLSFVALVDGYFRLTTDSQH..................
E9PM19_HUMAN/100-247                   ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A673WGR6_SALTR/247-325               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A673WSY6_SALTR/296-374               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A2K6U8W2_SAIBB/316-400               ............................................vtgdrglawspgvqed---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A452RVG9_URSAM/283-357               .....................................................pggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A3Q1BRP3_AMPOC/283-363               .....................................................qwyrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Qvske.gaaesR..M................VTIN.....KQDGKNR..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A402FYP1_9SAUR/341-389               ............................................................EGEKVPLYINGGHTS.LEN.SH...D.SQ..dSYRPPTHEVKITGTDGIQWRPISA-.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------e.................
A0A671VZX6_SPAAU/286-403               .....................................................lsvqege---------------.---.--...-.-N...METSHDMQVRVTGTTGISWRKKPPT.......................-..----V..KKGK.SK.KN.KQ...D..G..KQKN..D..K..-N..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
H2VE39_TAKRU/281-414                   ..................................................fnggyygycn---------------.KTS.SQ...D.QK...TQTSRDMQVLVTGTTGISWRKKPDT.......................T..SVVSK..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A091I5H9_CALAN/298-380               ...................................................srgklkdce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......ierriVTIH.....KQDSKNL..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A3P9Q8Q5_POERE/301-434               .....................................................gyygyyn----------QSQ-L.QTK.CQ...N.QN...LEASSDMQVLVTGTTGISWRQKPAA.......................V..PVMPK..DKSK.SK.KS.KQ...D..-..EKQK..N..N..RN..KE.....TEDGW.VVFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A226MBR6_CALSU/444-580               ........................................kgrpysdgghvpaqrgdapl---------------.---.--...-.-A...EDGPVSHEVLVTGTTGIQWRLVPNE.......................S.vEVISH..RGYF.GR.RS.RR...K..-..EPEP..R..A..PP..QP.....TEPPW.VHFCDFREITHI.........VI.R..........D..........R..R................VSVH.....RQDNKCL..........E.VL...........L....PSH.ESALSFVSLLDGYFRLTADSNH..................
G1RYT5_NOMLE/283-418                   ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..----S..EGKK.TE.AE.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.R..........Sl........wS..A................LTSR.....QQENGKF..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A673BZR6_9TELE/280-311               ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....----KVT..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A6Q2YVQ3_ESOLU/166-239               .....................................................skgnsgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A662YQC4_ACIRT/1882-1959             .......................................................llgre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....PQQDW.QTFCDFPEIIDI.........SI.K..........Q..........T..Srdkvp......lgsrvVTVS.....RQDSRLL..........E.AE...........F....HTL.REALSFVSLIDGYFRLTTDSAH..................
A0A672UXK2_STRHB/286-421               ............................................cegekvqlngthpehp---------------.---.--...L.LP...KERPVTHEVLITGTSGIQWRAVPVE.......................N.tETFSH..RGYF.GR.KT.RN...K..E..LEAK..G..P..AP..ER.....SDPKW.AHFCDFQEVTHI.........VV.R..........E..........C..R................VSIH.....RQDNKCL..........D.VV...........L....PCP.GNALSLVSLVDGYFRLTADSSH..................
A0A672JDA0_SALFA/243-323               ......................................................wstgke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..PG.....EEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A669CD94_ORENI/345-389               .........................................................aes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A2K6P929_RHIRO/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..VD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A4W5Q4V4_9TELE/340-475               ......................................................sdgsgs-------YLNTSHAR.G-A.SD...P.EN...FGPQVMHEVMVSGTKGIQWRKITVQ.......................K.aKSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A673XY37_SALTR/276-352               ....................................................sreedkeg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---LE.LTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
H2TE41_TAKRU/271-384                   ...............................................retweesgslpnk---------------.-TH.P-...Q.CD...CRAPATHEIMVNGNKGISWRISTQK.......................-..-----..----.--.--.-A...Q..-..----..-..S..PQ..PD.....TPNDW.TAFCDFPEIAHI.........AI.T..........E..........T..N................VCIS.....TQDNHCM..........E.VQ...........M....SST.QEAHSFISLLDGYYRLTADAH-n.................
A0A1U7R3C7_MESAU/290-433               ..........................................................qp--ERDPCYIQNSGQT.TGD.PD...P.EL...TTRLPTHEVLVTGTGGIQWHPLQIQese.................rgsS..RGNLQ..GNRS.GK.KA.KT...P..-..EAGE..Q..L..TK..SP.....GDPPW.TYFCDFQDISHV.........VL.E..........E..........C..R................VRIH.....LQDNKCL..........L.LC...........L....CSR.AEALSFVALVDGYFRLTADSSH..................
A0A3Q1K6Q1_ANATE/306-385               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..QE..EG.....AEEDV.QTFCDFPEVIDI.........SI.K..........Q..........G..Hkegs.......vesriVTLT.....RQDNQIL..........E.LE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A091R6W6_MERNU/284-417               ............................................................EIFETSDLLISSENE.INR.FN...C.GD...SESLPLYEVIVTGNNGIQWRLKPN-.......................-..---SL..QTEK.EK.KK.KS...D..G..KTKK..D..E..EK..HK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A2K6NK05_RHIRO/218-302               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A3Q2HL76_HORSE/284-421               ............................................................EIFETSELLISSENE.MNR.FH...L.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KYKK..D..E..EK..NK.....IREEW.NNFSYFPEITHV.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W6DA50_LATCA/274-396               ..............................................pvslsvtqegeian---------------.---.--...-.--...----GGYHVLVTGTTGISWRKKPTS.......................-..-VISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A0P7WH47_SCLFO/290-370               .......................................................trdsq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..TA..SG.....SEKEL.QTYCDFPDIIDL.........II.K..........Qpnke.gvsssH..T................VTIN.....RQDSQTL..........E.LE...........F....PSA.AEVLSFVSLIDGYYRLTCDAHH..................
M3ZLD9_XIPMA/293-373                   .....................................................qwcrekf---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFHDVTDI.........SI.K..........Qacke.gatesR..L................VTIN.....KQDGKNL..........E.LE...........F....PSL.FEAMSFASLVDGYYRLTTDAHH..................
H2QWZ4_PANTR/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
G3PKI3_GASAC/290-370                   .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....LSL.PEALSFVSLIDGYYRLTTDAHH..................
A0A674PFU5_TAKRU/277-402               ................................................gsevfepislik---------------.---.--...-.--...TQTSRDMQVLVTGTTGISWRKKPDT.......................-..-VSET..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A2K6N0V3_RHIBE/256-338               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A0R4ICU5_DANRE/283-365               ........................................................qwch---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---E..R..H..KD..TQ.....SEDLL.QTYCDFAEVVDI.........SI.R..........Q..........A..Skdgt.......nmnriVSIN.....RQDGTPL..........E.LV...........F....STS.MQALSFVSLIDGYYRLTTDAHH..................
A0A4W6CM50_LATCA/255-334               ...................................................gsetfavdp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--SEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A1S3ADN5_ERIEU/278-352               .......................................................pgdpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---AF.QPFCDFPEVVDI.........TV.K..........QapcsgpiqerR..L................VTVT.....RTDGQIL..........E.AE...........F....PGL.PEALSFLALVDGYFRLTTDSRH..................
A0A663FKI4_AQUCH/284-417               ............................................................EIFETSFLLISSENE.INI.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..QK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A663DQT3_AQUCH/287-429               ............................................................EGEKVQLYVNGGHSQ.LEH.GQ...A.LL..pKDRPVTHEVLVTGTTGIQWRPMPVE.......................S.iENFSH..RGYF.GR.KS.RN...K..E..LEPK..G..P..TQpaER.....SEPKW.VHFCDFREITHI.........VV.K..........D..........C..R................VSIN.....RQDNKCL..........E.VV...........L....PSP.ESALSLVSLVDGYFRLTADSSH..................
F1LR79_RAT/277-354                     .........................................................aws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SK.....DQELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTIT.....RMDGHIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLICDSRH..................
A0A4W5QJI0_9TELE/276-354               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3Q2TXU4_CHICK/297-379               ....................................................srgklknc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A2J7R3I0_9NEOP/221-304               ...........................................etvllkvnpfheeqpgv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..S..VR..YD.....GKKEW.HQLCTIDDLCYI.........SV.R.........nD..........G..T................VEIS.....RKNGIPS..........Y.LK...........F....HSI.PLMFSFVSLLDGYYRLMV----kw................
A0A5F4BRD0_CANLF/574-656               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K6N0Q5_RHIBE/336-418               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5MM75_9TELE/281-418               .................................................emlepralvvt-----------QEVE.TNG.GL...S.HG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KL...E..-..GKQT..K..P..KK..KD.....ASDSW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A6I8QZ07_XENTR/294-432               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEEv.....................gV..VAPPL..KNIP.KS.RV.KG...Q..K..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A672ZK88_9TELE/262-332               ........................................................stgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A668A5H5_9TELE/273-400               ...........................................ltvsqegdlsnggyhgr---------------.---.--...-.--...----HPEEVLVTGTTGISWRKKPAT.......................N..VMMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A4X2M7E6_VOMUR/239-386               ............................................................EAERDLCYVNSSEQG.PTV.PP...G.ATlslADQAPTHEVLVMGTSGIHWRLLQVEdpd.................ldlN..HPRSS..FGKK.SK.AR.EA...E..S..RKLS..Q..L..PT..ER.....KESPW.IYFCDFQDITHV.........VV.K..........E..........N..N................VSIH.....RQDNKCL..........E.LT...........L....PSP.MVALSLVSLVDGYFRLTADSSH..................
A0A5F4C7C6_CANLF/272-420               ..........................................................ra--VGESCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEvsrvhl..........gsprgdsS..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A452S2E2_URSAM/267-394               ......................................................qvimvk-------YLATLEQL.APH.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAE.......................-..-----..----.VS.RV.AL...A..S..KVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
JAK1_DANRE/282-417                     ....................................eifkpknlkvtgesegspaqmlpl---------------.---.--...-.--...GDNGMGYEVQVYGTTGISWRRKPAP.......................N..QLILK..DKPK.SK.KI.KG...D..-..---K..Q..W..ND..KK.....KDSGW.TLFSDFHEITHI.........VI.K..........D..........C..C................VTIY.....RQDNKTM..........E.LD...........L....FYR.DAALSFAALVDGYFRLTVDAHH..................
A0A671XSS2_SPAAU/200-276               ......................................................mcvhel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFPEVIDI.........SI.Kqa......nkE..........G..T................LSIHilvfnVADGIIL..........H.LY...........IlyifHLL.SEALSFVSLVDGYYRLVADAHH..................
A0A4W4EFR3_ELEEL/281-416               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ......................rA..QENSY..LGND.YL.DN.RK...H..R..GQQV..R..Q..QE..MD.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........-.-V...........R....MSS.LDARSLVSLLDGYFRLTADAHH..................
A0A4X2L5P7_VOMUR/285-357               .......................................................gsesp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIADI.........GM.K..........QacreghlsenR..L................VTVT.....KTDNRIL..........E.VE...........F....PTL.REALSFISLVDGYYRLTTDAHH..................
S7MJU2_MYOBR/227-309                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....ISL.KEALSFVSLIDGYYRLTADAHH..................
K7GSE8_PIG/273-356                     ...............................................vaggsgiswspge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSQH..................
A0A2K5F086_AOTNA/285-427               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGTPTHEVLVTGTGGIQWWPVQEEvs..................qvgS..SRNLQ..ASLS.RK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPW.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A3Q7V4V1_URSAR/283-357               .....................................................pggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A4W6CM31_LATCA/279-359               ...................................................tsgschpds---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-ALEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A2K6FGU0_PROCO/284-421               ............................................................EIFETSMLMISSENE.MNW.FN...S.ND...SGNVVYYEVMVTGNLGIQWRQKPNV.......................-..VPFEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VNVN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A5E4A9W2_MARMO/286-430               ............................................................QAEGEPCYIQDSRRA.SVD.HS...L.EP...AVGSPTHEVLVTGTGGIQWRPVQVEgss................dindS..SRNSQ..THLS.GK.KA.KA...R..-..EAGG..Q..T..AD..RP.....REPPW.TYFCDFQDITHL.........VL.K..........G..........C..R................VTIY.....QQDNKCL..........E.LR...........L....PSR.AAALSFVALVDGYFRLTADSSH..................
A0A6G1AVY6_CROCR/284-420               ............................................................EIFETSMLLISSENE.MNW.FN...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKTK.LK.WK.KL...E..S..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671XSY0_SPAAU/298-373               ........................................................kgkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EEGEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
A0A4U1F8P3_MONMO/463-545               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
A0A2U3Z0Y0_LEPWE/272-357               ...........................................rvagdtgiawspggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SV.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A2U9CF62_SCOMX/312-412               .......................................vtdlsarevtivvmgnkgiqq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--SK..G..K..LE..EG.....ENEEL.QTYCDFPEVIDI.........SI.K..........Q..........S..Nkegs.......aesriVTIT.....RQDSKFL..........E.LE...........F....HSQ.AEALSFVSVVDGYYRLVADAHH..................
A0A091XF04_OPIHO/298-380               .................................................srgklkdcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ADQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A673XYW0_SALTR/291-369               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A673Y5Y9_SALTR/260-397               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
F1PBD0_CANLF/272-413                   ...........................................................q-AVGESCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gdsS..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A384C3J0_URSMA/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKHK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5Q1Z6_CEBCA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A401NV79_SCYTO/364-505               .........................................................emy---KPTSLLISTENE.RVM.TN...Y.EPfekEQKEQEHEVMITGSEGIKWRRAPKE.......................F..IVNLK..EKKL.KK.SK.SG...S..K..NCKT..G..E..SK..SV.....QNEGW.NLFSDFYEITHI.........VI.K..........D..........S..T................VIIN.....KQDNKKL..........E.LK...........L....SSY.EEALSLVSLIDGYFRLTVDAHH..................
A0A667ZF98_9TELE/287-366               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..DA.....AEEEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A3P9CKW9_9CICH/307-386               ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..DR.....AEEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A4W5RE64_9TELE/154-203               ....................................................aksllwds---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A2Y9G9Q3_NEOSC/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....IREEW.SNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672IG66_SALFA/257-364               ............................lekafytetfpvkepssgqvilhvaadtgiqw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CR..KK.....MKDSD.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
X1WHN6_DANRE/259-360                   ......................................hsgwleqseqqrvlavkvsgeg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---G..I..Q..IQ..KT.....DRQEW.QTFCDFPQIIDI.........SI.KrlcqeqmpleG..........R..V................VTLT.....RQDDQCM..........E.AE...........F....QTL.TDALSFVSLVDGYFRLTTDSTH..................
A0A5N4CLW7_CAMDR/317-401               ............................................vaggsgiawspgeqev---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSQH..................
A0A672JAY8_SALFA/222-297               ...................................................tgkeepgee---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.ETYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
G3QSH5_GORGO/273-357                   ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A3S2MYF5_ORYJA/279-406               ................................................gsysstvhgngl---------------.---.-S...K.EN...LSPLVTHEVMVSGTEGVQWRKLQIQ.......................-..--RAQ..EN-S.YL.RN.DY...L..N..YKKV..K..Q..LK..AN.....TPDTW.TLFSDFPDITHI.........AI.S..........E..........A..N................VYIS.....TLDNRCM..........V.VQ...........M....NSS.QEARSFVSLLDGYYRLTADAHH..................
G3IEQ4_CRIGR/289-371                   .......................................................srgrh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..E..SE..TL.....TEQGL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......nesrlVTIH.....KQDGKIL..........E.IE...........L....SSL.REALSFVSLVDGYYRLTADAHH..................
A0A1L8HY58_XENLA/297-379               .....................................................skgkpne---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..RE..SL.....ADMDL.QLYCDFPEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKTL..........E.VE...........F....STL.KGALSFASLIDGYCRLTTDAHH..................
A0A091TPR4_PELCR/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegc.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A674HNV0_TAEGU/283-413               ............................................................EIFETSFLLISAENE.VNK.FN...C.GD...NE---RYEVMVSGNNGIQWRLKPS-.......................-..---PV..PTEK.EK.KK.KS...D..S..KSKK..V..E..EK..HK.....LREAW.NSFSYFPEITHI.........VI.R..........D..........C..A................VSVN.....KQDNKRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
A0A672IVQ7_SALFA/273-378               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A4W4GFW2_ELEEL/288-360               .........................................................lav---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A4W6EKN6_LATCA/292-370               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
I3K427_ORENI/326-414                   ................................................ekgiqtagniyd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..SQ..DL.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A1S3LTH7_SALSA/291-369               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A384A4I8_BALAS/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W4H6Z5_ELEEL/224-319               ........................................keasagqvtiivsadqgiqw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CR..ER.....QKEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A4W6C123_LATCA/289-423               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................K.aQANSY..LRND.YM.SY.MR...K..T..KHQS..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A5A9PCH4_9TELE/250-386               ................................................evfqpssliile------------NEE.M--.LT...D.SS...CEAGVQFEILVSGISGIHWRKVSTE.......................T..SFDTG..KRKS.KR.GQ.KD...T..K..TQSI..T..P..TP..DV.....GEDRW.TLFSDFHEIMYI.........VI.K..........S..........S..V................VSIY.....RQDDRKM..........E.LC...........L....ASH.GEALSFASLVDGYFRLRVDAHH..................
W5MIN0_LEPOC/284-419                   ............................................................EIFETSMLQICVENE.SCL.PY...-.--...NKEQPLYEIQVSGKMGIMLREKPIN.......................I..VFTQK..EKNK.SR.KI.RT...E..S..KKKN..E..R..KK..DN.....LSDGW.KLFSEFNNITHI.........VL.R..........D..........S..T................VTIY.....TQDNKRM..........E.LQ...........L....AFH.DEALSFTALIDGYFRLTVDAHH..................
A0A4W4EP58_ELEEL/158-291               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................-..--VSE..GVPL.LS.K-.-V...D..S..K-QK..N..E..KK..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
W5PVH1_SHEEP/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A673YF71_SALTR/292-366               .......................................................padvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A4W3JUV1_CALMI/283-425               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNE.......................P..VVNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A485NN57_LYNPA/136-217               ..............................................dsgmhwspggheal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A665UQE7_ECHNA/301-431               .....................................................gyhgyyn-------------HS.QTE.SQ...I.QN...IEKSRDVQVLVTGTTGISWRKKPSV.......................-..SLVSK..EKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W4EGP8_ELEEL/298-435               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ.......................R.vGLNSA..TRRCcGS.PA.CL...V..-..LTVG..R..V..QE..MD.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A673C8F6_9TELE/315-383               .......................................................taqkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-C.....QNKTW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W5MLC8_9TELE/295-373               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A671W3K5_SPAAU/261-381               ..................................................dpillsvqeg---------------.--E.SQ...S.QN...METSHDMQVRVTGTTGISWRKKPPT.......................-..-----..----.SK.KN.KQ...D..G..KQKN..-..D..KN..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A2K6JTR6_RHIBE/290-427               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKSK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A669B420_ORENI/274-403               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSAN.......................N..YMRNG..YLNY.MR.KQ.KQ...H..-..---S..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A674D7B8_SALTR/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A6Q2Z134_ESOLU/293-374               ........................................................qwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..Q..QK..DS.....EQQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A670K528_PODMU/295-380               .......................................................iqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..D..SE..TL.....AEQEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
A0A670KAY1_PODMU/100-201               ...........................qawvpaqaatgsawtihvssekgiltshsgakg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----T.HLFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A6J3R6N7_TURTR/325-401               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtasd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..E..E---..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------l.................
A0A673YIJ0_SALTR/252-384               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................-..--VSG..KKTK.SK.KN.KH...E..G..KQKK..-..D..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A6I8QZL9_XENTR/297-379               ......................................................skgkpk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..RE..SL.....ADMDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A5G2R6U0_PIG/236-318                 .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A091CUK2_FUKDA/316-453               ............................................................EIFETPMLRISSENE.MSW.FR...S.SD...GGSTLCYEVMVTGNLGIQWRQKPNA.......................-..VPAEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....VREEW.NNFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKNM..........E.LQ...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A556VU80_BAGYA/311-446               .............................................dgsgsylnpsrahep---------------.---.-L...E.EN...PCSQPTHELMVSGTAGIRWRKIPAQ.......................R.aQENNY..MGNDyFN.KK.KR...E..-..NQEV..M..Q..GE..NY.....MAESW.NVFCDFPEISHI.........AI.T..........G..........A..N................VCIS.....RQDNFAM..........E.LR...........L....KSI.LEARSLVSLLDGYFRLTADAHH..................
A0A2I4CIS6_9TELE/281-412               ...........................................sngsssytrcdgdlrkp---------------.---.--...-.--...CGAEATHEIMVSGTKGIHWRKLSQK.......................-..QTDPR..LRNN.YL.NL.SK...K..S..KQNS..S..E..AN..GE.....SHDDW.EFFCDFPEITVI.........DI.N..........E..........S..N................VRIS.....TQLNQCL..........E.VE...........M....RSS.QEACSFISLLDGYYRLTADAHH..................
A0A4U1EWU8_MONMO/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A452QRE2_URSAM/290-368               ......................................................rgkhke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....ETLTE.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
G3NVW0_GASAC/305-437                   ......................................................sygygy--------SNQGQEE.IQK.PN...M.--...-KTSHDMHVLVTGTNGISWRKKPAT.......................S..TGISK..EKGK.LK.KV.KL...D..G..KQKN..G..K..SM..EA.....-NEDW.VVFCDFHEITHT.........VI.K..........E..........T..M................VTVY.....RQDNKRM..........E.LH...........M....ASR.GEALSFAALVDGYFRLTVDAHH..................
A0A6I8P0P2_ORNAN/202-277               ....................................................nssgnegs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QHFCDFPEITDI.........SI.K..........Q..........V..Srdgnp......retrlVTLT.....RTDNRTL..........E.VE...........F....PTL.REALSFISLIDGYYRLTADAHH..................
A0A6Q2XVQ0_ESOLU/263-366               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A4W3HJ12_CALMI/288-363               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
G3W042_SARHA/288-435                   ............................................................EAERDLCYVNSSEQG.PTL.PP...G.ATlslADQAPTHEVLVTGTSGIHWRLLQVEdsd.................lkvN..HSQSS..LGKK.SK.TR.EA...E..S..RKLS..Q..L..PT..ER.....KETVW.TYFCDFQDITHI.........VV.K..........E..........N..N................VSIH.....RQDNKCL..........E.LT...........L....PSP.MVALSLVSLVDGYFRLTADSSH..................
A0A672IDD0_SALFA/284-367               ....................................................tgiqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A3P8WN30_CYNSE/288-395               .........................................slsvsqegefsigyngene---------------.---.--...-.--...-------------------------.......................V..LVSVK..EKSK.SK.KN.KS...D..G..KQQS..-..D..AK..KE.....AYEGW.VVFCDFHEIIHT.........AI.K..........E..........A..T................VSIY.....RQD-KKM..........E.MQ...........M....SSR.TEALSFLALVDGYFRLTVDAHH..................
A0A0R4J0R7_MOUSE/275-354               ....................................................giswssgd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTVT.....RMDGHIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLICDSRH..................
A0A3P9CMC0_9CICH/278-320               ..................................................etgiqtagsi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....---NNSQ..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W3JKR6_CALMI/219-301               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A3Q3W8P7_MOLML/268-394               ................................................sglgcelfepis---------------.---.--...-.QN...METSHDTQVLVTGTTGISWRKKPTP.......................-..-VNSK..EKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A226MI46_CALSU/270-355               .............................................hvsadsgvswscsgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ESR.QHFCDFPDIADV.........SI.K..........Q..........A..Srdggp......venriVTIT.....KTDNRVL..........E.VE...........F....PTL.REALSFVALVDGYYRLTADPHH..................
A0A4W6D9H2_LATCA/219-343               .................................................glgsellepvs---------------.---.-Q...S.QN...METSSDMQVLVTGTTGISWRKKPAA.......................-..----V..KKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
H0Z3Y5_TAEGU/297-379                   .................................................srgklkdcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A3P8WZL7_CYNSE/282-418               .................................................dgdegssylnr-------------MD.PQD.DE...K.DN...FTAPTTHEIIVSGIKGIRWRKVSVQ.......................A..QDNAC..PGND.YM.NF.SR...K..A..KRQS..A..Q..AS..VK.....SPNKL.TSFCDFPEITHI.........AV.N..........G..........A..N................VCIS.....TQENQCM..........V.VQ...........M....RSS.QEAHSFISLLDGYYRLTADAHH..................
A0A671UP86_SPAAU/172-271               ...............................vssshsksafslvrhqvvilpthefslfr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--LQW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A401NRJ4_SCYTO/176-262               ..................................................imriskerkw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..NL..RQ.....ICDQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srdyvl......eesriVTLT.....KQDNKLL..........E.AE...........F....PTL.REALSFVSLIDGYYRLTADAHH..................
H3CH80_TETNG/307-390                   ..............................................rsmgteegaegllp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEL.QTFCDFSEVIDM.........GV.Q..........Q..........A..Nkegs.......segrvVTVT.....KQDNQIL..........E.VE...........F....SLL.SEALSFVSLVDGYYRLVADAHH..................
A0A5N4CLX1_CAMDR/326-401               .....................................................spgeqev---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSQH..................
A0A672JQ86_SALFA/269-375               ..............................frvnnsssqskppfslvrvtgetgiqtsgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..DQ..PD.....EDLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A1S3FJH6_DIPOR/284-420               ............................................................EIFETSMLLISSENE.NW-.FH...S.ND...SGNVLYYEVMVTGNLGIQWRQKPNA.......................-..VPIEK..EKNK.LK.RK.KL...E..N..KLKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672ZKE9_9TELE/195-267               ......................................................qwstgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A3Q0CF12_MESAU/356-433               .....................................................awspgdq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTVT.....RMDSHAL..........E.AE...........F....PGL.PEALSFLALVDGYFRLTCDSRH..................
D2GV17_AILME/282-357                   ....................................................spggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A4W5QLJ4_9TELE/283-421               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM.........vR.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
G1KCE0_ANOCA/285-379                   ..............................................tiiisanggiqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..E..SE..TL.....VEQDI.QTYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.KDALSFVSLIDGYYRLTADAHH..................
A0A6I8QGD3_XENTR/212-288               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KP.....KERES.LTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A3Q3CEY0_HAPBU/299-432               ....................................................ngsyygyy------------NQS.LGH.AQ...S.QN...MEASRDMQVLVTGTTGISWRKKPTT.......................S..SVACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........L....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A667Y0Y5_9TELE/321-455               .........................................gsssylstthaigdagdsf---------------.---.--...-.--...-GAPVTHEIMVSGTKGIQWRKVSGQ.......................K..AQENS..YLRP.GD.TD.YM...R..-..KAKQ..Q..PsqSN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A4W4GEL3_ELEEL/330-406               ........................................................qtra---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....DSQEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A3P9C798_9CICH/297-377               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A4W3JI20_CALMI/299-381               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A673XZ50_SALTR/228-306               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3P8S1G4_AMPPE/286-367               ...................................................qtsgschsv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....DAPEW.HTFCDFQEIIDIgirrvcheqVL.Q..........D.........sR..M................VTIT.....RKDDKCF..........E.AK...........F....QTL.KEALSFVSLVDGYFRLTTDSSH..................
A0A3Q3RYC8_9TELE/246-374               ......................................................fhgyfn---------------.QSQ.EQ...S.QS...METSHGMQVLVTGINGISWRNKPTS.......................T..FLNSK..EKSK.LK.KK.KN...D..G..KQK-..N..D..RK..KE.....VDDGW.MVFCDFHEITHT.........VV.K..........E..........A..T................VTIY.....KQDNKRM..........E.LQ...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A091NKY1_APAVI/102-223               ............................................................EIFETSFLLISSETE.VNG.FN...R.GD...YEILPLYEVIVTGNNGIQWRLKPNS.......................-..-----..---D.GK.N-.--...-..-..---K..K..D..EE..KH.....KRDFW.NNFSYFPEITHI.........VI.K..........E..........S..T................VCIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFTSLIDGYFRLTADAHH..................
A0A672JQ91_SALFA/184-291               .........................................gsetfrvnnsssqskppfs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.LV.RV...T..G..ETGI..Q..T..SG..NN.....ETLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A673C6K4_9TELE/282-419               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K.aQANTY.lRNDY.MN.YV.RI...T..-..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A337SUR0_FELCA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qgnqe.gsnesR..I................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A315UYF9_GAMAF/318-397               ......................................................wcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFHDVTDI.........SI.K..........Qacke.gatesR..L................VTIN.....KQDGKNL..........E.LE...........F....PSL.FEALSFASLVDGYYRLTTDAHH..................
A0A673XYL6_SALTR/278-356               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
TYK2_HUMAN/285-432                     ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
#=GR TYK2_HUMAN/285-432          SS    ............................................................GGG--TT--------.---.--...-.--...------EEEEEETTTEEEEEE---------.............------..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.EEEE-GGGEEEE.........EE.E..........T..........T..E................EEEE.....ETTSEEE..........E.EE...........-....SSH.HHHHHHHHHHHHHHHHHT-TT-..................
A0A1U7U068_CARSF/284-420               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNLLYYEVMVTGNLGIQWRQKPNV.......................-..-VPVE..KEKK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5WFZ1_MACFA/260-344               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A340WTZ3_LIPVE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
H0YE41_HUMAN/64-117                    ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEE.......................V..NK---..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------eee...............
A0A452QRK9_URSAM/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A402FXK3_9SAUR/267-319               ......................................akeamrviqvsgetgissshse---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-----DQ..........E.ME...........F....LTL.REALSFVSLVDGYYRLTVDTQH..................
A0A6Q2Y6V9_ESOLU/243-384               ..................................kylinmesleqafytecfqvrdpsag---------------.---.--...-.--...-----QVTITVTAEHGIQWCREQQK.......................D..SEQVL..LTLL.LE.L-.LM...H..-..--NF..L..F..LL..TF.....FKQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
M3Y0T4_MUSPF/297-379                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A673YX36_SALTR/283-410               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQ.......................K..VWNR-..--KS.VK.Q-.--...-..-..--SP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........V.RA...........P....ASQlLEALSFVSLLDGYFRLTADAHH..................
A0A4W5JGW4_9TELE/230-370               ......................................hflnefnnktvksnkvnthdik---------------.---.--...-.--...VKYLATLETLTCGFGCEVYKNILCSsv...................sqN..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..-D.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A4W6C1L4_LATCA/283-400               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVYMR.......................-..-----..----.--.KT.KH...-..-..--QS..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A2K5WFY6_MACFA/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
F1R5C7_DANRE/282-417                   ....................................eifkpknlkvtgesegspaqmlpl---------------.---.--...-.--...GDNGMGYEVQVYGTTGISWRRKPAP.......................N..QLILK..DKPK.SK.KI.KG...D..-..---K..Q..W..ND..KK.....KDSGW.TLFSDFHEITHI.........VI.K..........D..........C..C................VTIY.....RQDNKTM..........E.LD...........L....FYR.DAALSFAALVDGYFRLTVDAHH..................
A0A5F4C8Z3_CANLF/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A060VVA2_ONCMY/278-415               ...................................................ykpevlrvt----------DSEGE.IEG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DV.....-SNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLVDGYFRLTVDAHH..................
A0A674HCE1_TAEGU/292-416               ..................................................aagscaepep---------------.---.--...-.-P...RDRPVTHHVLVTGTGGIQWRPVAGE.......................S.tESFSQ..RGYF.GR.KS.RK...-..-..-KEP..E..A..AP..ER.....SEPPW.RRFCDFREITHV.........VV.K..........D..........A..R................ISIH.....RQDNECL..........E.VL...........L....PSP.GSALALVSLVDGYFRLTADSSH..................
A0A5F4DAD4_CANLF/191-299               .................................................pgrggvllhpg---------------.---.--...-.--...----------------------QRSpr..................gdsS..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A672IWS2_SALFA/282-396               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQ.......................-..-----..----.-K.KT.KQ...Q..-..QAGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........V.RA...........L....---.-EARSFISLLDGYYRLTADAHH..................
A0A3Q7R7F6_VULVU/299-440               ...........................................................q-AVGKSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gngS..SKNRH..ADPF.GK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A672J911_SALFA/273-369               ..................................................ftlfrcgmpv---------------.---.--...-.--...-------------------------.......................-..--ISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A662YPR4_ACIRT/296-378               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..D..SN..SL.....SDQDL.QTYCDFPDVIDV.........GI.K..........Q..........A..Dkdfs.......tesriVTIS.....KQDGNSL..........E.VE...........F....SSL.QEALSFVSLIDGYYRLTADAHH..................
A0A673WE61_SALTR/264-343               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A671VHJ7_SPAAU/277-355               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A3S2M0Z0_ORYJA/295-375               .........................................................wsk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..EG.....ADEEL.QAYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VSLT.....RQDNQIL..........E.LE...........F....HSL.PEALSFVSLVDGYYRLVTDAHH..................
A0A673UT14_SURSU/284-420               ............................................................EIFETSMLLISSENE.MNW.FN...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5IHF1_COLAP/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKSK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
F6TJE9_HORSE/286-431                   ............................................................QAEGDPYYIGDSGHA.PSD.PG...P.EA...AAGPPTHEVLVTGTGGIQWRPVQAEgpsg...............sgsgS..NRNPG..AGPS.GK.KA.KA...Q..-..EVGD..Q..P..VD..RP.....REVPW.TYFCDFQDITHV.........VL.K..........E..........R..H................VSIH.....CQDNRCL..........E.LT...........L....PSR.ASALSLVSLVDGYFRLTADSSH..................
A0A2U3W8S8_ODORO/273-357               ............................................vagdtgiawspggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A553NHL3_9TELE/238-346               ...............................................sesfslhhsglle---------------.---.--...-.--...-------------------------.......................-..---QS..ERRR.VK.AV.KV...S..G..EEG-..L..Q..IQ..AS.....DGQEW.QTFCDFPQITDI.........SI.KrlcqeqmpleG..........R..V................VTLT.....RQDDQCM..........E.AE...........F....LTL.TEALSFVSLVDGYFRLTTDSTH..................
A0A5F9ZI39_HUMAN/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5QF79_9TELE/282-419               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A672IUK2_SALFA/243-379               ............................lkylismeslekafytetfpvkepssgqvilh---------------.---.--...-.--...----------VAADTGIQWCREKMK.......................-..----D..SDQL.SL.RV.FS...H..-..----..L..P..TL..AR.....PNREL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A672Z4J3_9TELE/263-390               ...................................................llepksvsv--------------K.QEE.DQ...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................-..----V..KKNK.SK.KN.KH...D..S..KQ-K..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
L5LC09_MYODS/248-323                   .......................................................spgaq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PASLSFVALVDGYFRLTTDSQH..................
A0A2Y9IYY8_ENHLU/272-357               ...........................................rvagdsgiawssggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLISDSRH..................
A0A672IX68_SALFA/294-425               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQ.......................D..NPYLR..NDYL.NY.TK.KT...K..-..QQQA..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W4GEN8_ELEEL/230-326               ..................................mepnygseqfavrqsgwhqsniqlla---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-VQEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A2R9C1D6_PANPA/285-432               ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..L..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
G3QWD9_GORGO/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
G3PKV8_GASAC/280-413                   ...........................................giesssysnstryegap---------------.---.--...E.DD...FIGPATHEVLVSGTKGVRWRPVSEQ.......................-..KAQAN..TYLR.ND.YM.KT...K..-..KQPS..S..Q..PS..EN.....TTDKW.TSFCDFREITHI.........AI.T..........G..........T..N................VCIS.....TLDNRCL..........E.VQ...........M....NSS.QEARSFISLLDGYNRLTAFAHH..................
A0A4W4GJH3_ELEEL/258-334               ........................................................qtra---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....DSQEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
F7DRD4_MACMU/285-432                   ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A5J5MYP2_MUNRE/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...S.ES...AAGPPTHEVLVSGTEGIRWRLVRAEgpgd..............gggggG..SRMPD..AGPS.GK.KM.KA...Q..-..KAGS..E..P..VD..RP.....RETPW.SYFCNFQDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
A0A099YZG4_TINGU/293-430               ............................................................EIFETSSLLISSENE.INK.FN...C.GD...NEILPQYEVIITGNNGIQWRLKPNP.......................-..AQTER..EKHK.TK.RR.KS...D..G..KSKK..E..E..EK..HK.....IQDLW.NNFSYFPEITHI.........VI.K..........D..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A437DEZ3_ORYJA/297-434               ................................................eeevcngyygyy------------NQS.QGQ.TP...S.QN...MQTSCDMQVLVTGITGISWRKKPFI.......................D..SLMSK..EKKK.TK.KN.KQ...D..G..KQKN..-..D..KK..TE.....ASEGW.VIFCDFYEITHT.........VI.K..........D..........C..T................VTIK.....SQDNKKM..........E.VE...........L....ASK.PEALSFAALVDGYFRLTVDAHH..................
G1KI54_ANOCA/284-424                   ............................................................ELFETTSLLISSENE.KS-.FN...M.DD...CNIIPHYEVIVTGNQGIQWRVKPYGsm...................lqV..TQTEK..EKHK.TK.RK.KS...D..G..KVKK..N..E..EK..SK.....RED-W.NNFSYFPEITHL.........VI.K..........E..........S..T................VSVY.....KQDNKRM..........E.LK...........L....SSH.GEALSFAALVDGYFRLTTDAHH..................
A0A671VIY1_SPAAU/212-283               .......................................................cvqel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
A0A091UD74_PHORB/296-380               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A665VNN0_ECHNA/264-342               ........................................................rgkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A091K588_COLST/252-323               ..........................................................kp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---N..D..E..EK..LK.....IQESW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
A0A4W3JUX4_CALMI/281-419               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRPV--.......................-..-VNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A673XY40_SALTR/291-367               ....................................................sreedkeg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---LE.LTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A2I3NI09_PAPAN/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A452QRI0_URSAM/282-360               ......................................................rgkhke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....ETLTE.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A6Q2ZJP0_ESOLU/227-356               ..................................................gdgsnsqahg---------------.--A.SD...S.DN...FVTPASYEVTVSGTNGIQWRKIVVQ.......................K.eNNYFG..NDYF.GN.RK.SV...K..-..-KPA..E..G..V-..PK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSL..........E.IQ...........M....KSN.MEARSFVSLLDGYFRLTADAHH..................
A0A6I8RFQ0_XENTR/266-333               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................S..V----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------yrgnkylmncrlkcisls
A0A091GNU7_BUCRH/285-415               ............................................................EIFETSYLLISSENE.RNG.FN...C.GD...GETPPQYEVIVTGNNGIQWRLKPAV.......................-..-----..--EK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IRDSW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A668A690_9TELE/246-341               ........................................hgrhpeevnagirynnlmcn---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.KL...D..G..K-QK..N..D..RK..KD.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A672Z5D3_9TELE/279-398               ......................................................epksvs------YYNQA--QG.QNQ.SQ...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................-..--VSE..TVLK.TK.K-.--...-..-..----..-..-..--..-E.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W5QP54_9TELE/273-382               ................................secfrvteslegevtivvtgnngiqwsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..EEDK..E..A..DK..VG.....GEVGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A096P1M0_PAPAN/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3Q0GUV9_ALLSI/297-379               .......................................................srgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......sesriVTIH.....KQDSKNM..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A485MWR0_LYNPA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qgnqe.gsnesR..I................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2Y9P436_DELLE/284-421               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...D..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....CSH.EEALSFVSLVDGYFRLTADAHH..................
JAK3_RAT/277-354                       .........................................................aws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SK.....DQELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTIT.....RMDGHIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLICDSRH..................
A0A3Q2E5B9_CYPVA/304-383               ......................................................skesge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..GG.....AEEEL.ETYCDFPEMIDI.........SI.K..........Qgnke.gsaesR..I................VSLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A093HE63_STRCA/298-380               .................................................srgklkgcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2Y9LBB1_ENHLU/299-442               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEgpr.................gdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A091Q3A9_LEPDC/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A2I3RSB7_PANTR/285-432               ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A669DPT6_ORENI/310-382               ......................................................psittk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-Y.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKMv.......rlE.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A6Q2ZAK6_ESOLU/228-306               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A2Y9LL96_ENHLU/299-442               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEgpr.................gdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A4W3JVC8_CALMI/279-417               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNE.......................-..VRGP-..--GA.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
G3V9W2_RAT/284-421                     ............................................................EIFETSMLLISSENE.LSR.CH...S.N-...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..LPVEK..EKNK.LK.RK.KL...D.yN..KHKK..E..D..DR..NK.....LREEW.NSFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A310U8T2_XENLA/297-377               ........................................................tkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..P..KE..SF.....ADMGL.QTYCDFPEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKTL..........E.LE...........F....STL.KEALSFASLIDGYCRLTTDAHH..................
A0A3Q7STG4_VULVU/282-357               ....................................................spggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A672Z379_9TELE/279-405               ...................................................gwellepnq---------------.---.--...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A669D9G9_ORENI/233-308               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-E.....EDREL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........-.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A3B1K0A2_ASTMX/250-383               .....................................................gdgsgsy--------LNASRA-.-HD.PS...Q.EM...LCGQPTHEVMVSGTAGIKWRKISCR.......................-..-RAQE..NSYM.EN.DY.LA...E..-..RREE..G..S..QS..RQ.....EGETL.ESFCDFPEISHI.........AI.M..........G..........A..N................VCIC.....RQDNSTI..........HtIT...........H....HTL.TEARSLVSLLDGYFRLTADAHH..................
A0A452QRG3_URSAM/290-368               ......................................................rgkhke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....ETLTE.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A672IVE2_SALFA/260-365               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A674D887_SALTR/282-416               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........-.--...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
H2P0I2_PONAB/130-194                   ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...GAGPPTHEVLVTGTGGIQWWPVQEE.......................V..NKEEE..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------pfvqaklrped.......
A0A669CF70_ORENI/213-318               ........................................etfqvnhssshpmsdfslvr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.-V...T..G..EKGI..Q..T..AG..NI.....YDIEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W5JJL4_9TELE/247-385               ...........nefnnktvksnkvnthdikvkylatletltcgfgcevcnknilcssvsq---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
U3IAY8_ANAPP/294-379                   ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2Y9IGV8_NEOSC/286-429               ...........................................................q-AVGEPYYIQDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIQAEgpr.................gdgS..SRNPR..AGPF.GK.KT.KA...P..-..EVGG..Q..P..AD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........C..H................VSIR.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A3P8XPU7_ESOLU/293-375               .............................................nsvetdeftlkaphg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A5F7ZPU9_MACMU/294-441               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A493SXP1_ANAPP/275-348               ......................................................vspqsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QHFCDFPDIADV.........SI.K..........Q..........A..Srdgsp......venriVTLT.....KTDNRVL..........E.VE...........F....PTL.QEAHSFVALIDGYYRLTADAHH..................
A0A674PNA5_TAKRU/293-451               ........................................................wvnt------CMVILGYCN.KTS.SQ...D.QK...TQTSRDMQVLVTGTTGISWRKKPDTvsetvcdqesh.sklcqqfrssnQ..PILSF..DWFK.PM.KS.KV...D..G..KQQS..-..D..KK..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A2Y9M105_DELLE/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...ATGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A667XWN7_9TELE/289-423               .........................................gsssylstthaigdagdsf---------------.---.--...-.--...-GAPVTHEIMVSGTKGIQWRKVSGQ.......................K..AQENS..YLRP.GD.TD.YM...R..-..KAKQ..Q..PsqSN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A0A0MVD8_PAPAN/296-380               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A060ZAS2_ONCMY/32-150                ......................................................gdgsgs-------YLNTSHAH.GA-.SD...P.GN...VGPQVMHEVMVSGTKGIQWRKMTVQ.......................-..-----..----.--.--.--...-..N..QSPL..-..Q..QE..PN.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSIF.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A1S3LTD3_SALSA/291-369               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
G3T029_LOXAF/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QIYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSVIDGYYRLTADAHH..................
H3DMJ5_TETNG/107-223                   ...............................................nlreaweesgslh---------------.-TH.AP...C.-E...DRAAATHEIMVNGNKGIWWRISIQT.......................-..---E-..----.--.--.--...-..-..QAAT..Q..P..HK..-D.....TPHKW.NVFCDFPEITHI.........VI.S..........E..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....SSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W4ENR1_ELEEL/128-254               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................-..--VSE..GVPL.L-.--.--...-..-..---K..N..E..KK..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A2Y9TGK4_PHYMC/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEspsd..............gggggG..GRIPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VV..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........D..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A5F8G8A0_MONDO/308-338               .......................................................kefie---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........F....PTL.REALSFVSLVDGYYRLTTDAHH..................
A0A667XPX5_9TELE/303-374               ........................................................qqps---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..Q..SN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A4W6BTP8_LATCA/308-380               ..........................................................kv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--SG..Q..K..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W3H198_CALMI/303-378               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A4W5QG72_9TELE/237-367               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQ.......................K.aNSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........-.--...........-....-VR.APALSFVSLLDGYFRLTADAHH..................
A0A452S1S4_URSAM/308-449               ..........................................................qa--GGEPYYIRDGGQP.PPD.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAEvs...................dgS..SRNPH..AGPS.GK.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A672H7E8_SALFA/280-396               ............................................gdassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................-..-----..----.-K.R-.--...-..-..QPGS..Q..N..AD..T-.....-PNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........-.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
L8IF56_9CETA/273-357                   ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A674D799_SALTR/282-414               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................-..----V..KKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
E2RG40_CANLF/272-357                   ...........................................rvagdrgiawspggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....KTDKQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A4W3J8K3_CALMI/315-465               .......................................eiykatsllvcveseavtagq---------------.--Y.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNEvrgp...............ggreA..GRSPL..SGGS.GK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
W5MVJ9_LEPOC/291-373                   ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-NKD..K..E..AS..SI.....SEQDL.QTYCNFPDVIDI.........SI.K..........Q..........A..Nkdgs.......sesriVTIN.....KQDGKTL..........E.LE...........F....LSL.IEALSFVSLIDGYYRLTTDAHH..................
A0A2K5H7M5_COLAP/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A3P9C6V1_9CICH/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A091ULX3_NIPNI/296-380               ..................................................qclrgklkdy---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A5N5NIA0_PANHP/280-369               .............................................csmvrvsgeggiqtc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SS.....NSQEW.QTFCDFPQITEI.........NM.KrlcqeqlpaeG..........R..V................VTLT.....RQDDRCL..........E.VQ...........F....ETL.AVALSFVSLIDNYFRLTTDSSH..................
A0A4W3IYT8_CALMI/260-397               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNE.......................-..----V..RGPG.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A4W5Q4S5_9TELE/336-471               ......................................................sdgsgs-------YLNTSHAR.G-A.SD...P.EN...FGPQVMHEVMVSGTKGIQWRKITVQ.......................K.aKSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A6Q2YX46_ESOLU/195-320               ..................................................gdgsnsqahg---------------.--A.SD...S.DN...FVTPASYEVTVSGTNGIQWRKIVAK.......................E..NNYFG..NDYF.GN.RK.SV...K..K..PAEG..V..-..--..PK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSL..........-.--...........M....KSN.MEARSFVSLLDGYFRLTADAHH..................
A0A673XYZ4_SALTR/291-367               ....................................................sreedkeg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---LE.LTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A5F4BUS1_CANLF/179-280               ................................................pgrggvlprgds---------------.---.--...-.--...-------------------------.......................S..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A674MFU4_TAKRU/338-410               .....................................................istqksp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-Q..PD.....TPNDW.TAFCDFPEIAHI.........AI.T..........E..........T..N................VCIS.....TQDNHCM..........E.VQ...........M....SST.QEAHSFISLLDGYYRLTADAH-n.................
A0A6I8R020_XENTR/237-313               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
H2LLN7_ORYLA/284-416                   ............................................dgsssysnvvhgdsls---------------.---.--...K.GN...SNPLITHEVMVSGIEGLKWRKVHVH.......................K..--AQV..NSYL.RN.DY.LN...Y..K..KAKQ..Q..S..KQ..LN.....TPDTW.SLFSDFPDITHI.........AI.S..........D..........A..N................VYIS.....TLDNRCM..........V.VQ...........M....SSS.QEARSFVSLLDGYYRLTADAHH..................
F1NQU4_CHICK/297-379                   ....................................................srgklknc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
G1SQL4_RABIT/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...S.SD...SGIVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKSK.LK.RK.KL...E..N..KLRK..D..E..ER..NK.....TREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A226MYM3_COLVI/208-319               ........................................kgrpysdgghvpaqrgdapl---------------.---.--...-.-A...EDGPVSHEVLVTGTTGIQWRPVPNE.......................S.vEVISH..RGYF.GR.RS.RR...K..-..EPEP..R..A..PP..QP.....TEPPW.VHFCDFREITHV.........VI.R..........D..........R..R................VSVH.....RQDNKCL..........-.--...........-....---.----------------------vsav..............
A0A093QTD9_PYGAD/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A6A5ETV4_PERFL/299-432               ....................................................nggyyghi------------NQS.QGQ.SK...S.EN...METNRDMEVLVTGTTGISWRKKPST.......................T..PVIAK..EKGK.SK.KN.KL...D..G..KQKN..-..N..KK..TE.....ANDSW.VVFCDFHEITHA.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LH...........M....ASR.GEALSFAALVDGYFRLTVDAHH..................
A0A669C4P2_ORENI/305-375               ........................................................cqel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A6Q2ZJM5_ESOLU/307-388               ........................................................qwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..Q..QK..DS.....EQQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A452S2S7_URSAM/286-427               ..........................................................qa--GGEPYYIRDGGQP.PPD.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAEvs...................dgS..SRNPH..AGPS.GK.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A3Q7R7F2_VULVU/299-440               ...........................................................q-AVGKSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gngS..SKNRH..ADPF.GK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A3Q2C6B5_CYPVA/261-362               .................................frvnrsssdttftllrvcgetgiqtgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SD.....GALEW.QTFCDFHEIVDI.........SI.KrilnemvpqdS..........R..M................VTIT.....RKDERCL..........E.AS...........F....QSR.REALSFMSLIDGYFRLITDSSH..................
A0A669CL91_ORENI/291-411               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................-..-----..----.--.RV.CI...D..T..DHSS..Q..P..DA..-D.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A673WPD6_SALTR/233-311               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A4W5MH14_9TELE/291-369               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
G3PZA6_GASAC/297-378                   .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..EE..AG.....AEEEL.QTYCDFAEVIDV.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDNQILq........kE.LE...........F....QSL.AEALSFVSLVDGYYRLVADAHH..................
A0A401RSJ1_CHIPU/283-419               ......................................................essrtp------YINNRNYLQ.TTE.NI...I.CP...TLPTQEYEVLVTGTEGIQWRILKKP.......................-..APFKK..TGWK.GK.PA.DS...G..-..SGKS..S..E..AV..EF.....TEKPY.SHFCDFKEITHL.........VI.S..........D..........C..R................VSVH.....RQDNKCL..........D.LV...........L....PSH.KQALSFAALIDGYSRLTTDSHH..................
A0A6I8P500_ORNAN/298-432               ................................................lltpdarsgppa---------------.---.--...-.-P...GDQTATHEVLVTGTGGIAWRPLPAQvs..................gmgR..GPFPG..GGSR.LR.RP.RL...R..A..RRVE..C.wE..PG..VG.....QEAPW.ERFCDFQEITHV.........VL.T..........G..........S..R................VTIH.....QRDNQSL..........E.LA...........L....PTP.AAALSLISLVDGYFRLTTDASH..................
H2M2B1_ORYLA/303-383                   ........................................................wskg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..K..EA..EG.....ADEEL.QAYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VSLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVTDAHH..................
A0A673WPG6_SALTR/290-368               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
L5K8D1_PTEAL/297-379                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqevs.......nesriVTIH.....KQDGKNL..........E.VE...........L....NSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K6U928_SAIBB/273-357               ............................................vtgdrglawspgvqed---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A3Q3G7R5_9LABR/276-415               ......................................................egdgss------SYANTTHA-.-QG.VT...K.DN...FTAPTTHEINVSGTKGIQWRKVSGQk....................aqA..NSYLR..NDSA.NY.MR.KT...K..Q..QSSP..T..E..QN..AN.....TPNKW.TSFCDFPEITHI.........AI.A..........G..........A..N................VCIS.....TQDNHCL..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A2Y9IAA7_NEOSC/118-261               ...........................................................q-AVGEPYYIQDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIQAEgpr.................gdgS..SRNPR..AGPF.GK.KT.KA...P..-..EVGG..Q..P..AD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........C..H................VSIR.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A673YGV7_SALTR/288-423               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A4W3IYU9_CALMI/272-410               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRPV--.......................-..-VNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
L9KPJ3_TUPCH/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W3H2D5_CALMI/325-365               ................................................svvvdclpsllq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A3Q1C5G3_AMPOC/286-367               ...................................................qtsgschsv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....DAPEW.HTFCDFQEIIDIgirrvcheqVL.Q..........D.........sR..M................VTIT.....RKDDKCF..........E.AK...........F....QTL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W5JJM1_9TELE/247-385               ...........nefnnktvksnkvnthdikvkylatletltcgfgcevcnknilcssvsq---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A6I8RHJ1_XENTR/256-399               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTVsvy.................rgnK..CTTSE..KDRK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........-.VS...........A....NSI.EEALSFAALIDGYFRLTADAHH..................
A0A669B4I1_ORENI/264-375               ............................................rldlrdeddrsgsynf---------------.---.--...-.--...-CGPISHEISVSGTEGIQWRKVSVQ.......................-..-----..----.--.R-.--...-..-..-HSS..Q..P..-D..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A4W5MKF7_9TELE/280-357               ....................................................tslsrfls---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3Q3AHA0_KRYMA/290-423               ..................................................lqeedlfngy-----------YNQS.QEQ.SQ...S.QN...LETSKNMQVLINGITGISWRKAPKQ.......................E..SVILK..DKGK.SK.KD.G-...-..-..-KQR..N..D..RN..KD.....ENEAW.VEFCDFHEITHT.........VI.T..........E..........S..E................VTIK.....RQDNKKM..........I.VK...........M....DSR.EKALSFAALIDGYFRLSVDAHH..................
A0A3Q2LLF4_HORSE/274-357               ............................................aggsgiawspggdeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTADSRH..................
A0A2Y9GDB3_NEOSC/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....IREEW.SNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A665VMB3_ECHNA/259-337               ........................................................rgkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
JAK2_RAT/299-381                       .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......tesrvVTVH.....KQDGKVL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A3Q7WQ56_URSAR/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
D3ZD03_RAT/290-433                     ..........................................................qp--ERDPCYIQNSGQT.TGD.PG...P.EL...ASGPATHEVLVTGTGGIQWRPLQTQdse.................rghS..RGNPQ..GSQS.GK.KP.KA...P..-..ESGE..H..L..AG..SP.....QEPPW.TYFCDFQDISHV.........VL.K..........E..........R..R................VHIH.....LQDNKCL..........L.LC...........L....CSQ.AEALSFVALVDGYFRLTADSSH..................
A0A6Q2ZIB1_ESOLU/221-299               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A3Q3LW26_9TELE/304-432               ......................................................fhgyfn---------------.QSQ.EQ...S.QS...METSHGMQVLVTGINGISWRNKPTS.......................T..FLNSK..EKSK.LK.KK.KN...D..G..KQK-..N..D..RK..KE.....VDDGW.MVFCDFHEITHT.........VV.K..........E..........A..T................VTIY.....KQDNKRM..........E.LQ...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A673A6T3_9TELE/272-346               ........................................................wcyg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--HEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A452C7C9_BALAS/286-423               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..A................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
G1NGZ6_MELGA/284-417                   ............................................................EIFETSSLLISSESE.INR.FN...C.GD...GEIIPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KIKK..D..E..DR..YK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A669CBN7_ORENI/308-387               ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..DR.....AEEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A2Y9N3T7_DELLE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
H3DL74_TETNG/306-422                   ......................................................lplick---------------.---.--...-.--...-----RFLVLVTGTTGISWRKKPEM.......................A..LITSK..DKSK.SK.KS.KA...D..G..KQQN..D..R..KK..EE.....-TEGW.EVFCDFYEITHA.........VI.K..........D..........K.tT................VTIY.....RQDNMGM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
G5E852_MOUSE/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDV.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......nesriVTVH.....KQDGKVL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A5N5M2M0_PANHP/285-363               ...................................................tkgkdngdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QDL.QVYCDFPDVIDI.........SI.K..........Q..........A..Skdgs.......vesriVTIN.....RQDSQTL..........E.LE...........F....SSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A0N8K0F6_SCLFO/295-375               .........................................................sce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..R..KE..SG.....AEQEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......nesrvVTIN.....KQDSKKL..........E.LE...........F....RSL.SEALSFVSLIDGYYRLTADAHH..................
A0A091DCH8_FUKDA/286-431               ............................................................QADREPCYIRDGGQP.PAE.VD...P.AA...APGPPTHEVLVTGTGGIQWRLVQPEsas................anggG..SWNPP..PRLP.GK.KA.RA...H..K..EVGK..Q..P..VD..KP.....QGPPW.TYFCDFRDVTHV.........VL.K..........E..........C..L................VSIH.....RQDNKCL..........E.LS...........L....PSP.TAALSFAALVDGYFRLTADSSH..................
A0A6I8NFI0_ORNAN/331-468               ............................................................EVFEATLLQISSENE.KNR.SH...F.GD...HGEVLHFEVMVTGNQGIQWRQKCNV.......................-..VPVEK..EKSK.PK.RK.KL...E..S..KTKK..E..E..EK..IK.....LREEW.ISFSYFPEITHI.........VI.K..........E..........A..T................VSIN.....KQDNKRM..........E.LQ...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A5F9D5Z1_RABIT/301-354               ............................................................QADGEPCYIRDHRPA.PAD.PG...P.EA...APGPPTHEVLVTGTGGIQWRPVLAE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vragrl............
A0A2R8RWH2_DANRE/234-342               ......................................slklkylmklselepdygsetv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.KV...S..G..EGG-..I..Q..IQ..KT.....DRQEW.QTFCDFPQIIDI.........SI.KrlcqeqmpleG..........R..V................VTLT.....RQDDQCM..........E.VA..........eF....QTL.TDALSFVSLVDGYFRLTTDSTH..................
V8NXT0_OPHHA/271-413                   ...........................................................d-GEKVPLYINGGHMH.LEN.SY...S.SS..hGSRPVTHEVWVTGINGIQWRPIPAE.......................K.pQSQPH..KIYF.GR.KV.KT...K..E..HKSK..Q..S..YQpvEQ.....REAKW.AHFCDFQEITHI.........VV.K..........D..........C..N................ISIH.....RQDNKCL..........D.LT...........L....SSH.EAALSLISLVDGYFRLTADSSH..................
A0A4W5QMA6_9TELE/359-429               ..........................................................tv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..K..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
H0YE41_HUMAN/108-145                   .........................................................vee---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-EVNKEE..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A667ZWL7_9TELE/268-347               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..DA.....AEEEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A669CVA8_ORENI/280-414               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................R..AQANN..YMRN.GYlNY.MR...K..Q..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A665WVC5_ECHNA/293-375               ...................................................giqwcreki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQAL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
G3VR92_SARHA/282-357                   ....................................................tpagsqsp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........GI.K..........QacrdghlsenR..L................VTVT.....KTDNRIL..........E.VE...........F....PTL.REALSFISLVDGYYRLTTDAHH..................
A0A672J5N6_SALFA/256-376               ..............................................qegdlcnggysgef---------------.---.--...-.--...--------VLVAGTSGISWRSKPSV.......................M..PVISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A286XLG2_CAVPO/273-357               ..............................................vaggsgiawspgea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EAF.QQFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTIT.....RADNKIL..........E.AE...........F....PAL.RAALSFVALVDGYFRLTCDTRH..................
A0A673C3A4_9TELE/307-339               ........................................................tqfq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LE...........F....PSL.LEALSFVSLIDGYYRLTTDAHH..................
A0A672IT07_SALFA/244-350               .............................fytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A026WQI1_OOCBI/221-300               ..............................................kvllrvnieelkyc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EV..HA.....SNTAW.NTLCAIEDLCFI.........SI.R..........E.........dN..T................VEIS.....RKNGIPS..........Y.LK...........F....NMY.AMMLSFVSALDGYYRLSV----kw................
A0A3Q3LUN7_9TELE/281-418               ....................................................dgdrsssy--------SNTTHA-.-HG.VT...K.DN...FRAPPTHEIMVSGIKGIQWREVPNQ.......................K.vHENTY..FRND.YM.NF.MK...K..T..KQQS..S..Q..PN..AN.....TPNEW.TFFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDIHFM..........E.VE...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
JAK3_MOUSE/275-354                     ....................................................giswssgd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTVT.....RMDGHIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLICDSRH..................
A0A315V4F5_GAMAF/278-409               ....................................................dgdesisy-----------SINE.SNG.DS...K.KD...FAAPFTHEIMVSGTKGIQWRMLKTQ.......................-..---KA..EENS.YH.RG.NY...L..N..QRTP..K..R..ST..SN.....PPDKW.TFFCDFREIIHI.........SI.T..........E..........A..N................VCIN.....TQKSHCM..........E.VQ...........M....NSS.QEARAFISLLDGYYRLTADAHH..................
A0A2U9BTF6_SCOMX/281-363               ...................................................giqwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTWCDFPDVTDI.........SI.Klask.egateS..........R..V................VTIN.....KQDGKKL..........E.LE...........F....PSL.YEALSFVSLIDGYYRLTSDAHH..................
A0A4W6D9I3_LATCA/221-343               ..............................................pvslsvtqegeian---------------.---.--...-.--...----GGYHVLVTGTTGISWRKKPTS.......................-..-VISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A672JDT9_SALFA/245-330               ...................................................wstgkeepg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EE..EV.....RAGRWlKTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A212D0T1_CEREH/141-252               ......................................................ndvasl-------WELSSEEE.IHH.FQ...N.DS...LGMALLHLCHLALHDGVPLEKVAKK.......................-..TRMPD..AGPS.GK.KM.KA...Q..-..KAGS..E..P..VD..RP.....RETPW.SYFCDFQDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKCL..........-.--...........-....---.----------------------sdraf.............
A0A669BUY0_ORENI/235-369               ..........................................lsviqegdlcngsyygnq---------------.---.--...-.-N...MEVSRDMQVLVTGTTGISWRKKPAT.......................S..SVACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM.........vR.LV...........C....VCV.AEALSFAALVDGYFRLTVDAHH..................
A0A3B1ILK7_ASTMX/279-367               .....................................................qgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..EKQK..D..E..QS..EL.....SDKDL.QTYCDFPHVIDI.........SI.R..........Qaske.gsnksR..V................VSIN.....KQDGKTL..........E.LE...........F....SSH.AEALSFVSLIDGYYRLTVDAH-y.................
JAK2_PIG/299-381                       .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4Z2FS45_9TELE/294-372               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KE.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qagke.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....LSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A673Y620_SALTR/283-421               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM.........vR.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A6Q2XC04_ESOLU/239-322               .....................................................hgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..QQ..KD.....SEQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A669B0U9_ORENI/257-362               ........................................etfqvnhssshpmsdfslvr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.-V...T..G..EKGI..Q..T..AG..NI.....YDIEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A672HA16_SALFA/286-399               .............................................assshsnaahaqgvc---------------.---.--...-.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................-..-----..----.--.--.--...-..-..KPGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A4W6EKW9_LATCA/287-367               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A091FRB5_CORBR/279-375               ....................................srknlefspqsvenfsqrgyfgrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..SGNK..E..L..EA..PP.....AEPQW.CHFCDFREITHV.........VV.K..........D..........S..R................ICIH.....RQDNECL..........E.VQ...........L....PCP.GSALSLVSLVDGYFRLTADSSH..................
A0A4W4FC90_ELEEL/276-412               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPNA.......................T..SIEMR..VLKS.SR.GR.RP...Q..N..QQNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A0N8JZU0_SCLFO/261-394               ..............................................gssssgsvgmspew---------------.---.--...-.-S...KGSEVTHEVMVSGTEGIKWRKVQVKkd..................mvqE..SSFCG..NDYQ.GR.TK.R-...E..-..KSLI..T..Q..QA..DK.....PPTTW.NIFCDFPEISHI.........VI.T..........G..........S..T................VCVN.....RQDNSFM..........D.VC...........L....GSS.LEAQSFVSLLDGYFRLTADAHH..................
A0A669BYD1_ORENI/241-328               ...............................................slvrvtgekgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..DL.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4U5V9W5_COLLU/295-375               .........................................................wsk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..EE.....GEEEL.QTYCDFPEMIDI.........SI.K..........Q..........S..Nkegs.......aesriVTLT.....KQDNQIL..........E.LE...........F....DLL.SEALSFVSLVDGYYRLVADAHH..................
H2V1W4_TAKRU/292-370                   .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QSFCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNV..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
H0X195_OTOGA/273-357                   ................................................vagdsgiawsqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EDQVF.QPFCDFPEIIDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSRH..................
JAK1_HUMAN/284-421                     ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
#=GR JAK1_HUMAN/284-421          SS    ............................................................EEEEEEEEEEECTTE.EEE.EE...E.--...---EEEEEEEEETTTEEEEEE----.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.EEEE-GGGEEEE.........EE.E..........T..........T..E................EEEE.....ETTS-EE..........E.EE...........-....SSH.HHHHHHHHHHHHHHHHHT-TT-..................
A0A5F9CC30_RABIT/286-339               ............................................................QADGEPCYIRDHRPA.PAD.PG...P.EA...APGPPTHEVLVTGTGGIQWRPVLAE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vragrl............
A0A3Q4I087_NEOBR/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....LEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A2K5WAG8_MACFA/290-427               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672IVH9_SALFA/222-324               .................................ytetfpvkepssgqvilhvaadtgiqw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CR..EK.....MKDSD.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A3Q2VC30_HAPBU/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A096LUR2_POEFO/279-411               ...................................................kelsnggyy---------NQSQL-.QTK.CQ...N.QN...LEASSDMQVLVIGTTGISWRQKPAA.......................-..NQCYD..RNLS.GN.K-.-Q...D..-..-EKQ..K..N..RN..KE.....TDDGW.VVFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A3B5KB22_TAKRU/292-370               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QSFCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNV..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W2GNE8_BOBOX/284-421               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHI.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A1D2NKP5_ORCCI/212-304               .............................hamtfkqdeypatvrvdayhsehpgvsmtyi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GKANW.EHLCTIEDLCFV.........SM.R..........E.........dC..T................AEIS.....RKNGIPI..........C.FK...........F....KSL.EQVHSFVSLLDGYYRLT-----ekw...............
A0A2K6P3C9_RHIRO/240-322               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A5F8HLF7_MONDO/307-339               ........................................................genr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.VE...........F....PTL.REALSFVSLVDGYYRLTTDAHH..................
A0A093H4Q9_STRCA/284-421               ............................................................EIFETSSLLISSENE.INR.LN...C.GD...NEILPQYEVIITGNNGIQWRLKPNS.......................-..AQTER..EKHK.MK.RK.KS...D..G..KNKK..E..E..EK..HK.....IRDSW.NNFSYFPEITHI.........VI.K..........D..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
T0M5G5_CAMFR/286-430                   ............................................................QAEGEPCYIQDGGQA.SLD.PE...-.-S...APGPPTHEVLVSGTDGIQWRLIQAEgpcg..............gadgdS..SRNPR..AGPS.GK.KA.KV...Q..-..EEGN..Q..P..AD..RP.....REAPW.AYFCDFQDITHM.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A2K5XZM0_MANLE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
H0X486_OTOGA/284-421                   ............................................................EIFETSVLLISSENE.MSR.LH...S.ND...GGNIVYYEVMVTGNLGIQWRVKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..D..EK..NK.....IREEW.TNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A670K7C6_PODMU/256-343               ..........................................epgrdinadsssycnifs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
A0A4W3JVE5_CALMI/287-359               .....................................................enifdlq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A667ZU67_9TELE/282-409               .................................................lgsellepvsl---------------.---.-T...S.QK...QEMSHDSQVLVTGTTGISWRKKPNV.......................-..-MMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A444U8C5_ACIRT/265-403               ............................................................EIYETSMLQICAENE.KSL.SE...H.FG...GADLPLREVQVAGNVGIQWRFKPLN.......................T..VTIAK..EKNK.SR.KN.KM...E..S..RNKK..D..K..NK..DL.....VNEGW.TLFSDFYEITHI.........VI.K..........E..........A..T................VTIY.....KQDNKKM..........E.LE...........L....AFR.DEALSFVALVDGYFRLTVDAHH..................
A0A4W5R1M1_9TELE/229-310               .....................................................qwcrdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A2K6P3E3_RHIRO/247-329               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A674D826_SALTR/282-414               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................-..-VSGS..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........-.--...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
F7BLF9_HORSE/250-387                   ............................................................EIFETSELLISSENE.MNR.FH...L.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KYKK..D..E..EK..NK.....IREEW.NNFSYFPEITHV.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W4HE47_ELEEL/278-365               ..................................................sadqgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..QK..EA.....QPEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A5F9ZH32_HUMAN/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A665WVP5_ECHNA/285-372               .........................................rekikdsdqirtfvllldq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---AL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W5QQQ5_9TELE/154-229               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-KDSE.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
H3B0L6_LATCH/290-364                   ........................................................frec---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EDW.QPFCDFPEIIDI.........SI.K..........Q..........A..Shdnvp......vesriVTVV.....KHDNEIL..........E.AE...........F....PTL.KEALSFVSLVDGYYRLTADAHH..................
A0A5F4BSS7_CANLF/185-309               .........................................................gav---GESCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAE.......................-..-----..----.--.VS.RV...H..L..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A2K5YD24_MANLE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A091GZ50_9AVES/294-379               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A673WSS0_SALTR/246-324               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A2K5F006_AOTNA/285-427               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGTPTHEVLVTGTGGIQWWPVQEEgs..................irgS..SRNLQ..ASLS.RK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPW.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A452RVH2_URSAM/283-357               .....................................................pggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A3P4REC0_GULGU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4D9DKB4_9SAUR/286-428               ...........................................................e-GEKVLLYINGGHGQ.LED.GC...A.SS..pRDRPATHEVLVTGTDGIQWRTVPVE.......................S.tESHPH..RGYF.GR.KT.RA...K..E..LDPK..G..A..CQpvER.....SEAKC.VRFCDFQEITHI.........AL.E..........D..........C..K................VSIN.....RQDNKCL..........E.LV...........L....PSY.ETALSLVSLVDGYFRLTADSSH..................
H0V2Z6_CAVPO/278-425                   ......................................................vrhlel-------LCQADREP.PAA.PD...P.AS...SPGPPTHEVLVTGTGGIQWRPVQPEvsrga.............ggsgvG..SWNPK..AGVP.GR.KA.RA...H..R..EAGG..Q..P..AD..RP.....QQPPW.TYFCDFRDVTHV.........VL.K..........E..........S..R................VSVH.....RQDNKCL..........E.MS...........L....PSR.AAALSFAALVDGYFRLTADSSH..................
A0A2I3MPX7_PAPAN/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A4W6ELH9_LATCA/303-373               ........................................................fsel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A665UQR4_ECHNA/283-413               ....................................................epislsvt--------------Q.EGE.SQ...I.QN...IEKSRDVQVLVTGTTGISWRKKPSV.......................-..SLVSK..EKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A401RTD8_CHIPU/279-353               .........................................................gle---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QDEW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srdyil......eesriVTVT.....KQDNELL..........E.AE...........F....PTL.REALSFVALIDGYYRLTADPHH..................
A0A4X2M7I5_VOMUR/267-414               ............................................................EAERDLCYVNSSEQG.PTV.PP...G.ATlslADQAPTHEVLVMGTSGIHWRLLQVEdpd.................ldlN..HPRSS..FGKK.SK.AR.EA...E..S..RKLS..Q..L..PT..ER.....KESPW.IYFCDFQDITHV.........VV.K..........E..........N..N................VSIH.....RQDNKCL..........E.LT...........L....PSP.MVALSLVSLVDGYFRLTADSSH..................
A0A2I4AUZ4_9TELE/294-373               ...................................................ykgrwrkgd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-KEDL.QLFCDFPEVIDI.........SI.K..........Qgnkd.gplesR..I................VSVT.....RQDSSTL..........E.VV...........F....HSV.AEALSFVSLVDGYYRLVADAHH..................
A0A5F4C2M3_CANLF/202-314               .....................................grggvllhpgqragpsrsprgds---------------.---.--...-.--...-------------------------.......................S..SRNRH..ADPF.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A3Q1JI88_ANATE/282-419               ....................................................dgdgsssy--------SNTTHA-.-QG.DS...K.DS...FRDPATHEIMVSGTKGIQWRKLSSQ.......................K.aQANTY..FRND.YM.NY.ME...K..T..KQQS..N..Q..RN..AD.....SPNKW.TSFCYFPEITHI.........AI.T..........G..........T..N................VCIS.....TQDNHCM..........V.VE...........M....LSS.QEARSFVSLLDGYYRLTADAHH..................
A0A672JE22_SALFA/242-322               ......................................................wstgke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..PG.....EEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
F6V3I2_MONDO/286-433                   ............................................................EAERELCYVNSSGQT.PAG.PA...G.STfslDAQVPTHEVLVMGTNGIRWRLLQEKvse.................leiN..RPKSS..FGKK.SK.AQ.KA...E..N..QKLS..Q..L..PT..EK.....KDPSW.TYFCDFQEITHV.........VV.K..........E..........S..N................VSIH.....RQDNKCL..........E.LT...........L....PSP.IVALSLVSLIDGYFRLTADSSH..................
H2PZ66_PANTR/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W3JI38_CALMI/242-324               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A673WDI7_SALTR/222-300               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A2Y9IE55_NEOSC/286-429               ...........................................................q-AVGEPYYIQDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIQAEgpr.................gdgS..SRNPR..AGPF.GK.KT.KA...P..-..EVGG..Q..P..AD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........C..H................VSIR.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A1S3GKJ0_DIPOR/132-273               .......................................pseraeqgvqlldsasfeylf---------------.---.--...-.--...------EQVQVTGTGGIQWRPVQAEglgsqd...........skggngG..SRNPQ..ARPS.RK.KG.KA...H..-..PAGQ..Q..V..VG..RP.....WESPW.TYFCDFQDISHV.........VL.T..........D..........S..R................VSIR.....RQDNQCL..........E.FS...........L....LSR.ASALSFVALVDGYFRLTADSSH..................
A0A3Q7SHZ4_VULVU/286-427               ...........................................................q-AVGKSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gngS..SKNRH..ADPF.GK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A060W8K3_ONCMY/350-485               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQQK..-..D..KK..SD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
H3ABD2_LATCH/295-377                   ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..E..SE..SL.....SDQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Nkdss.......tesriVTIN.....KQDSGIL..........E.VE...........F....PSL.REAQSFVSLIDGYYRLTVDAHH..................
B1ASP2_MOUSE/284-421                   ............................................................EIFETSMLLISSENE.LSR.CH...S.N-...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E.yN..KHKK..D..D..ER..NK.....LREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSR.EEALSFVSLVDGYFRLTADAHH..................
A0A5K1UN95_CALJA/284-421               ............................................................EIFETSMLRISSENE.MNW.FY...S.ND...SGNVQYYEVMVTGNLGIQWRQKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....VREEW.SSFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6I8QTW1_XENTR/214-345               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................-..-----..SVYR.GN.KV.TS...E..-..KYKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
A0A3P9NKF3_POERE/279-409               ..............................................gdesisysinesdg---------------.---.DS...K.KG...FRAPFTHEIMVSGTKGIQFRTLKTQ.......................-..---KA..EENS.YH.RG.SY...V..N..EKTP..K..Q..AT..SN.....PPDKW.TFFCDFREIIHI.........AI.T..........E..........A..N................VCIS.....TQNSRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A6Q2YW87_ESOLU/234-307               .....................................................skgnsgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A673YV50_SALTR/107-233               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVM.......................-..---PS..VGCS.VR.NR.KS...V..-..KQSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........-.--...........-....-VR.APALSFVSLLDGYFRLTADAHH..................
A0A4W3JCH4_CALMI/272-410               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRPV--.......................-..-VNNK..EKVK.SK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........E.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
E9QJS1_MOUSE/311-454                   ..........................................................qp--ERDPCYIQNSGQT.AGD.PG...P.EL...PSGPPTHEVLVTGTGGIQWHPLQTQese.................rgnS..RGNPH..GSRS.GK.KP.KA...P..-..KAGE..H..L..TE..SP.....QEPPW.TYFCDFQDISHV.........VL.K..........E..........R..R................VHIH.....LQDNKCL..........L.LC...........L....CSQ.AEALSFVALVDGYFRLTADSSH..................
A0A3N0YU55_ANAGA/281-408               ........................................................dgdg----SESYLIASRTQ.TP-.-S...E.ET...VNCEPTHEIRVSGSTGIWWRKLSAQ.......................-..KVNDY..IHNK.SR.E-.--...-..-..---T..Q..S..RD..EQ.....EMDNW.KTFCDFPEISLI.........AI.Q..........G..........V..N................VCIS.....RQDNMSM..........D.MH...........L....GSS.LQARCLVSLLDGYFRLTTDAHH..................
A0A673YV75_SALTR/285-422               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQk....................pqA..NNYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A6Q2YTL8_ESOLU/260-348               ...........................................lrvsgesgiqisgclrp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EEEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A671UNH9_SPAAU/288-364               ......................................................scppdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ALW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A6Q2X8L3_ESOLU/283-412               ...........................................evcsttvpiiegeiegt---------------.---.PL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................-..-----..-KKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A3Q7R5E6_VULVU/189-330               ...........................................................q-AVGKSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gngS..SKNRH..ADPF.GK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A5J5CSC9_9PERO/253-389               .................................................gdgsssysntt--------------H.AQG.AS...K.DD...FSLPATHEIMVSGTKGIQWRKVSGQ.......................K.aQANTY..LRND.YM.NY.MK...K..T..KQQS..S..Q..PN..AD.....TPNKW.TSFCDFPEITHI.........AI.T..........G..........D..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QQARSFISLLDGYNRLTAFAHH..................
A0A1S3PI02_SALSA/295-373               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A3P4P1S6_GULGU/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5RTM0_9TELE/293-428               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..K..-K..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A2K5NH39_CERAT/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
E2RPW6_CANLF/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K6P919_RHIRO/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..VD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A672J939_SALFA/173-304               ...........................................cslgselfepvsfsvnq---------------.---.--...-.-N...VETSHDMQVLVAGTSGISWRSKPSV.......................-..VSKTV..KKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A673BZQ3_9TELE/282-420               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K..VCQNK.tAVIS.CC.IL.PL...I..T..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM.........vR.VL...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A5F8ATC5_MACMU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
W5PK80_SHEEP/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHI.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A674DY64_SALTR/281-384               .....................................ysthnalcnrvcrhtlrkkiapg---------------.---.--...-.--...-------------------------.......................-..-----..--QR.QN.QH.KT...N..I..NWTN..K..P..P-..QG.....VSNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........-.VD...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A2K6JTR0_RHIBE/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKSK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6I8S5L3_XENTR/283-359               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KP.....KERES.LTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A5F9ZI01_HUMAN/284-345               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...GGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.K-...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------..................
G1KHZ7_ANOCA/289-431                   ............................................................EGEKLPLYINGGHTH.LEN.SH...T.SP..pSDKPATHEVLVTGTDGIQWRPISPE.......................R.lQSYHH..RGYL.SR.KV.KI...K..D..YKSK..G..P..NQsaEH.....HDPKW.VHFCDFQEITHI.........VV.K..........D..........C..K................VSIH.....RQDNKCL..........E.LA...........L....FSH.DVALSLVSLVDGYFRLTADSSH..................
A0A672ZKC6_9TELE/281-351               ........................................................stgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A384A4L9_BALAS/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.KEALSFVSLIDGYYRLTADAHH..................
A0A672ITZ4_SALFA/282-415               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQk....................aqD..NPYLR..NDYL.NY.TK.KT...K..-..QQQA..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........-.VR...........L....VVV.SEARSFISLLDGYYRLTADAHH..................
A0A4W5PRP9_9TELE/322-394               ........................................................kitv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..K..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A4W5QDZ7_9TELE/291-369               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W3JJ69_CALMI/287-405               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................-..-----..VKDV.SR.K-.--...-..-..---L..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A0P7UXN8_SCLFO/280-413               ............................................................EVYETSMLQFTSENE.KSH.VT...A.FH...ENDPPVFEVQVSGNNGISWRKKPDP.......................T..LPFPK..DKNK.SK.KN.KV...Y..-..---G..K..N..KN..EK.....KKDSW.ILFSDFHEIIHI.........AI.R..........D..........S..T................VTIN.....KQD-KKM..........E.MQ...........L....AFP.AEALSFAALVDGYFRLTVDAHH..................
W5LAY4_ASTMX/259-335                   ......................................................kgketd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-GQDL.QVYCDFPDVIDI.........SI.K..........Q..........A..Srdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....QSL.VEALSFVSLIDGYYRLTADAHH..................
A0A484H2J8_SOUCH/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....MSL.REALSFVSLIDGYYRLTADAHH..................
A0A671VY17_SPAAU/285-415               ..................................................dpillsvqeg---------------.--E.SQ...S.QN...METSHDMQVRVTGTTGISWRKKPPT.......................A..NVICK..EKGK.SK.KN.KQ...D..G..KQKN..D..K..NK..-E.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A4W6BU27_LATCA/302-415               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................-..-----..----.--.K-.--...-..-..---S..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A2K6T829_SAIBB/262-409               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvskek.............gsirgS..GRNLQ..ASLS.GK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPR.VYFCDFRDITHV.........VL.K..........E..........C..R................VGIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A3P9NSD5_POERE/130-233               ................................etfrvnrssshteatftllrvcgetgiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-T..GQ.....LDGEW.QTFCDFHEIVDI.........SI.KrilnemvpqdS..........R..M................VTIT.....RKDDRCL..........E.AS...........F....QSR.KEALSFMSLIDGYFRLITDSSH..................
A0A6I8RHG1_XENTR/210-286               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A151P6W0_ALLMI/54-130                ....................................................wshsgdet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QPFCDFPEIADI.........SI.KqasrdsqpveN..........R..V................VTIT.....KTDNRIL..........E.VE...........F....PSL.REALSFVSLLDGYYRLTADAHH..................
A0A6I8SBZ3_XENTR/212-343               .........................................etlqsafysecfevrepsr---------------.---.--...-.DN...SGGENFATIVVTGNSGIQFSKGKPK.......................-..-----..----.ER.E-.--...-..S..LADM..V..S..TD..LN.....LLRDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
I3M210_ICTTR/299-443                   ............................................................QAEGEPCYIQDSRRA.SAD.HN...L.EP...ALGSPTHEVLVTGTGGIQWRPVQVEvss................dvndS..SRNSQ..THLS.GK.KA.KA...R..-..EAGG..Q..P..AN..RP.....REPPW.TYFCDFQDITHL.........VL.K..........G..........C..R................VTIY.....QQDNKCL..........E.LR...........L....PSR.AAALSFVALVDGYFRLTADSSH..................
A0A287ASU9_PIG/285-431                 ............................................................QAEGEPCYIRDGGQS.SPD.PE...P.QA...APEPTTHEVLVSGTDGIQWRLVQAEgpsgg.............agdgsS..SRIPH..TGHS.GK.KA.KA...Q..-..ERGN..Q..P..VD..RP.....GEALW.TYFCNFQDITHV.........VL.K..........E..........R..H................VSIH.....CQD-KCL..........E.LT...........L....PSR.ATALSLVALVDGYFRLTADSSH..................
A0A3P8SFP8_AMPPE/282-385               .....................................rfqvtnlssqevtivvmgnkgiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-RSK..G..K..ED..KG.....AEEEL.ETYCDFPAVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....RQDNHIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A452HKY4_9SAUR/297-439               ...........................................................e-GEKVLLYVNGGHTQ.LED.GC...A.SS..pRDRSTTHEVLVTGTDGIQWRTVPVE.......................S.aESLPH..RGYF.GR.KT.RA...K..E..LDLK..G..P..CRpvER.....NEAKW.VRFCDFQEITHI.........AL.E..........D..........C..K................VSIN.....RQDNKCL..........E.LV...........L....PSY.ETALSLVSLVDGYFRLTADSSH..................
A0A6Q2YP72_ESOLU/184-257               .....................................................skgnsgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A060X1Z7_ONCMY/279-415               .......................................................dgsgs-------YLNTSHAH.GA-.SD...P.GN...FGPQVMHEVMVSGTKGIQWRKITVQ.......................K.aQANSYfgNDYL.GN.RK.TV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSI.LEALSFVSLLDGYFRLTADAHH..................
A0A6Q2XZE1_ESOLU/196-283               ..................................................titvtaehgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..W..CR..EQ.....QKDSE.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A093GHG5_DRYPU/284-417               ............................................................EIFETSFLRISSENE.ING.FS...C.GD...SESLPLYEVIVTGNNGIQWRLKPSS.......................-..----V..QAEK.EK.KK.KS...D..G..KTKK..E..E..EK..HK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........C..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLVDGYFRLTADAHH..................
A0A2U3ZSA9_ODORO/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5WAH4_MACFA/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6J3R6N7_TURTR/398-428               ..........................................................qe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A667XVH4_9TELE/279-363               ..................................................adsgiqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..HK.....DSEQL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
U3KDU1_FICAL/283-413                   ............................................................EIFETSFLLISAENE.VNK.LN...S.GD...N---ERYEVMVTGNNGIQWRLKPS-.......................-..---PV..QTEK.EK.KK.KS...D..G..KSKK..E..E..EK..HK.....LRETW.NNFSYFPEITHI.........VI.K..........E..........C..T................VSIN.....KQDNKRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
A0A3Q1B0E3_AMPOC/282-385               .....................................rfqvtnlssqevtivvmgnkgiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-RSK..G..K..QD..KG.....AEEEL.ETYCDFPAVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....RQDNHIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A3Q3C4Z2_HAPBU/283-366               .................................................tagsinnsqvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W6D9P7_LATCA/277-405               ...............................................epvslsvtqegei---------------.---.--...S.QN...METSSDMQVLVTGTTGISWRKKPTS.......................-..-VISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A060WH89_ONCMY/172-249               ........................................................rdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....TEQDL.QTYCDFPDVTDI.........SI.K..........H..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A4W6BYG7_LATCA/295-419               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................-..----K..VCHY.MR.KT.KH...Q..-..---S..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W3JB89_CALMI/280-402               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRLPPAT.......................-..-PNLD..GITQ.SR.K-.-L...N..-..----..-..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A556U5B1_BAGYA/283-364               .........................................................rek---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---Q..K..D..TQ..LE.....VNKDL.QPYCDFLHVIDI.........NI.R..........Q..........A..Skega.......qksrfVSIN.....KQDGKTL..........E.LE...........F....SSL.AEALSFVSLIDGYYRLTTDAHH..................
U3K7L6_FICAL/297-379                   .................................................srgklkdcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A667ZC10_9TELE/251-281               ........................................................tker---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.-E...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A674DYQ8_SALTR/294-404               .......................................yysthnalcnrvcrhtlrkki---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A3P8SS90_AMPPE/301-397               ...................................................ggyfgkntl---------------.---.--...-.--...-------------------------.......................-..-VISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..NK..EA.....-NEGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A643BS30_BALPH/216-298               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.KEALSFVSLIDGYYRLTADAHH..................
W5Q3B2_SHEEP/286-432                   ............................................................QAEGEPCYLRDGGQA.PAD.PG...S.ES...AAGPPTHEVLVSGTKGIRWRLVTAEgpad..............gggggG..STMPD..ADPS.GK.RM.KA...K..-..EAGG..E..P..VD..RP.....RETPW.SYFCDFQDITHM.........VL.K..........E..........C..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
A0A669CJR3_ORENI/281-361               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A3Q2X356_HAPBU/280-414               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSAQ.......................R.aQANNY..MGNG.YI.NY.MR...K..P..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A5J5N876_MUNRE/273-357               ...........................................vaggtgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A1U8DCB6_ALLSI/365-505               ........................................................eddr----TPLYVNGEPPM.PVD.AP...-.PH...GDCLPTHEVLVTGADGIRWRPVPVE.......................V.tESPPH..RGYF.GR.KG.RS...K..E..PGSR..E..P..PTlaEH.....NKPKW.VQFCDFQEITHV.........VL.T..........G..........A..C................VGIH.....RQDNQCL..........E.LV...........L....PSP.EVALSLVSLVDGYFRLTADASH..................
A0A4W4FC22_ELEEL/277-404               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPAE.......................V..RGDTC..----.--.--.-L...D..L..AQNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
JAK1_MOUSE/284-421                     ............................................................EIFETSMLLISSENE.LSR.CH...S.N-...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E.yN..KHKK..D..D..ER..NK.....LREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSR.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5Q760_CEBCA/285-431               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvske..............evsqgS..GRNLQ..ASLS.GK.KA.KA...H..-..EAIA..Q..P..AD..KP.....REPPR.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A667XE84_9TELE/264-365               .......................................epagglqptqcnrqhavclsh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-PQR..K..T..LQ..SS.....SSEEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A6A5DXK3_PERFL/301-437               ...............................................gdgsssysnttha---------------.-QG.AS...K.DD...FIVPATHEMMVSGTKGIQWRKVSGQ.......................K.aQANTY..FRND.YM.NY.MK...K..T..KQQS..S..Q..PN..AD.....TPNKW.TSFCDFPEITHI.........AI.T..........G..........D..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QQARSFISLLDGYNRLTAFAHH..................
A0A672GXG3_SALFA/353-469               .............................................dassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................-..-----..----.-K.R-.--...-..-..QPGS..Q..N..AD..T-.....-PNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A2K6LIE0_RHIBE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPK..ASLS.GK.KA.KA...H..-..KAIG..Q..P..VD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A667ZWJ0_9TELE/298-377               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..DA.....AEEEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A2Y9J6S5_ENHLU/272-357               ...........................................rvagdsgiawssggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLISDSRH..................
A0A674DYK3_SALTR/283-427               .........................................vcskmyysthnalcnrvcr---------------.---.-H...T.LR...KKIPTQYQVLVSGNTGIKWRRKQQN.......................-..----V..KKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM.........vE.FHclnsiaftlhlL....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A3Q2V3W2_HAPBU/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A6I8PGC1_ORNAN/209-346               ............................................................EVFEATLLQISSENE.KNR.SH...F.GD...HGEVLHFEVMVTGNQGIQWRQKCNV.......................-..VPVEK..EKSK.PK.RK.KL...E..S..KTKK..E..E..EK..IK.....LREEW.ISFSYFPEITHI.........VI.K..........E..........A..T................VSIN.....KQDNKRM..........E.LQ...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A1S3MPK9_SALSA/291-366               ......................................................cpadvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A093QCV4_9PASS/283-413               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NE---KYEVMVTGNNGIQWRLKPSS.......................-..----V..QTEK.EK.KK.KS...D..G..KTKK..D..E..EK..HK.....LRESW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFTSLIDGYFRLTADAHH..................
G3H6C9_CRIGR/286-429                   ..........................................................qp--EGDPCYVQNSGQT.TGD.PD...P.EL...ASRVPTHEVLVTGTGGIQWHPLEIQese.................rgsS..RGNLQ..GNRS.GK.TV.KA...P..-..ETGE..Q..L..AK..SP.....GEPPW.TYFCDFQDISHV.........VL.E..........E..........R..C................VRIH.....LQDNKCL..........L.LR...........L....CSR.AEALSFVALVDGYFRLTADSSH..................
M3W7U9_FELCA/408-483                   ....................................................spggheal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
G5BSN6_HETGA/452-583                   ............................................................EIFETSMLRISSENE.MNW.FH...S.SE...GASTLCYEVMVTGNLGIQWRQKPNE.......................-..-----..-KNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....VREEW.SNFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDNKNM..........E.LQ...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A093EPV8_GAVST/284-417               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKP--.......................-..--NSA..QTEK.EK.KK.KS...D..G..KTKK..D..E..EK..HK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A673YG05_SALTR/283-418               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A3B1JD68_ASTMX/207-283               ......................................................kgketd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-GQDL.QVYCDFPDVIDI.........SI.K..........Q..........A..Srdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....QSL.VEALSFVSLIDGYYRLTADAHH..................
A0A341BII3_NEOAA/303-449               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A3P9NS13_POERE/293-373               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEP.QTLCDFHDVTDI.........SI.K..........Qacke.gttesR..L................VTIN.....KQDGKNL..........E.LE...........F....PSL.FEALSFASLVDGYYRLTTDAHH..................
A0A553Q2R1_9TELE/275-359               ....................................................dqgvqwsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..Q..RE..TG.....EKEEL.QAYCDFSEVIDI.........SI.Kqgsk.dgsveN..........R..I................VSIN.....RQDSHTL..........E.LE...........F....DFL.GDALSFVSLIDGYYRLTTDAHH..................
A0A673YVA3_SALTR/284-422               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQk....................pqA..NNYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM.........vR.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A4W3GYM5_CALMI/301-376               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A663FLT2_AQUCH/284-417               ............................................................EIFETSFLLISSENE.INI.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..QK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A060Y9J4_ONCMY/305-376               ........................................................rklq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..VT..VS.....VSNDW.KTFSDFHEITHI.........NI.K..........G..........S..A................VTVH.....KQDNKNM..........E.LG...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A5A9PB32_9TELE/81-156                ........................................................rgte---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ESEEL.QVYCDFSDVIDI.........SI.Kqgtk.dgsveN..........R..I................VSIN.....RQDGQTL..........E.LE...........F....HSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2R9BS87_PANPA/285-432               ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..L..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A1S3WF45_ERIEU/290-420               ..........................................ascclpeagaatpkppep---------------.---.--...P.NS...TSGPPSHEVQVTGLGGIQWRPWQTV.......................-..ISHTT..TAPS.GK.KY.RA...Q..-..----..E..L..PN..RP.....REAPW.TPFCDFPDITHV.........VL.K..........E..........L..H................VSIH.....CQNDKCL..........E.LT...........L....PSR.ATALSLVALVDGYFRLTMDSSH..................
A0A665UR13_ECHNA/288-410               ...............................................slsvtqegevcng---------------.---.--...-.--...-----GYHVLVTGTTGISWRKKPSA.......................V..SLVSK..EKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A2K5KJN0_CERAT/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A3Q3NIL0_9LABR/291-369               ...................................................creklkdtg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEL.PTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKIL..........E.LE...........F....SSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2J8LTH4_PANTR/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A2K5IU17_COLAP/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A674PJB1_TAKRU/317-399               ..................................................ntiddiqiks---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-TSS..L..D..KK..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A6I8QEE3_XENTR/276-407               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEE.......................V..GVVKK..SRVK.GQ.K-.--...-..-..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A673UFI5_SURSU/285-357               .......................................................ghedl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A2U3VU82_ODORO/299-450               ...........................................................q-AVGEPYYIRDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIHAEvsrmptp.........ssgpgdgS..SRNPR..VGPF.GK.KT.KV...P..-..EVGN..Q..P..ED..RP.....QEAPW.AYFCDFKDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A5N4CL97_CAMDR/256-400               ............................................................QAEGEPCYIQDGGQA.SLD.PE...-.-S...APGPPTHEVLVSGTDGIQWRLIQAEgpcg..............gadgdS..SRNPR..AGPS.GK.KA.KV...Q..-..EEGN..Q..P..AD..RP.....REAPW.AYFCDFQDITHM.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A3Q0DNG1_CARSF/285-430               ...........................................................q-AEAGSCCVQDSRQA.PVD.PS...S.KT...AARPLTHEVLVTGTGGIQWRPVWEVrgst...............sssgA..GRNPQ..ADLF.GK.SA.KV...P..-..EAGG..Q..S..VA..RP.....REPPW.TYFCDFRDITHV.........VL.K..........E..........C..R................VGIH.....RQDNKCL..........E.LG...........L....PSR.AAALSFVALVDGYFRLTADSSH..................
A0A667Y8V1_9TELE/295-427               .........................................gsssylstthaigdagdsf---------------.---.--...-.--...-GAPVTHEIMVSGTKGIQWRKVSGQ.......................K..AQENS..YLRP.GD.TD.YM...R..-..KAKQ..Q..PsqSN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........-.-W...........C....FSM.CEARSFISLLDGYFRLTADAHH..................
A0A669CBX6_ORENI/236-348               ...................................................lcngsyygh---------------.---.AQ...S.QN...MEVSRDMQVLVTGTTGISWRKKPFH.......................-..----N..GKLS.SK.QV.KD...-..-..----..-..-..--..--.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A6I8Q069_XENTR/235-311               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
G1TCI4_RABIT/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqega.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2K6P3D0_RHIRO/261-343               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5QXA5_9TELE/295-373               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A673YVF4_SALTR/242-372               ...............................................lrkdggdgsgsyl---------------.---.--...-.--...NTSRVMHEVMVSGTKGIQWRKMTVQkv...................clS..HWMFI..RLFD.WN.RK.SV...K..-..-QSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
L5LTA8_MYODS/286-435                   ............................................................QAEGEPCYIQDSAQA.PGD.PK...S.KS...AVELPTHEVLVTGTGGIQWRPLQAEvlgfqg..........pgggdggG..SRNPH..AGLS.GK.NG.KA...Q..-..QWSG..Q..P..GD..RP.....REAPW.AYFCDFRDITHV.........VL.R..........E..........R..H................VSIH.....CQD-KRL..........E.LT...........L....PSP.AIALSLVSLVDGYFRLTADSNH..................
A0A2K5DBQ1_AOTNA/299-381               ........................................................srgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---H..K..E..SE..TL.....TAQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A673BZQ8_9TELE/282-418               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K..VSNTY..LRNDyMN.YV.RI...T..-..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4U5ULJ4_COLLU/268-361               .............................................nptfslvrvtgetgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--QT..S..A..SH..HP.....DDAQW.QTFCDFKDIIDI.........SI.Krach..eqddG..........R..M................VTIT.....RKDERCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W5MIY4_9TELE/291-369               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W4FBZ9_ELEEL/273-412               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPAEv....................rgD..TCLDL..KRKS.SR.GR.RP...Q..N..QQNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A653DWY0_CALMS/141-209               ......................................................gikycl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..ES.....KKEQW.TLKCTIEELGFI.........SI.R.........nD..........S..T................TEIS.....RKNGIPF..........Y.LK...........F....SSM.STMYSFISLLDGYYRLTC----k.................
A0A4W4GFZ3_ELEEL/148-224               ........................................................iqtr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-A.....DDSQV.TTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A3Q3ELU2_9LABR/303-421               ....................................................gyygyynq-----------SQEQ.---.SP...S.QN...LEASYDTVVRVTGTTGISWKKKTPT.......................-..-ITLS..----.--.--.--...-..-..RVVK..Q..K..KE..AK.....ESECW.EVFCDFHEITHT.........VI.K..........D..........V..T................VTIF.....RQDNKRM..........E.LR...........M....ASR.AEAQAFAALVDGYFRLTVDAHH..................
A0A452HXS2_9SAUR/299-375               ..................................................hspshtlfrq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PFCDFPEIADI.........TI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A4W4H717_ELEEL/195-296               ....................................tecfqvkeasagqvtiivsadqgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..W..CR..ER.....QKEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A384DH94_URSMA/267-309               ................................................qvimvkylatle---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-----QL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A673YF29_SALTR/291-366               ......................................................cpadvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A0Q3QCQ8_AMAAE/285-421               ..........................................ssegekvqxngihpehpl---------------.---.--...-.LP...KEQAVTHEXLITGTSGIQWRAVPVE.......................N.tETCSH..RGYF.GR.KN.RT...K..E..LEPK..G..S..AP..ER.....DDPKW.SHFCDFQEVTHI.........VV.Q..........G..........C..R................VSIH.....RQDNKCL..........D.VV...........L....PCP.GNALSLVSLVDGYFRLTADSSH..................
A0A2U3VU74_ODORO/299-442               ...........................................................q-AVGEPYYIRDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIHAEgpr.................gdgS..SRNPR..VGPF.GK.KT.KV...P..-..EVGN..Q..P..ED..RP.....QEAPW.AYFCDFKDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A2I0TZT4_LIMLA/354-437               ...................................................csrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A093J647_EURHL/284-417               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...GEILPLYEVIVTGNNGIQWRLKP--.......................-..--NPV..QTEK.EK.KK.KS...D..G..KAKR..D..E..EK..LK.....IRDSW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
H2NY19_PONAB/279-356                   .....................................................swtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTLT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A226N5B7_CALSU/340-424               ...................................................qcsrgklkn---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A668A5D5_9TELE/272-399               ............................................epvsltvsqegdlsng---------------.---.--...-.--...-EMSHDSQVLVTGTTGISWRKKPNV.......................-..-MMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A672JTL4_SALFA/253-333               .....................................................tsgsdqp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....EDLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A4W6EJX3_LATCA/284-364               .....................................................qwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
F6RLI3_CALJA/299-381                   ........................................................srgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---H..K..E..SE..TL.....TAQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A0Q3QW93_AMAAE/273-352               ..................................................gvswscsgse---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QHFCDFPDIADI.........SI.KqasgdgaaveN..........R..V................VTLT.....KTDNRVL..........E.VE...........F....PSL.RDARSFVALIDGYYRLTADAHH..................
A0A673YF46_SALTR/280-360               ....................................................sgtdkvki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....CRSEW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A667XYG3_9TELE/287-421               .........................................gsssylstthaigdagdsf---------------.---.--...-.--...-GAPVTHEIMVSGTKGIQWRKVSGQ.......................K..AQENS..YLRP.GD.TD.YM...R..-..KAKQ..Q..PsqSN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A673VD79_SURSU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A553QRE2_9TELE/280-413               ......................................tvepkslkvlgenegspthtip---------------.---.--...-.-L...GDDGQGYEVQVSGTTGISWRRKPAP.......................N..QLIVK..DKPK.SK.KS.TA...D..-..----..N..K..QK..AD.....KKKEW.TLFSDFYEITHI.........VI.K..........E..........S..Y................VTIY.....RQDNKTM..........E.LD...........M....FYR.DAALSFAALVDGYFRLTVDAHH..................
A0A665UP63_ECHNA/301-429               .....................................................gyhgyyn-------------HS.QTE.SQ...I.QN...IEKSRDVQVLVTGTTGISWRKKPSA.......................-..--VSK..MKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A672GXG2_SALFA/300-431               ............................................gdassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKTQDN.......................P..DLRND..CLNY.TK.KT.KR...Q..-..-PGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A673WD29_SALTR/295-374               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A091DWB5_FUKDA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQNL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A665UV06_ECHNA/271-403               ................................................dggssyanttha---------------.-QG.VS...K.DN...FTASITHEIRVSGTQGIQWRKASAQ.......................R..VSQTA..RFLN.DY.--.MS...T..T..EQQP..S..Q..QK..AN.....TPDEL.TTFCDFPEITHI.........AI.S..........G..........A..T................VCIS.....TQDNRCM..........D.VQ...........M....TSS.QEARSFISLLDGYYRLTADAHH..................
A0A2K5IGU5_COLAP/290-427               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKSK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A1U7RXD8_ALLSI/284-421               ............................................................EIFETSSLLISSENE.KNR.FN...F.GE...NENVPQYEVMVTGNNGIQWRLKPNI.......................-..QQTDK..EKHK.LK.RK.KL...D..G..KNKK..D..E..LK..TK.....IQEEW.NNFSYFPEITHV.........VI.K..........E..........S..T................VNIN.....KQDNKRM..........E.LK...........L....SSH.AEALSFASLIDGYFRLTADAHH..................
A0A151N0Y0_ALLMI/287-427               .........................................................edd---RTPLYVNGGPPM.PVD.AP...P.-H...GDCLPTHEVLVTGADGIRWRPVPVE.......................V.tESPPH..RGYF.GR.KG.RS...K..E..PGSR..E..P..PTlaEH.....HKPKW.VQFCDFQEITHV.........VL.T..........G..........A..C................VGIH.....RQDNQCL..........E.LV...........L....PSP.EVALSLVSLVDGYFRLTADASH..................
A0A2K5BXU8_AOTNA/282-357               ......................................................spggqe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EL.QPFCDFPEIVDI.........SI.K..........QaprtgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALLDGYFRLTTDSQH..................
A0A4W5JH01_9TELE/247-385               ...........nefnnktvksnkvnthdikvkylatletltcgfgcevcnknilcssvsq---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A673C2X0_9TELE/290-427               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K.aQANTY.lRNDY.MN.YV.RI...T..-..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A673Y8X8_SALTR/263-396               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITAN.......................-..-SYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........V.RA...........P....ASQlLEALSFVSLLDGYFRLTADAHH..................
F1PIY7_CANLF/245-382                   ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A1S3S4Y6_SALSA/285-422               .......................................................gdgsg------SYLNTSHAR.G-A.SD...P.EN...FDPQVMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHV.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A3Q3XJJ1_MOLML/283-364               ....................................................iqwcaekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDKEL.QTLCDFPDVTYI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNR..........E.LE...........F....PSL.SEALSFVSLVDGYYRLTTDAHH..................
JAK2_HUMAN/299-381                     .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
#=GR JAK2_HUMAN/299-381          SS    .........................................................EES---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..T..T..TS..--.....-GGG-.EEEE-GGGEEEE.........EE.E..........E..........-..-----.......---EEEEEE.....ESSS-EE..........E.EE...........E....SSH.HHHHHHHHHHHHHHHHHT-TT-..................
L5L284_PTEAL/299-357                   ............................................................QAKGKPCYVEDSSQA.PPD.PG...P.ES...APGPPTHEVLVTGTGGIRWRPAPAE.......................V..S----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------marlggvqv.........
A0A087R0W7_APTFO/284-417               ............................................................EIFETSFLLISSENE.INR.IN...C.GD...NEILPLYEVIVTGNNGIQWRLKP--.......................-..--NSA..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIY.....KQDNRRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A4W5PYV7_9TELE/285-422               ......................................................sdgsgs-------YLNTSHAR.G-A.SD...P.EN...FGPQVMHEVMVSGTKGIQWRKITVQk....................aqA..KSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A4W2EXR7_BOBOX/350-434               ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
K7FRH1_PELSI/285-423                   ............................................................EIFETSSLQISTENE.KHG.FN...L.GD...NGIMPQYEVMVTGNNGIQWRRKPNV.......................I..QPERE..KHNK.LK.RK.KM...D..S..KNRK..G..E..EK..NK.....SREEW.NSFSYFPEITLL.........VI.K..........E..........S..T................ININ.....KQNHEKM..........E.IK...........L....SSH.EEALSFASLVDGYFRLTADAH-l.................
A0A3P8XKU1_ESOLU/282-415               .................................................vfepevlrvmd-----------SEGE.IEGtPL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................-..----V..RKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A672V1N8_STRHB/294-379               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W6BYM9_LATCA/297-410               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKVSGQ.......................-..-----..----.--.K-.--...-..-..---S..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
H2TCV2_TAKRU/244-364                   .................................ltelagiqpslgsetfhvdpssphsss---------------.---.--...-.--...-------------------------.......................-..-----..-RSA.VS.LV.RV...T..G..ESGI..Q..T..SE..SC.....DGPVW.QTFCDFKEITDI.........SI.RricrdqvphdS..........R..M................VTMT.....RKDDACL..........D.VE...........F....QSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A4W5QPI2_9TELE/232-307               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EE.....DKEGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A151M8K3_ALLMI/292-374               .......................................................srgkl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..K..D..SE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......sesriVTIH.....KQDSKNM..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2U4BAV6_TURTR/334-416               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....MSL.REALSFVSLIDGYYRLTADAHH..................
A0A671W106_SPAAU/298-393               ....................................................clslkqan---------------.---.--...-.--...-------------------------.......................-..-VICK..EKGK.SK.KN.KQ...D..G..KQKN..D..K..-N..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A452DZ23_CAPHI/273-357               ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFLALVDGYFRLTTDSRH..................
A0A672JB17_SALFA/223-301               .........................................................stg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..EP.....GEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A670KG51_PODMU/259-360               ...........................qawvpaqaatgsawtihvssekgiltshsgakg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----T.HLFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A1S3KKN4_SALSA/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A3Q3WHN4_MOLML/259-370               ..........................................tqegeifnggyygkiskr---------------.---.--...-.--...---------------------RRIK.......................T..PVNSK..EKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A6Q2ZF90_ESOLU/263-366               .............................gsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A2R8P2H7_CALJA/282-357               .....................................................spggqed---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A669D6F4_ORENI/252-386               ..........................................leglvssmgsevfepssl---------------.---.--...-.SN...MEVSRDMQVLVTGTTGISWRKKPAT.......................V..SKNLK..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A670KEC6_PODMU/315-385               ........................................................qgth---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-LFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A1S3LUJ9_SALSA/291-369               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A6I8PJX5_ORNAN/249-386               ............................................................EVFEATLLQISSENE.KNR.SH...F.GD...HGEVLHFEVMVTGNQGIQWRQKCNV.......................-..VPVEK..EKSK.PK.RK.KL...E..S..KTKK..E..E..EK..IK.....LREEW.ISFSYFPEITHI.........VI.K..........E..........A..T................VSIN.....KQDNKRM..........E.LQ...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A0A0AT86_CHAVO/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K6BRZ3_MACNE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2Y9HEH0_NEOSC/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qasqe.gsnesR..V................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTTDAHH..................
A0A4W5JVP2_9TELE/358-389               .........................................................plq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A673WAM3_SALTR/291-370               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A5A9NAP8_9TELE/272-399               .........................................fsvshlyirndgddsephv---------------.--K.IP...E.EP...VNSGSTHEIRVSGSTGIWWKKLTRD.......................-..-----..----.--.-H.YI...A..N..QRND..T..L..VD..EQ.....GVDTW.KSFCDFPAISHI.........AI.T..........G..........V..N................VCIS.....RQDNMLM..........D.VC...........L....GSS.LEAHSLVSLLDGYFRLTADAHH..................
A0A3Q3FP56_KRYMA/294-373               ......................................................ckgnws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EG.....AEEEL.QLFCDFPEVIDI.........SI.K..........Q..........D..Nkdgp.......lesriVSVT.....RQDNSTL..........E.VV...........F....HSV.AEALSFVSLVDGYYRLVADAHH..................
G1T864_RABIT/287-340                   ............................................................QADGEPCYIRDHRPA.PAD.PG...P.EA...APGPPTHEVLVTGTGGIQWRPVLAE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vragrl............
A0A4W5QX41_9TELE/229-310               .....................................................qwcrdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..DS.....EQQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A553Q2S4_9TELE/275-359               ....................................................dqgvqwsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..Q..RE..TG.....EKEEL.QAYCDFSEVIDI.........SI.Kqgsk.dgsveN..........R..I................VSIN.....RQDSHTL..........E.LE...........F....DFL.GDALSFVSLIDGYYRLTTDAHH..................
A0A4W3HIY3_CALMI/270-345               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A3Q1EEQ9_9TELE/294-429               ..................................................qegelcngyy------------NQS.QEQ.GH...T.QN...METSHDMQVLVTGTTGISWRKKPAT.......................T..PVISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..N-..KV.....ARDGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A4W4GFV2_ELEEL/279-362               ...................................................rvtgeggiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-T..RA.....DDSQW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A673YFH5_SALTR/292-427               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A4Z2F267_9TELE/286-417               ..................................................nggyygfsnq---------------.-SQ.EQ...S.LN...MKTSHDMHVLVTGTTGISWRKKPAT.......................S..PGIGK..EKGK.SK.KN.KL...D..G..RQKN..-..A..KK..VD.....VNEGW.VAFCDFHEITHT.........AI.K..........E..........A..T................VTIS.....RQDNKRM..........E.LH...........M....ASR.GEALSFAALVDGYFRLTVDAHH..................
A0A091P2W8_APAVI/299-380               ...................................................rgklkdcet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-L.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A1S3G4P2_DIPOR/277-354               ..................................................sgiawsagea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EDF.QPFCDFPEVVDI.........SV.K..........Qapg...agehR..L................VTLT.....RTDKQML..........E.AE...........F....PGL.PEALSFVALVDGYFRLTCDPHH..................
S7MWR8_MYOBR/299-436                   ............................................................EIFETSMLLISSENE.MNW.LN...P.ND...NGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2I3LH42_PAPAN/98-235                ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2Y9LFZ4_ENHLU/299-445               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEvsrg..............prgdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A667ZY75_9TELE/265-342               .........................................................qws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-K..GK.....EGDEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
F6YLX1_MACMU/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A455BLI6_PHYMC/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriITIH.....KQDGKSL..........E.IE...........L....RSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W6BTH0_LATCA/294-423               ......................................................ggssys-----------STTH.AQG.VS...K.DN...FTAPTTHEIMVSGTKGIQWRKAQAN.......................S..YLRND..YMSY.MR.KT.KH...-..-..--QS..N..Q..PN..GN.....TPDEW.TVFCDFPEITHI.........AI.S..........G..........A..N................VCIS.....TLDNHCM..........E.AQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
H2TCV4_TAKRU/216-336                   .................................ltelagiqpslgsetfhvdpssphsss---------------.---.--...-.--...-------------------------.......................-..-----..-RSA.VS.LV.RV...T..G..ESGI..Q..T..SE..SC.....DGPVW.QTFCDFKEITDI.........SI.RricrdqvphdS..........R..M................VTMT.....RKDDACL..........D.VE...........F....QSL.KEALSFVSLVDGYFRLTTDSTH..................
T1I9L6_RHOPR/233-300                   ......................................................qyiyrg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-KKEW.HHLCSFEDLCCI.........SL.H..........K..........DegT................AEIS.....RRTGIPL..........Y.IT...........F....ASN.NSMVSFVTLVDGYYRLSV----kw................
M3XFX5_FELCA/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qgnqe.gsnesR..I................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A5N5PXD8_PANHP/279-416               ............................................tvepkslrvcgegevs---------------.-PT.HT...P.SM...GDEGQGYEVQVCGTTGISWRKKLQQ.......................N..ALTLK..DRSK.SR.KT.KT...D..-..YKQN..N..D..KT..ND.....ASNGW.ILFSDFYEITHI.........VT.K..........E..........A..G................ITIY.....RQDNKTM..........E.LQ...........L....GYR.EEALAFAALVDGYFRLTVDAHH..................
A0A2I4BPV4_9TELE/289-423               ..................................................vfqeeelcng-----------YYNQ.SQE.QN..qN.QN...LETSKNMQVVINGVTGISWRKAPNP.......................E..SPILK..DKGK.SK.RD.--...-..-..GKQK..N..D..RN..KE.....ENEKW.VQFCDFHEITHT.........VI.K..........E..........S..V................VTIK.....RQDNKKM..........I.LN...........M....QSS.EKALSFVALIDGYFRLSVDAHH..................
A0A3M0IYK1_HIRRU/286-420               ..............................................ekgqpcasgsraep---------------.--E.VP...P.IA...GDCPVTHHVLVTGAGGIQWRPVSGE.......................S.tENFSH..RGYF.GR.KS.RN...K..-..-ELE..A..Q..AV..EQ.....SEPPW.CRFCDFREITHV.........VV.K..........D..........C..R................IIIH.....RQDNKCL..........D.VL...........L....PCP.RSALALVSLVDGYFRLTADSSH..................
A0A2U4BAY9_TURTR/119-201               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....MSL.REALSFVSLIDGYYRLTADAHH..................
A0A673YH76_SALTR/284-316               ........................................................kyln---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A4W3J886_CALMI/288-418               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................K.pVTMKK..CGWR.GR.--.-E...D..V..SRKL..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
G1R1P8_NOMLE/209-288                   ................................................trkrirrtvrvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A5N4B7D4_PHOPY/234-299               ........................................................ycld---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....EREKW.EHICGIDELCHI.........SV.R.........rD..........G..T................VEIS.....RKNGIPF..........Y.LN...........F....HSL.LHMFSFVSLLDGYYRLS-----ck................
A0A672Z5C1_9TELE/295-431               ..................................................elcngfgyyn-----------QAQG.QNQ.SQ...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A2I0MC95_COLLI/284-417               ............................................................EIFETSFLLITSENE.ING.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKPSS.......................-..----V..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IQDLW.NNFSYFPEITHI.........VI.K..........E..........S..R................VSIN.....KQDNKRM..........E.LK...........L....SSH.AEALSFASLIDGYFRLTADAHH..................
A0A0D9R4G8_CHLSB/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWRPVQEEvnkee.............gssggS..SRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
F6X8E5_ORNAN/287-363                   ....................................................wnssgneg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----S.QHFCDFPEITDI.........SI.K..........Q..........V..Srdgnp......retrlVTLT.....RTDNRTL..........E.VE...........F....PTL.REALSFISLIDGYYRLTADAHH..................
A0A3Q1AVJ6_AMPOC/282-419               ...................................................dadgsssys---------NTTYAQ.G--.AS...K.DN...FQAPATHEIMVSGTKGIQWREVSAH.......................R..AQANT.yLRND.YM.NY.MK...K..A..KQQP..S..Q..PN..AN.....TLNKW.TFFCDFPEITHI.........AI.T..........E..........A..N................VCIS.....TQDNQYM..........E.VQ...........M....NSS.QEAHSFISLLDGFYRLTADAHH..................
A0A673A582_9TELE/258-362               .................................fkvnpssseskssftllrvtgedgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..GS..SD.....PDDEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A384D6N1_URSMA/286-357               .......................................................vqalq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A5C6MY48_9TELE/286-364               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QSFCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNV..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A672IW61_SALFA/281-412               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQ.......................D..NPYLR..NDYL.NY.TK.KT...K..-..QQQA..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W3J8N8_CALMI/272-405               ........................................eiykatsllvcveseavtag---------------.-QY.QP...V.EK...EQKEREYEVMVTGGAGIKWRRVTNE.......................-..-----..--VR.GK.KG.KS...G..G..KSVR..S..P..DT..KS.....SSETW.TIFSDFFEITHI.........VI.K..........D..........C..I................VSIN.....KQDNRKM..........-.VT...........M....ASY.TEALSLVSLIDGYFRLTVDAHH..................
A0A6I8QXJ0_XENTR/231-307               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A341BIN6_NEOAA/303-449               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A4W4EDS4_ELEEL/299-436               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ......................rA..QENSY..LGND.YL.DN.RK...H..R..GQQV..R..Q..QE..MD.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A672IH18_SALFA/290-372               .....................................................giqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A2I4CI67_9TELE/298-377               ......................................................wcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Q..........V..Skega.......gesrlVTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A6G0HW98_LARCR/283-419               ................................................gdgsssysnmth---------------.AQG.VS...K.DT...FRAPTTHEIMVTGTKGIQWREVSSQ.......................K.aQANTY..FRND.PL.NY.MR...K..T..KQQS..S..Q..LS..AN.....TPNKW.TFFCDFPDIIHI.........GI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A452HWJ7_9SAUR/325-400               ......................................................shsgde---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QPFCDFPEIADI.........TI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A484D1S3_PERFV/299-432               ....................................................nggyyghi------------NQS.QGQ.SK...S.EN...METNRDMEVLVTGTTGISWRKKPST.......................T..PVIAK..EKGK.SK.KN.KL...D..G..KQKN..-..N..KK..TE.....ANDSW.VVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LH...........M....ASR.GEALSFAALVDGYFRLTVDAHH..................
A0A643CJ88_BALPH/297-354               ..................................................psdggggggr---------------.---.--...-.--...-------------------------.......................-..-RMPH..AGPS.GK.KA.KA...Q..-..EVGS..Q..P..VD..RP.....QEAPW.AYFCDFQDITHI.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------snlivt............
I3J7Z7_ORENI/252-330                   .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..ED.....RAEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A5G2QGG0_PIG/299-381                 .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A096LWM8_POEFO/258-364               .........................setfrvnrssshaeatftllrvcgetgiqtgqldg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-AVEW.QTFCDFHEIVDI.........SI.KrilnemvpqdS..........R..M................VTIT.....RKDDRCL..........E.AS...........F....QSR.KEALSFMSLIDGYFRLITDSSH..................
A0A673YAB0_SALTR/223-358               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITAQ.......................A..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........V.RA...........P....ASQlLEALSFVSLLDGYFRLTADAHH..................
A0A672ISS2_SALFA/280-393               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKKTKQ.......................-..-----..----.--.-Q.--...-..-..QAGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A673Y9Z1_SALTR/238-376               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQ.......................K..VCLSV..SLDV.YQ.AV.SC...L..CvvKQSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A672JDT5_SALFA/236-314               .........................................................stg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..EP.....GEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A384A4U9_BALAS/119-201               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W3J8A7_CALMI/286-404               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................-..-----..VKDV.SR.K-.--...-..-..---L..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A4W3H2W4_CALMI/288-363               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A673WP02_SALTR/230-311               .......................................................rdghk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..D..SE..QV.....LTQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A6I8S7S7_XENTR/283-418               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................-..--SQK..NYRK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
A0A3Q3KUX2_9TELE/255-362               ...............................seafpadssgshskstlirvtgetgiqts---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..R..R..SH..PD.....DSVEW.QTFCDFHEIIDI.........SI.KrvcqeqaphdS..........R..M................VTIT.....RKDDRCM..........E.AR...........F....HSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A673YSW6_SALTR/284-410               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQ.......................K..VWNR-..--KS.VK.Q-.--...-..-..--SP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A4W5MIG8_9TELE/279-357               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A091QIP2_9GRUI/1-29                  ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
H0ZIA6_TAEGU/283-413                   ............................................................EIFETSFLLISAENE.VNK.FN...C.GD...NE---RYEVMVSGNNGIQWRLKPS-.......................-..---PV..PTEK.EK.KK.KS...D..S..KSKK..V..E..EK..HK.....LREAW.NSFSYFPEITHI.........VI.R..........D..........C..A................VSVN.....KQDNKRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
A0A093F367_TYTAL/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A1L8H2U7_XENLA/287-427               ............................................................EGEKLPFYLNGGYME.HTE.TV...-.-N...REPISTHQVMVSGMDGIQYRVIKEEe.....................tA..EVSTQ..RHYF.SK.KS.WV...K..G..QKAS..K..P..QQitEK.....NETKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....PSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A4W4FAF7_ELEEL/271-391               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPWN.......................L..SV---..----.--.--.--...-..-..-INN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A670K578_PODMU/295-380               .......................................................iqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..D..SE..TL.....AEQEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
M3VXL7_FELCA/284-420                   ............................................................EIFETSMLLISSENE.MNW.FH...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W6CM91_LATCA/239-319               ...................................................tsgschpds---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-ALEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A093CGK4_TAUER/178-311               ............................................................EIFETSFLLISSENE.INR.SN...C.GD...NEILPLYEVIVTGNNGIQWRLKPKS.......................-..----V..QTEK.EK.KK.KS...D..G..KTKK..D..E..EK..HK.....IRDSW.NNFSYFPEITHI.........VI.R..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLVDGYFRLTADAHH..................
A0A556V7T0_BAGYA/283-361               ........................................................tkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-D..AG.....EEEDL.QVYCDFPDVIDI.........SI.K..........Q..........A..Skdgs.......vesriVTIN.....RQDGQTL..........E.LE...........F....SSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A665VNC4_ECHNA/281-356               .......................................................rgkve---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EGEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A6G0IKB7_LARCR/222-333               .......................irfrfkrfiqqfsqgtvqwtahhpvaadsgiqwcrek---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-L..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDCKTL..........E.LE...........F....STL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2Y9GN84_NEOSC/272-357               ...........................................rvagdtgiawspggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SV.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A674DZX2_SALTR/275-413               ....................................................eyepkvlr--------VTDSEGE.IQG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A671VX46_SPAAU/298-429               ..................................................gyfgyynqcq---------------.-GQ.SQ...S.QN...METSHDMQVRVTGTTGISWRKKPPT.......................A..NVICK..EKGK.SK.KN.KQ...D..G..KQKN..D..K..NK..-E.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A494BBB9_MOUSE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDV.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......nesriVTVH.....KQDGKVL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2I0LJ08_COLLI/314-452               .......................................sletssegeraqlgangghep---------------.---.--...-.-P...KEPLVTHELLVTGTSGIQWRPVPAE.......................S.vEGFSQ..RGYF.GG.RS.RS...N..E..AEAK..A..P..AE..QR.....NEAKW.AHFCDFREITHV.........VV.K..........D..........N..R................VSVH.....RQDNKCL..........E.LL...........L....PSA.PLALSLVSLLDGYFRLTADSSH..................
A0A6I8RPN1_XENTR/292-437               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEEvag................sgtdG..RDYTQ..RHYF.SK.KS.RVk.gQ..K..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A4W5K0F1_9TELE/247-385               ...........nefnnktvksnkvnthdikvkylatletltcgfgcevcnknilcssvsq---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A2Y9R049_TRIMA/286-430               ............................................................QAEGEPSYIQDRGQA.PLD.PG...P.ES...VPGPPTHEVLVTGTRGIQWRPVQAEgsg................gsggG..SRNPP..ASPS.GK.KA.QA...Q..-..EADV..Q..P..AG..RP.....KGLPW.ASFCNFQDISHL.........VV.K..........E..........H..R................VSIH.....RQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTVDSSH..................
G1M9G8_AILME/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNLLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A1A6GPP0_NEOLE/215-351               ............................................................EIFETSMLLISSENE.LSR.FH...S.N-...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...D..Y..KHKK..D..E..ER..NK.....LREDW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A665UX81_ECHNA/278-410               ................................................dggssyanttha---------------.-QG.VS...K.DN...FTASITHEIRVSGTQGIQWRKASAQ.......................R..AQA--..NTYL.RN.DY.MS...T..T..EQQP..S..Q..QK..AN.....TPDEL.TTFCDFPEITHI.........AI.S..........G..........A..T................VCIS.....TQDNRCM..........D.VQ...........M....TSS.QEARSFISLLDGYYRLTADAHH..................
A0A4W6C5M5_LATCA/307-386               ........................................................skge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..LE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A665WVV7_ECHNA/313-350               ...................................................svvvshtfq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A670KDY6_PODMU/318-388               ........................................................qgth---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-LFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A4W4EMY2_ELEEL/164-302               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................N..VLNVK..DKSK.SR.KS.KV...D..S..KQKN..E..K..-K..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A096N179_PAPAN/283-420               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3P9AN96_ESOLU/262-385               .................................................tetfpvvhleq---------------.---.--...-.RK...DGGDASYEVTVSGTNGIQWRKIVVQ.......................K..--AKE..NNYF.GN.DY.FG...N..R..KSVK..K..P..AEgvPK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSL..........-.--...........-....-SN.MEARSFVSLLDGYFRLTADAHH..................
A0A452I649_9SAUR/268-383               ................................fevkepcrgeesfatiiitgnggiqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..E..SE..TL.....TEQEL.QTYCDFPDIIDV.........SI.K..........Q..........A..NqegssesrivtsesriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVSLIDGYYRLTADAHH..................
A0A673YFU0_SALTR/277-409               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................-..--VSG..KKTK.SK.KN.KH...E..G..KQKK..-..D..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A341BHA0_NEOAA/303-449               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A4W6C5Q3_LATCA/251-330               ........................................................skge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..LE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A3Q2UXG2_HAPBU/267-311               .........................................................aes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A2Y9L8X3_ENHLU/299-442               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEgpr.................gdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A673A545_9TELE/261-362               ....................................npssseskssftllrvtgedgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..GS..SD.....PDDEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
H3C837_TETNG/179-258                   .................................................vkrnfiyvpdq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EL.QILCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W6EJX8_LATCA/248-326               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A672IV44_SALFA/273-386               .................................................vahlelredgd---------------.---.--...-.-S...SSYPNTARIMVSGPKGIQWRKATAQ.......................-..-----..----.-K.KT.KQ...Q..-..QAGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A3Q7SHZ9_VULVU/299-440               ...........................................................q-AVGKSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAEspr.................gngS..SKNRH..ADPF.GK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A6Q2Z698_ESOLU/280-367               ..................................................titvtaehgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..W..CR..EQ.....QKDSE.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
S5RRC4_SALSA/285-422                   ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQk....................pqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A556TZT5_BAGYA/309-381               ........................................................qisp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..P..SN..DK.....KYDDW.TAFSDFHEITHI.........VT.K..........E..........A..A................VTVY.....RQDNRRM..........E.VH...........F....AGH.EEALAFASLIDGYFRLTVDAHH..................
H9H0M3_MELGA/148-220                   .........................................................gse---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SH.QHFCDFPDIADV.........SI.K..........Q..........A..Srdggp......venriVTLT.....KTDNRVL..........E.VE...........F....PTL.REALSFVALVDGYYRLTADAHH..................
A0A4W4HEZ0_ELEEL/242-329               ..................................................sadqgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..QK..EA.....QPEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A665VJ15_ECHNA/280-362               ....................................................iqtrgsch---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TE.....SSLEW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A674PRY4_TAKRU/285-331               .....................................................vegates---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..V................VTIN.....KQDGKNL..........E.--...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A2K5L3K1_CERAT/260-344               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
M7AIF3_CHEMY/201-305                   ............................fpvrahsasergqegqriihvsgesgifwshs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GDESR.QPFCDFPEIADI.........SI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.QEALSFVSLIDGYYRLTADAHH..................
A0A2U3ZNI2_ODORO/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A1V4KXU7_PATFA/314-450               .......................................ldtssegeraqlganggrspp---------------.---.--...-.--...KEPLVTHELLVTGTSGIQWRPVPAE.......................QslEGFSQ..RGYF.GR.RS.GS...Q..-..-EAE..T..K..AE..QR.....NEAKW.AHFCDFREITHV.........VV.K..........D..........N..R................VSVH.....RQDNKCL..........E.LL...........L....PSA.PVALSLVSLLDGYFRLTADSSH..................
A0A2I0T5J9_LIMLA/105-247               ............................................................EGEKVQLYVNGGHSQ.PEP.GH...P.LL..pKDPPVTHEVLVTGTSGIQWRPVPVE.......................S.vENFSH..RGYF.GR.KS.RN...K..E..LELKgpT..P..PG..ER.....NEVKW.VHFCDFREITHI.........VV.K..........D..........C..R................VSIN.....RQDNKCL..........E.VL...........L....PSP.ESALSLVSLVDGYFRLTADSSH..................
A0A2Y9K4R8_ENHLU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVAIH.....KQDGKNL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A671DXL1_RHIFE/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..IPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..ER..NK.....IREEW.SNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A673WDA3_SALTR/285-368               .................................................crdghkdseqv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-L.....TAQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A4Z2HWR3_9TELE/281-413               ...........................................ngssshsdathcqgasg---------------.---.--...-.DD...VVSPASREILVSGTKGIQWRRVSEQ.......................Q..-AQAN..TYFR.ND.YM.RS...K..-..KQPS..S..Q..PS..AN.....APNEW.TSFCDFPEITHV.........AI.T..........G..........S..N................VCIS.....TLDNHCM..........E.VQ...........M....NSS.QEARSFISLLDGYNRLTAFAHH..................
A0A672H0Y6_SALFA/321-426               .............................................tetfsvahlelredg---------------.---.--...-.--...-------DIMVSGTKGIQWRKAPVQ.......................-..-----..----.-K.R-.--...-..-..QPGS..Q..N..AD..T-.....-PNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A672Z392_9TELE/280-405               .................................................wellepksvsi---------------.---.--...-.--...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A5N5PL17_PANHP/269-400               ...............................................vyeplsvsihend---------------.-EV.PC...S.SA...REDGAQRRVLISGTRGIEWQSVSPE.......................T..CPNL-..QRKK.SK.RN.KS...Q..-..--QG..Q..L..SD..VR.....KEDNW.TTFSDFHEITHI.........VI.K..........E..........A..L................VTVY.....RQDDRRM..........E.VR...........F....AGR.EEALAFTSLIDGYFRLTVDAHH..................
A0A087QSD3_APTFO/298-379               ...................................................srgklkdce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........D.-E...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
M3ZDE9_XIPMA/278-409                   ....................................................dgdenvsy-----------SNNE.SNG.DS...K.KG...FTAPFTHEIMVSGTKGIQWRMLKTQ.......................-..--KAE..ENSY.HR.GS.YV...N..-..QKTP..K..Q..ST..SN.....PPDKW.TFFCDFREIIHI.........AI.T..........E..........A..N................VCIT.....TQKSHCM..........E.VQ...........M....NSS.QEARAFISLLDGYYRLTADAHH..................
A0A673YFN7_SALTR/227-304               ......................................................gshcpa---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DVLW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A4W6DA05_LATCA/288-407               ..............................................pvslsvtqegeian---------------.---.--...-.--...----GGYHVLVTGTTGISWRKKPAA.......................-..----V..KKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A672UUB6_STRHB/257-373               ............................................................EIFETSFLLISSENE.INR.SN...C.GD...NEVLPLYEVIVTGNNGIQWRLKPNV.......................-..-----..----.--.--.--...-..-..----..N..E..EK..HK.....IRDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
A0A670KIG7_PODMU/291-431               ............................................................EGEKVPLYINGGHTH.LEN.FH...S.PP..pSDRLATHEVLVTGTAGIQWRPISAE.......................R.lESHPH..RGYL.GK.KA.RT...K..D..HKQP..Y..Q..PM..ER.....RESKW.VHFCDFQEITHI.........VI.K..........D..........C..R................VSIH.....RQDNKCL..........D.LT...........L....SSY.EAALSLISLVDGYFRLTADSNH..................
A0A6I8P3T8_ORNAN/335-469               ................................................lltpdarsgppa---------------.---.--...-.-P...GDQTATHEVLVTGTGGIAWRPLPAQvs..................gmgR..GPFPG..GGSR.LR.RP.RL...R..A..RRVE..C.wE..PG..VG.....QEAPW.ERFCDFQEITHV.........VL.T..........G..........S..R................VTIH.....QRDNQSL..........E.LA...........L....PTP.AAALSLISLVDGYFRLTTDASH..................
A0A665VN89_ECHNA/313-391               ........................................................rgkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A2I3T122_PANTR/280-357               .....................................................awtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A6Q2XQ37_ESOLU/191-295               ............................pgsqlpqkeatasllrvsgesgiqisgclrpe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EVQEW.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
M7AKN2_CHEMY/607-749                   ...........................................................e-GEKVLLYVNGGHTP.LEG.GC...V.SS..pRDRPATHEVLVTGTDGIQWRTVPVE.......................S.aESHPH..RSYF.GR.KT.RA...K..E..LDPK..GlcQ..PV..ER.....SEAKW.VRFCDFQEITHI.........VL.K..........D..........C..K................VSIN.....RQDNKCL..........E.LV...........L....PSH.ETALSLVSLVDGYFRLTADSSH..................
A0A2R8QJ02_DANRE/286-409               ...................................................dsgsylits------------RT-.--Q.NP...P.EE...TINEPTHEIRVSGSDGIWWRKFSAQ.......................R..SQSDD..YSHS.Q-.--.--...-..-..--NK..E..T..AA..LN.....EEEDW.NIFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IS...........L....DSS.IQARSLVSLLDGYFRLTTDAHH..................
A0A087XMA3_POEFO/279-409               ..............................................gdesisysinesdg---------------.---.DS...K.KG...FRAPFTHEIMVSGTKGIQFRTLKTQ.......................-..--KAE..ENSY.HR.GS.YV...N..-..EKTP..K..Q..ST..SN.....PPDKW.TFFCDFREIIHI.........AI.T..........E..........A..N................VCIS.....TQNSHCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A6I8QAF1_XENTR/298-443               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEEvgvq..............pgsglN..ERLRH..YFSK.KS.RV.KG...Q..K..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A212D239_CEREH/169-254               ...........................................rvaggtgiawspgeqev---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A5A9P5C0_9TELE/259-365               .................................terfkvkkpsaeqvtivvsadngiqlc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--RE..Q..N..KD..TQ.....LEPDL.QTYCDFAEVVDI.........SI.R..........Qacke.gtdtnR..I................VSIN.....RQDGKPL..........E.LE...........F....SSS.MEALSFVSLIDGYYRLTTDALH..................
A0A665WVT6_ECHNA/263-361               ....................................fqvkdscngqviilvaadcgiqwc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..EK.....IKDSD.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A672J907_SALFA/311-405               ..................................................ghirqsftvi---------------.---.--...-.--...-------------------------.......................-..----C..TDNK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A3Q1GXZ2_9TELE/304-400               ...................................................lpyllkqtp---------------.---.--...-.--...-------------------------.......................-..-VISK..EKGK.SK.KN.KQ...D..G..KLKN..D..R..-N..KV.....ARDGW.VLLCDFHEITHV.........VV.R..........E..........A..T................VTIL.....TQDNKKM..........E.MQ...........M....SSR.AQALSFAALVDGYFRLTVDAHH..................
A0A674D7T5_SALTR/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A674DXX0_SALTR/295-399               ................................................tlrkkiapgqrq---------------.---.--...-.--...---------------------NQV-.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A0D9R8Z9_CHLSB/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A673YXS6_SALTR/283-418               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQ.......................-..KVCLS..HWMF.IR.LF.DC...Y..V..KQSP..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A2K6D4H6_MACNE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
G1RCI3_NOMLE/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A401PFC1_SCYTO/297-378               .......................................................kgkck---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..D..HN..FQ.....SDQDL.QPYCDFPEIINV.........SI.K..........Q..........A..Skdgs.......segriVTIN.....RQDNKTL..........E.VE...........F....PSL.KEGFSFVSLIDGYYRLTTDAHH..................
A0A4W5R6Q6_9TELE/158-185               ........................................................tefq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....-TV.TEALSFVSLVDGYFRLTTDSSH..................
A0A6J3R4U3_TURTR/282-357               ....................................................spgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
L5L7Y5_PTEAL/272-357                   ...............................................hvagdsgiawssg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....EQEVF.QPFCDFPEIVDI.........SI.K..........QalrvgtagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTVDSRH..................
A0A674EB82_SALTR/245-385               ................flnefnnktvknnkvnthdikvkylatletltcgfgcevcnkni---------------.---.--...-.--...------------------------Scps.................isqN..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.NTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A337SI69_FELCA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qgnqe.gsnesR..I................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3B1K723_ASTMX/250-383               .....................................................gdgsgsy--------LNASRA-.-HD.PS...Q.EM...LCGQPTHEVMVSGTAGIKWRKISCR.......................-..-RAQE..NSYM.EN.DY.LA...E..-..RREE..G..S..QS..RQ.....EGETL.ESFCDFPEISHI.........AI.M..........G..........A..N................VCIC.....RQDNSTI..........HtIT...........H....HTL.TEARSLVSLLDGYFRLTADAHH..................
G3TF05_LOXAF/258-329                   .......................................................gralq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PFCDFPEIVDI.........SI.K..........QalrvgpagehR..L................VTIT.....RTDNQIL..........E.PE...........S....PGL.PEALPFVALVDGYFRLTTDSRH..................
A0A674NZS1_TAKRU/293-439               ........................................................wvnt------CMVILGYCN.KTS.SQ...D.QK...TQTSRDMQVLVTGTTGISWRKKPDTvmlyn.............iynfqT..SVVSK..DKPK.SK.KS.KV...D..G..KQQS..D..K..K-..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
A0A671UPZ4_SPAAU/288-364               ......................................................efslfr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--LQW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A671FXV6_RHIFE/273-357               ..............................................vaggsgiawspgaq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSQH..................
A0A093GIU2_DRYPU/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K6EKT2_PROCO/285-427               ............................................................QAEVEPCYTLDSGQA.PTD.PS...P.ES...AAGPSTHEVLVAGTSGIQWRPIQPEgs..................sgsI..GRNPH..ASLS.GK.KA.KV...H..-..EAGD..L..P..VD..GP.....REPPW.AYFCDFRDITHV.........VL.K..........E..........S..R................VSIH.....RQDNKCL..........E.FS...........L....PSR.AKALSFVSLVDGYFRLTADSSH..................
A0A226MBH8_CALSU/237-374               .......................................ekgrpysdgghvpaqrgdapl---------------.---.--...-.-A...QDGPVSHEVLVTGTTGIQWRLVPNE.......................S.vEVISH..RGYF.GR.RS.RR...K..-..EPEP..R..A..PP..QP.....TEPPW.VHFCDFREITHI.........VI.R..........D..........R..R................VSVH.....RQDNKCL..........E.VL...........L....PSH.ESALSFVSLLDGYFRLTADSNH..................
A0A2K5VPR0_MACFA/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A452HXW3_9SAUR/288-363               ......................................................shsgde---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QPFCDFPEIADI.........TI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A315VE90_GAMAF/299-434               .....................................................knscnkr-------YCNQSQL-.QTK.CQ...N.QN...LEPSSDMQVLVTGTTGISWRQKPAA.......................V..PVMPK..DKSK.SK.KS.KQ...D..G..--KQ..K..N..RN..KE.....TDDGW.ALFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.ADALSFVALVDGYFRLIVDAHH..................
A0A3P8XGS0_ESOLU/272-402               ...............................................rerlqgeiegtpl---------------.---.--...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................S..AWTAI..EKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A673YFA8_SALTR/283-418               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A673WQT3_SALTR/294-372               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A0G2K636_RAT/276-353                 .........................................................aws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..SK.....DQELF.QTFCDFPEIVDV.........SI.K..........QaprvgpagehR..L................VTIT.....RMDGHIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLICDSRH..................
A0A3M0K6K0_HIRRU/305-435               ............................................................EIFETSFLLISAENE.ISK.FN...C.GD...NE---RYEVMVTGNHGIQWRLKPS-.......................-..---PV..QTEK.EK.KK.KS...D..G..KPRK..E..E..EK..HK.....LREMW.NNFSYFPEITHV.........VI.K..........D..........A..T................VSIN.....KQDNRRM..........E.LK...........L....SSH.AEALSFTSLVDGYFRLTADAHH..................
A0A1S3LTU5_SALSA/113-191               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A093CU52_TAUER/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A1V4J8Q4_PATFA/290-374               ..................................................qcsrgklkdc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A673YFL1_SALTR/277-363               .................................................rvagesgiqfs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-G..KE.....QIREW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A1S3P9N7_SALSA/283-418               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A2K6BRT5_MACNE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A667XE06_9TELE/283-364               ......................................................iqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..RH..KD.....SEQEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
A0A3Q3W8T4_MOLML/249-364               ..........................giepslgsetfqvipssshsklvfslvrvtwetg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-IQT..S..E..SC..HP.....DAAQW.QTFCNFKEIIDI.........SV.KricheqvphdS..........R..M................VTIT.....RNDDRIL..........E.AQ...........F....QSL.KQALSLVSLVDGYFRLTTDSSH..................
A0A673WAY1_SALTR/283-366               .................................................crdghkdseqv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-L.....TAQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A672JCB5_SALFA/280-416               ..........................................gdassshsnaahaqgisk---------------.---.--...-.DY...FGAPATHEIMVSGTKGIQWRKAPVQ.......................K.tQDNPD..LRND.CL.NY.TK...K..T..KRQP..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A2I3SYV7_PANTR/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4D9EHX2_9SAUR/307-445               ............................................................EIFETSSLQILTENE.KHG.FN...F.GD...NGIIPQYEVMVTGNNGIQWRRKPNV.......................V..QPERE..KHNK.LK.RK.KS...D..S..KNKK..D..E..EK..NK.....IREEW.NNFSYFPEITLL.........VI.K..........E..........S..T................ININ.....KQNHEKM..........E.LK...........L....SSH.EEALSFASLVDGYFRLTADAH-l.................
A0A672JE31_SALFA/307-387               ......................................................wstgke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..PG.....EEEEL.KTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..V................VTLT.....RQDNQIL..........E.LE...........F....HSL.SEALSFASLVDGYYRLVADAHH..................
A0A6Q2ZA61_ESOLU/124-202               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
F7CMB7_XENTR/287-415                   ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEE.......................-..--VGK..SRVK.GQ.K-.--...-..-..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A4W5R2Q6_9TELE/223-301               .....................................................sgshcpa---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DVLW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A3M0JPJ6_HIRRU/277-360               ..........................................ihvsgdggvawscggses---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADI.........SI.K..........Q..........A..Asaa.........enrlVTLT.....KADGRAL..........E.VE...........F....PTL.REARSFVALLDGYYRLTADAQH..................
A0A452RVA1_URSAM/283-357               .....................................................pggqeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTSDSRH..................
A0A672IV60_SALFA/258-363               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A091HKF2_BUCRH/298-380               ...................................................srgklknce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..AL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....LSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K5RM58_CEBCA/283-357               .....................................................pggqedl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDV.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A2K5NHQ0_CERAT/290-427               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K6N0P8_RHIBE/259-341               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
M3WBF6_FELCA/286-428                   ...........................................................q-AVGDPCYVQDGGQS.PPE.PG...P.EL...APGPPTHEVLVTGTGGIRWRPVQAEgpg.................gdgC..SRNPC..AGPS.GK.KS.KA...Q..-..EVGN..Q..P..VD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..H................VSIH.....CQD-KCL..........E.LT...........L....PSR.AVALSLVSLVDGYFRLTADSSH..................
A0A6I8RRC8_XENTR/289-410               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEE.......................-..-----..---V.GQ.K-.--...-..-..ALKS..Q..Q..LP..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........-.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A3P8X4V0_CYNSE/319-413               ........................................slsfldynacpgndymnfsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.K-.--...-..A..KRQS..A..Q..AS..VK.....SPNKL.TSFCDFPEITHI.........AV.N..........G..........A..N................VCIS.....TQENQCM..........V.VQ...........M....RSS.QEAHSFISLLDGYYRLTADAHH..................
A0A671XSC4_SPAAU/256-284               .....................................................lyifhll---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.SEALSFVSLVDGYYRLVADAHH..................
A0A673WQA8_SALTR/288-366               .........................................................sqg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KD..IE.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3Q7SBI6_VULVU/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A671UPB8_SPAAU/251-353               ...........................................epslgsetyrvnvsssh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.-S...K..S..AFSL..R..Q..QH..EQ.....NMLHW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W2DG60_BOBOX/284-331               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------..................
A0A3P9Q7L9_POERE/292-393               ..............................................aitqekelsnggyy---------------.---.--...-.--...-------------------------.......................-..-VMPK..DKSK.SK.KS.KQ...D..-..EKQK..N..N..RN..KE.....TEDGW.VVFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A672IDG5_SALFA/277-359               .....................................................giqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A667ZNH8_9TELE/232-306               .....................................................kgkegda---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-AEEL.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........-.--...........V....EYS.VQALSFVSLVDGYYRLVADAHH..................
A0A665WVS3_ECHNA/280-361               ...................................................giqwcreki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQAL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........-.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
A0A4W4FCQ1_ELEEL/275-411               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKNLPN.......................P..WSNLQ..KRKS.SR.GR.RP...Q..N..QQNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A3Q1J6K0_ANATE/303-434               ....................................................gyygyynq--------------G.QGQ.TQ...S.QN...METSKDMQVLVTGTTGICWRKKHVS.......................T..SVIPK..EKGK.SK.KN.KL...D..G..KQKA..D..R..NK..E-.....SNEGW.VVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........D.LQ...........M....TSQ.AQALSFAALVDGYFRLTVDAHH..................
G3HY52_CRIGR/272-408                   ............................................................EIFETSMLLISSENE.LSR.FH...S.N-...DSGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..Y..KHKK..D..E..EK..NK.....LREDW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKNM..........E.LK...........L....SSK.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5QNM6_9TELE/291-366               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EE.....DKEGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
H2R6D4_PANTR/285-432                   ............................................................QAEGEPCYIRDSGVA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVEEEvnkee.............gssgsS..GRNPQ..ASLF.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....REPLW.AYFCDFRDITHV.........VL.K..........E..........H..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A401S5B6_CHIPU/213-295               .........................................................mkg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KY..K..D..TD..SQ.....PDQEL.QPYCDFPDIINV.........SI.K..........Q..........A..Skdgs.......segriVTII.....KQDSKTL..........E.VE...........F....PSL.KEGFSFVSLIDGYYRLTADAHH..................
A0A4W3JI33_CALMI/295-377               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A673YVX1_SALTR/284-418               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTPQ.......................A..NNYFG..NDYL.GN.RK.SV...K..-..QSPL..-..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A2U3Z702_LEPWE/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNRKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A484D098_PERFV/285-365               ...................................................tsgswhpdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-SMEW.QTFCDFKEIIDI.........SI.Krvch.eqvpqD.........sR..V................VTIT.....LKDDRCL..........E.AN...........F....HSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A6G0IR04_LARCR/283-415               ....................................................ggyygyyn-------------QS.QGQ.SQ...S.QN...TETSNDMHVLVTGTTGISWRKKPST.......................T..AMISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..K-..KE.....ADEGW.QVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ACR.AEALSFAALVDGYFRLTVDAHH..................
A0A2K6EQQ8_PROCO/283-358               ........................................................gpge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DQAF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSRH..................
A0A665UXJ5_ECHNA/294-413               ................................................dggssyanttha---------------.-QG.VS...K.DN...FTASITHEIRVSGTQGIQWRKASAQ.......................-..-RVSQ..TQPS.QQ.K-.--...-..-..----..-..-..--..AN.....TPDEL.TTFCDFPEITHI.........AI.S..........G..........A..T................VCIS.....TQDNRCM..........D.VQ...........M....TSS.QEARSFISLLDGYYRLTADAHH..................
A0A674HF29_TAEGU/283-413               ............................................................EIFETSFLLISAENE.VNK.FN...C.GD...NE---RYEVMVSGNNGIQWRLKPS-.......................-..---PV..PTEK.EK.KK.KS...D..S..KSKK..V..E..EK..HK.....LREAW.NSFSYFPEITHI.........VI.R..........D..........C..A................VSIN.....KQDNKRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
A0A6Q2YP12_ESOLU/283-397               ..................................................gdgsnsqahg---------------.--A.SD...S.DN...FVTPASYEVTVSGTNGIQWRKIVVQ.......................-..-----..----.--.KV.RL...S..H..LMSV..T..L..DL..PK.....PADTL.TSFCDFPEISHI.........SI.T..........G..........A..S................VSII.....KQDNFSL..........-.--...........-....-SN.MEARSFVSLLDGYFRLTADAHH..................
A0A674D8C2_SALTR/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A2K5XZN6_MANLE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A672IRM0_SALFA/282-416               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQk....................aqD..NPYLR..NDYL.NY.TK.KT...K..-..QQQA..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A663FJ91_AQUCH/284-417               ............................................................EIFETSFLLISSENE.INI.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..QK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
H3DDQ1_TETNG/171-255                   ....................................................sngiqwcq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..KL..KD.....SDEEL.QILCDFPDVTDI.........SI.K..........Qaske.gatesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A452CH73_BALAS/55-137                .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....RSL.KEALSFVSLIDGYYRLTADAHH..................
A0A452HXA0_9SAUR/288-363               ......................................................shsgde---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QPFCDFPEIADI.........TI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A6Q2Y7B2_ESOLU/298-376               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
JAK3_HUMAN/273-357                     ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A2K6ARR6_MACNE/290-427               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHRK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
F7F934_MONDO/313-354                   ........................................................rths---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................--VH.....TSPSLTS..........E.VE...........F....PTL.REALSFVSLVDGYYRLTTDAHH..................
A0A6Q2YUG5_ESOLU/273-422               ............................................epevlrvmdsegeieg---------------.--T.PL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQNvrvwnl..........sfdgdsyT..CYYFR..NVKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A663DQP8_AQUCH/342-484               ............................................................EGEKVQLYVNGGHSQ.LEH.GQ...A.LL..pKDRPVTHEVLVTGTTGIQWRPMPVE.......................S.iENFSH..RGYF.GR.KS.RN...K..E..LEPK..G..P..TQpaER.....SEPKW.VHFCDFREITHI.........VV.K..........D..........C..R................VSIN.....RQDNKCL..........E.VV...........L....PSP.ESALSLVSLVDGYFRLTADSSH..................
A0A1W4XLI2_AGRPL/234-299               ........................................................icle---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....RKDQW.EQICKIEDLCHI.........SIrK..........D..........G..T................VEIS.....RKNGIPF..........Y.LQ...........F....ALP.-LMYSFVSLLDGYYRLTC----kw................
A0A6I8STR8_XENTR/232-368               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTC.......................-..-TTSE..KDRK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
A0A091N4F9_9PASS/1-70                  .........................................................qdl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A452S2R5_URSAM/286-434               ..........................................................qa--GGEPYYIRDGGQP.PPD.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAEvsrve............plsgdgS..SRNPH..AGPS.GK.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A673YY56_SALTR/266-384               ......................................................gdgsgs-------YLNTSRAH.-GA.SD...P.EN...VGPQVMHEVMVSGTKGIQWRKMTVQ.......................-..-----..----.-K.QS.P-...-..-..----..L..Q..QE..PT.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A672IVF5_SALFA/276-381               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A6I8PMK1_ORNAN/335-469               ................................................lltpdarsgppa---------------.---.--...-.-P...GDQTATHEVLVTGTGGIAWRPLPAQvs..................gmgR..GPFPG..GGSR.LR.RP.RL...R..A..RRVE..C.wE..PG..VG.....QEAPW.ERFCDFQEITHV.........VL.T..........G..........S..R................VTIH.....QRDNQSL..........E.LA...........L....PTP.AAALSLISLVDGYFRLTTDASH..................
H2PS83_PONAB/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W3JB95_CALMI/288-408               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................-..-----..VKDV.SR.K-.--...-..-..---L..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCLv........sE.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A3Q7Y8G7_URSAR/119-201               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A669BRF3_ORENI/280-359               .......................................................wcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A5N4DDS4_CAMDR/339-476               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NSFSYFPEITHI.........VI.K..........E..........S..V................VSVN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q3B343_KRYMA/281-416               ............................................ehsdgsssyanhnggn---------------.---.-S...K.NN...PGAPITHEIMVSGTKGILWKKVYQL.......................A..QPNPY..VRNL.YL.SY.TK...K..P..KQLS..N..K..EN..GN.....ASDNW.TSFCDFPEITLI.........AI.N..........E..........S..N................VRIS.....TQDNHCM..........E.VE...........M....NSS.QEACSFISLLDGYYRLTVDAHH..................
A0A3Q3W3K4_MOLML/264-361               ........................................ssshsklvfslvrvtwetgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..Q..TS..ES.....CHPDW.QTFCNFKEIIDI.........SV.KricheqvphdS..........R..M................VTIT.....RNDDRIL..........E.AQ...........F....QSL.KQALSLVSLVDGYFRLTTDSSH..................
A0A673YFK4_SALTR/287-362               .........................................................sgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....HCPEW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A672JFF5_SALFA/280-412               ..........................................gdassshsnaahaqgisk---------------.---.--...-.DY...FGAPATHEIMVSGTKGIQWRKAPVQ.......................K.tQDNPD..LRND.CL.NY.TK...K..T..KRQP..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........V.RA...........L....---.-EARSFISLLDGYYRLTADAHH..................
A0A383YNH1_BALAS/260-397               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..A................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W4GJ36_ELEEL/268-348               .....................................................eggiqtr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..AD.....DSQEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A3Q2VQ94_HAPBU/283-366               .................................................tagsinnsqvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
M3ZMT4_XIPMA/297-376                   .......................................................skgkg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.EIYCDFPEVIDI.........SI.K..........Qgske.gsaesR..I................VSLT.....RQDSQIL..........E.LE...........F....QLL.SEALSFVSLVDGYYRLVADAHH..................
A0A665VMU9_ECHNA/284-359               .......................................................rgkve---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-EGEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A668A593_9TELE/276-401               ...........................................ltvsqegdlsnggyhgr---------------.---.--...-.--...----HPEEVLVTGTTGISWRKKPNV.......................-..-MMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A226MI72_COLVI/279-355               ....................................................wscggses---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADV.........SI.K..........Q..........A..Srdggp......venriVTIT.....KTDNRVL..........E.VE...........F....PTL.REALSFVALVDGYYRLTADPHH..................
A0A4W6CM45_LATCA/303-338               ....................................................cheqvpqd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.TK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
H3CXH8_TETNG/239-354                   ...........................giqpslgsetfhvdpsssclnsrsavslvqvtg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..EIGI..Q..T..SE..GC.....EGVVW.QTFCDFKEITDI.........SI.KricreqvpndS..........R..M................VTIT.....RKDDACL..........E.VA...........F....QSL.KEALSLVSLVDGYFRLTTDSTH..................
A0A4W5K0G5_9TELE/223-366               ..........................................hflnefnnktvksnkvnt---------------.---.-H...D.IK...VKYLATLETLTCGTHNALRNHVYKNilcs...............svsqN..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........-.VN...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A3L8SPZ8_CHLGU/313-417               ............................................................EIFEPSSLLISAENE.MNK.FN...C.GD...NE---KYEVMVTGNNGIQWRLKPS-.......................-..---PV..PTEK.EK.KK.KS...D..G..KGKK..V..E..EK..HK.....LRETW.NSFSYFPEITHV.........VI.R..........D..........C..T................VSIN.....KQDNKRM..........-.--...........-....---.----------------------vst...............
A0A670KEE7_PODMU/302-375               .....................................................ailqgth---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-LFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A672JQ74_SALFA/259-365               ..............................frvnnsssqskppfslvrvtgetgiqtsgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..DQ..PD.....EDLDW.QTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A673WI02_SALTR/249-321               ......................................................kdieie---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.KTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A2K5JYU7_COLAP/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A091I984_CALAN/283-418               ............................................................EIFETSFLLISSENE.ISR.CN...G.GD...SEVPPVYEVLVTGNNGIQWRLKPTS.......................-..----V..QTEK.EK.KK.KT...D..G..KPRK..D..E.eKQ..KI.....RENSW.NNFSYFPEITHI.........VI.K..........E.........fT..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A4D9E8Q5_9SAUR/459-534               ......................................................shsgde---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QPFCDFPEIADI.........SI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A6I8SWL0_XENTR/228-307               ........................................................skgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..PK..ER.....ESLDL.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKIL..........E.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A3Q3L884_9TELE/286-364               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQEL.QTLCDFPDVTDI.........SV.K..........Qaske.gatesR..V................VTIN.....KQDGKNL..........E.LE...........F....PNL.LEALSFVSLIDGYYRLTTDAHH..................
A0A6J3R654_TURTR/325-471               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtasd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VY..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A5F4DBF0_CANLF/184-317               ..........................................................tl--EQLSCYIRDSGQA.PPE.PE...-.-L...ATGPPTHEVLVTGTGGIQWRPVQAE.......................-..-VSRK..IKIN.RK.KT.KA...G..-..EVGD..Q..P..VD..RP.....QEEPW.VYFCDFQDITHV.........VL.K..........E..........R..H................ISIH.....CQDNKSL..........E.LT...........L....PSR.AMALSWVSLVDGYFRLTADSSH..................
A0A1S3QZS8_SALSA/275-413               ....................................................eyepkvlr--------VTDSEGE.IQG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKNK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A4W6DA83_LATCA/235-338               ..............................................lepvslsvtqegei---------------.---.--...-.--...-------------------------.......................T..SVISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A3P8T0K1_AMPPE/283-363               .....................................................qwyrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDEEL.QTLCDFPDVTDI.........SI.K..........Qvske.gaaesR..M................VTIN.....KQDGKNR..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
L8IT24_9CETA/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A672Z4I4_9TELE/280-405               .................................................wellepksvsi---------------.---.--...-.--...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
W5PZ17_SHEEP/240-324                   ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A3P8WK53_CYNSE/297-375               ....................................................creimkgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DQEL.QALCDFQDVTYI.........NI.Klask.esateS..........R..V................VTIN.....KQDGKNL..........E.LE...........F....ASL.LEALCFVSLVDGYYRLTTDAHH..................
W5M4D5_LEPOC/290-365                   .......................................................rvnni---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEW.QTFCDFPEIIDI.........SI.K..........Q..........A..Rrdhvp......legrvVTVT.....RQDDRCL..........E.AE...........F....QSL.TEALSFISLIDGYFRLTTDSSH..................
M7B3B8_CHEMY/295-433                   ............................................................EIFETSSLQILTENE.KHG.FN...F.GD...NGIIPQYEVMVTGNNGIQWRRKPSV.......................V..QPERE..KHNK.LK.RK.KS...D..S..KNKK..D..E..EK..NK.....IREEW.NNFSYFPEITLL.........VI.K..........E..........S..T................VNIK.....KQNHEKM..........E.LK...........L....SSH.EEALSFASLVDGYFRLTADAH-l.................
A0A2K5L3H2_CERAT/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A3Q3NCK8_9LABR/299-378               ........................................................srgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..AG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......vesrvVTLT.....NQHNKIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A4W4FCG3_ELEEL/268-393               ..........................................evfdssslniheddepsl---------------.---.--...C.SG...GEDRARYLVLVSGVCGIKWRKVPAE.......................V..RGD--..----.--.--.-T...C..L..DLNN..D..S..LV..AT.....KESGW.TTFSDFHELTHV.........VI.R..........K..........C..L................VTVY.....RQDNKRM..........E.LQ...........L....GNH.GEALSFVSIIDGYFRLTVDAHH..................
A0A452EDI9_CAPHI/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHI.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671XZ75_SPAAU/280-363               ...............................................lyserfqevrnga---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-AGEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......mesrvVTLT.....RQDNKIL..........E.LE...........F....HLL.SEALSFVSLVDGYYRLVADAHH..................
R0LK59_ANAPL/258-384                   afysevfevkepggdpsgeesfativitgnggiqcsrgklkdcetlaxrpwqsryllwdl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W3GXG1_CALMI/1-70                  ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---QW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A2Y9M4G7_DELLE/282-357               ....................................................spgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprfgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSGH..................
A0A672IVB5_SALFA/108-242               ...........................................sssypntaraqgvskdy---------------.---.--...-.--...FGAPATHEIMVSGPKGIQWRKATAQk....................aqD..NPYLR..NDYL.NY.TK.KT...K..-..QQQA..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VHIS.....TLDNRCM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A2Y9ITG3_ENHLU/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLIDGYFRLTADAHH..................
A0A1L8GLW3_XENLA/270-406               ............................................................EIFETNSLVIKSENE.QNG.FN...I.SD...YDNMLHYEVLVAGNSGIHWRRKPTC.......................-..-TASE..KDRK.LK.RK.KT...E..S..KSKN..S..V..EK..GK.....TKDEW.NCFSYFPEITHI.........VI.K..........E..........D..T................VIIN.....NQDNKSM..........D.LK...........L....SSP.EEALSFAALIDGYFRLTADAHH..................
A0A2R8ZHT5_PANPA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W4GEQ0_ELEEL/227-303               ........................................................qtra---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....DSQEW.QTFCDFPQITDV.........NM.Krv......cqEhl.....aegR..V................VTLT.....RQDDRCL..........E.VE...........F....RTQ.EEALSFVSLIDGYFRLTTDSSH..................
A0A556VWA6_BAGYA/123-214               .............................................tssftmrvsgdggiq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..TR..SS.....DDQDW.QTFCDFPQIAEI.........NM.KrvcpeqlpaeG..........R..V................VTLT.....RQDDRRL..........E.VE...........F....ETM.AMALSFVSLVDNYFRLTTDSSH..................
A0A3Q3E7L5_9LABR/275-364               ...............................................vrvtgetgiqisd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..SS..HL.....DSAEW.QTFCDFKEIIDV.........SV.TrlsqdqvpqdK..........S..M................VIIT.....RKDDRCL..........E.AI...........F....QCL.KEALSFVSLVDGYFRLTTDSSH..................
A0A3P9CSX7_9CICH/280-414               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSAQ.......................R.aQANNY..MGNG.YI.NY.MR...K..P..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A673C5E6_9TELE/268-341               .....................................................qwrkvta---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..QK..VC.....QNKTW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A3Q3LI18_9LABR/303-421               ....................................................gyygyynq-----------SQEQ.---.SP...S.QN...LEASYDTVVRVTGTTGISWKKKTPT.......................-..-ITLS..----.--.--.--...-..-..RVVK..Q..K..KE..AK.....ESECW.EVFCDFHEITHT.........VI.K..........D..........V..T................VTIF.....RQDNKRM..........E.LR...........M....ASR.AEAQAFAALVDGYFRLTVDAHH..................
A0A2K5Q1Z3_CEBCA/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A672IVC6_SALFA/282-387               ..............................ytetfpvkepssgqvilhvaadtgiqwcre---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkegt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A226N3Z6_COLVI/1-29                  ............................................................---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.VL...........L....PSH.ESALSFVSLLDGYFRLTADSNH..................
A0A091KK52_9GRUI/296-380               ....................................................qclrgklk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..D..SE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A452DQ72_CAPHI/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
E1BEL4_BOVIN/273-357                   ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A2K5KJN2_CERAT/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A4W4HF24_ELEEL/278-365               ..................................................sadqgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..QK..EA.....QPEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A2R8MSL1_CALJA/282-357               .....................................................spggqed---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A5F7ZDF4_MACMU/294-441               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AARPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A2Y9HKP7_NEOSC/297-379               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Qasqe.gsnesR..V................VTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTTDAHH..................
A0A2K5ZKJ6_MANLE/272-409               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A669FCU2_ORENI/197-267               .........................................................yds---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A2P4TB51_BAMTH/141-225               ...................................................qcsrgklkn---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A670IXY0_PODMU/285-420               ...........................................................e-ILETASLLISSENE.KI-.FD...T.GY...SEIIPCYQVMVTGNNGIQWRLKPIV.......................-..TQSER..EKHK.TK.RK.RS...D..G..KAKK..N..E..EK..SK.....-KEEW.NSFCYFPEITHL.........VI.K..........E..........S..T................VCIY.....KQDNKRM..........E.FK...........L....SSC.EEALSFAALIDGYFRLTADAHH..................
A0A452HXQ7_9SAUR/289-364               ......................................................shsgde---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---SR.QPFCDFPEIADI.........TI.K..........Q..........A..Srdsnp......venriVTVT.....KTDNRIL..........E.VE...........F....LTL.REALSFVSLIDGYYRLTADAHH..................
A0A667ZXS7_9TELE/137-212               .....................................................skgkegd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL.........vE.YS...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A3P9CB25_9CICH/299-432               ....................................................ngsyygyy------------NQS.LGH.AQ...S.QN...MEASRDMQVLVTGTTGISWRTKPTT.......................S..SVACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........L....DTR.AEALSFAALVDGYFRLTVDAHH..................
V8P909_OPHHA/149-259                   ............................................................ETFETSSLLISSENE.NSK.LD...-.-T...SENIIHYEVMVTGNLGIQWRRKPVI.......................-..TQTEK..EKPK.IK.KK.KY...D..-..KVEK..N..E..EK..NK.....-REEW.ISFSYFPEITHL.........VI.K..........E..........S..T................VCIY.....KQDNKRM..........Q.--...........-....---.----------------------pnvfd.............
A0A452S2G3_URSAM/288-401               .................................................rvpvcrlqlpl---------------.---.--...-.--...APGPPTHEVLVTGMGGIQWRPVQAE.......................-..-----..----.--.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A674DZ95_SALTR/280-390               .......................................yysthnalcnrvcrhtlrkki---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
T1JVU0_TETUR/251-324                   .....................................................qsidift---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..AQ..KS.....NTPDW.VFFCSIEDICFI.........IV.Q..........N..........L..G................VEIS.....RKNGTPV..........F.LT...........V....ANQ.MVMKSLLSLLEGYHRLTT----gdsi..............
A0A091T8G5_PHALP/244-373               ............................................................EGEKVQLYVNGGHSQ.PEH.GH...A.LL..pKDRPVTHEVLVTGTSGIQWRPVPIE.......................V..DPNKE..----.--.--.-L...E..P..KGPA..Q..P..V-..ER.....SEPKW.AHFCDFREITHI.........VI.K..........D..........C..R................VSIN.....RQDNKCL..........E.VV...........L....PSS.ESALSLVSLVDGYFRLTADSSH..................
A0A667ZTY7_9TELE/304-433               ....................................................gyhgyyns---------------.-SQ.GQ...S.QK...QEMSHDSQVLVTGTTGISWRKKPAT.......................N..VMMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A3Q1G7R6_9TELE/282-419               ....................................................dadgsssy--------SNNTYA-.-QG.AS...K.DN...YQAPATHEIRVSGIKGIQWREVSAQ.......................K.aQANPY..LRND.YM.NY.MK...K..A..KQQP..S..Q..PN..AN.....TPNKW.AFFCDFPEITHI.........AI.T..........E..........A..N................VCIS.....TQDNQYM..........E.VQ...........M....NSS.QEAHSFISLLDGFYRLTADAHH..................
A0A674GF85_TAEGU/283-413               ............................................................EIFETSFLLISAENE.VNK.FN...C.GD...NE---RYEVMVSGNNGIQWRLKPS-.......................-..---PV..PTEK.EK.KK.KS...D..S..KSKK..V..E..EK..HK.....LREAW.NSFSYFPEITHI.........VI.R..........D..........C..A................VSVN.....KQDNKRM..........E.LR...........L....GSH.AEALSFTSLVDGYFRLTADAHH..................
F6QBA9_CALJA/285-432                   ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvskee.............gsirgS..GSNLQ..ASLS.GK.KA.KA...H..-..KAIA..Q..P..AD..KP.....REPPR.VYFCDFRDITHV.........VL.K..........E..........R..R................VSIH.....RQDNKCL..........E.LS...........L....PSR.AMALSFVSLVDGYFRLTADSSH..................
A0A2P4T3X3_BAMTH/174-305               ............................................................EIFETSSLLISSESE.INR.FN...C.GD...GEIIPLYEVIVTGNNGIQWRLKPSS.......................-..-----..-TQT.EK.KK.KS...D..G..KIKK..D..E..DR..YK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A673A8C1_9TELE/292-379               ................................................tngssdpddgkw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..NQ.....KTLEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A087V8Q7_BALRE/224-306               ...................................................srgklkdce---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A3Q4GXJ1_NEOBR/307-386               ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..DR.....AEEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
H0VSL1_CAVPO/273-354                   ..............................................vaggsgiawspgea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.EQFCDFPEIVDI.........SI.K..........QapragpagehR..L................VTIT.....RADNKIL..........E.AE...........F....PAL.RAALSFVALVDGYFRLTCDTRH..................
A0A452QRM6_URSAM/239-321               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K5JYV7_COLAP/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W3H1F7_CALMI/264-339               ..........................................................sl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-K.....DNEQW.QPFCDFPEIVDI.........TL.K..........Q..........A..Srgyil......eesriVTVT.....KQDSKVL..........E.AE...........F....PSL.KEALSFVTLIDGYYRLAADAHH..................
A0A6I8S3U7_XENTR/338-409               .......................................................svyrg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..NK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
A0A3Q3XGW4_MOLML/298-374               ..........................................................sk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..NE.....EEGEL.TKFCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......vesriVTLT.....RQDNKIL..........E.LE...........F....CSL.SEALSFVSLVDGYYRLVADAHH..................
A0A286ZVG5_PIG/285-431                 ............................................................QAEGEPCYIRDGGQS.SPD.PE...P.QA...APEPTTHEVLVSGTDGIQWRLVQAEgpsgg.............agdgsS..SRIPH..TGHS.GK.KA.KA...Q..-..ERGN..Q..P..VD..RP.....GEALW.TYFCNFQDITHV.........VL.K..........E..........R..H................VSIH.....CQD-KCL..........E.LT...........L....PSR.ATALSLVALVDGYFRLTADSSH..................
A0A2U9C6E2_SCOMX/297-430               ...................................................lsnggyhvd-------------QS.LNQ.GQ...S.QN...METSHDMQVLVTGTTGICRRKKPAP.......................T..SASSK..EKGK.SK.KN.KM...D..G..KQKN..D..K..-K..KE.....ANEGW.VVFCDFHEITHA.........AI.K..........E..........T..T................VTIN.....RQDNKRM..........E.LQ...........M....ASR.AEALSFAALVDGYFRLSVDAHH..................
A0A673Y5I3_SALTR/285-422               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A662YQC4_ACIRT/289-363               ........................................................tgdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QDW.QTFCDFPEIIDI.........SI.K..........Q..........T..Srdkvp......lgsrvVTVS.....RQDSRLL..........E.AE...........F....HTL.REALSFVSLIDGYFRLTTDSAH..................
A0A672UQL4_STRHB/271-404               ............................................................EIFETSFLLISSENE.INR.SN...C.GD...NEVLPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KT...D..G..KTRK..D..E..EK..HK.....IRDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
A0A1V4KQA1_PATFA/327-400               .......................................................ggaes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADI.........SI.KqasrdggpveN..........R..V................VTLT.....KTDSRVL..........E.VE...........F....PTL.RAACSFVALIDGYYRLTADPHH..................
A0A315W9S3_GAMAF/313-419               ...........................setfrvnrssshseatftllrvcgetgiqtgql---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-D.....GAMEW.QTFCDFHEIVDI.........SI.Nriln.emvpqD.........sR..M................VTIT.....RKDDRCL..........E.AS...........F....QSR.KEALSFMSLIDGYFRLITDSSH..................
A0A3P8YG87_ESOLU/239-326               ..................................................titvtaehgi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..W..CR..EQ.....QKDSE.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A3P8WN14_CYNSE/275-361               ..................................................etgiqisgss---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..QN..DG.....CSLEW.QTFCDFQEIVDI.........SI.KrvclehvpldS..........R..V................VTIT.....RKDDRCL..........E.AR...........F....QDL.KEALSFVSLIDGYFRLTTDSS-y.................
A0A087YP74_POEFO/300-380               ......................................................wskgkg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.ELYCDFPEVIDI.........SI.K..........Qgske.gsaesR..I................VSLT.....RQDNQIL..........E.LE...........F....QLL.SEALSFVSLVDGYYRLVADAHH..................
A0A093FE34_GAVST/214-299               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDI.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A673C5C4_9TELE/283-418               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K..VCQNK..TAVI.SC.CI.LI...T..-..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A226F4F6_FOLCA/233-323               ...............................amtykqaeypatirvnvyhtkepgvsvay---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-M.....GKHNW.DHICTIEDLCFI.........SI.R.........gD..........C..T................AEIS.....RKNGIPI..........C.FK...........F....KSQ.ELAHSFVSMLDGYYRLS-----ek................
A0A1V4JXL8_PATFA/284-417               ............................................................EIFETPFLLITSENE.ING.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPTS.......................-..----V..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IQDLW.NNFSYFPEITHI.........VI.K..........E..........S..R................VSIN.....KQDNKRM..........E.LK...........L....SSH.AEALSFASLIDGYFRLTADAHH..................
A0A4W5QC95_9TELE/199-336               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A3P4RY19_GULGU/286-428               ...........................................................q-AVGEPYYLRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVQAEgpr.................gdgS..SRNPR..AGPL.GK.RT.KA...P..-..AVGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........R..H................VSVH.....CQD-KSL..........E.VT...........L....PSR.AMALSLVSLVDGYFRLTVDSSH..................
F6RE38_HORSE/298-380                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQNL.QLYCDFPDIIDV.........NI.K..........Q..........A..Hqegs.......nesriVTIH.....KQDGKTL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A2Y9D774_TRIMA/284-421               ............................................................EIFETSMLLISSENE.MNR.FH...S.ND...SGNILCYEVMVTGNLGIQWRQKPNV.......................-..LPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NR.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..A................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2Y9L8L7_ENHLU/189-332               ...........................................................q-AVGEPYYFRDAGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPVRAEgpr.................gdgS..SRNPH..AGPF.GK.RT.KA...P..-..AAGD..Q..P..AD..RP.....QEALW.TYFCDFQDITHV.........VL.K..........E..........C..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
A0A2K5YD03_MANLE/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A452QRR1_URSAM/241-319               ......................................................rgkhke---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-S.....ETLTE.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
M3YWH9_MUSPF/272-357                   ...........................................rvagdsgiawssggqea---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.QPFCDFPEIVDI.........SI.K..........QapcvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLISDSRH..................
A0A402EKZ3_9SAUR/294-379               ......................................................iklsrg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..D..CE..TL.....EEQNL.QTYCDFPDIIDV.........GI.K..........Q..........A..Sqegs.......sesriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVSLIDGYYRLIADAHH..................
A0A671UQ49_SPAAU/328-402               ........................................................ppdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ALW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A668A5U0_9TELE/243-325               .................................................sqegdlsnggy---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-HGR..H..P..EE..KD.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A5N4E978_CAMDR/252-334               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQGL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....SSL.SEALSFVSLIDGYYRLTADAHH..................
A0A2U9C4U7_SCOMX/285-384               ...................................shsihstfslmrvtgesgiqtgrsc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..PD.....SSPEW.QTFCDFQEIIDI.........SI.KrvcheqiphdS..........R..M................VTIT.....RKDDKYL..........E.AK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A226NGA7_CALSU/300-433               ............................................................EIFETSSLLISSESE.INR.FN...C.GD...GEIIPLYEVIVTGNNGIQWRLKPTS.......................-..----V..QTEK.EK.KK.KS...D..G..KIKK..D..E..ER..YK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A4W5R648_9TELE/252-362               ...............................................hgtetfqvnhpgs---------------.---.--...-.--...-------------------------.......................-..-QLQQ..KEPT.FK.LM.RV...A..G..ES-G..I..Q..FS..GS.....HCPEW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
H2LQD3_ORYLA/283-367                   ....................................................tgiqtsgd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..DD..SD.....GPPKW.ETFCDFGEIIDI.........SI.KrvcqdqasqdS..........R..M................VTIT.....HKDDRCL..........E.VN...........F....KSL.KEAFSFVSLVDGYFRLTTDSN-n.................
A0A672IGX7_SALFA/289-372               ....................................................tgiqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
F7DKS0_XENTR/270-406                   ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTC.......................-..-TTSE..KDRK.LK.RK.KT...E..S..KSKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
I3MJ48_ICTTR/284-421                   ............................................................EIFETSMLLISSENE.MNW.LH...S.ND...SGNVLSYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITHI.........VI.K..........E..........S..M................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A674EB10_SALTR/281-420               ....................................................cevllrvt----------DSEGE.IEG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQNv....................siN..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.NTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A6I8S6C9_XENTR/283-359               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A3P8YGA9_ESOLU/209-292               .....................................................hgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..QQ..KD.....SEQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A2K6LIB7_RHIBE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPK..ASLS.GK.KA.KA...H..-..KAIG..Q..P..VD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A2I4BES6_9TELE/290-368               .................................................qtsegspvgiv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.LTFCDFQEIVDI.........SI.N..........S..........Q..Eqapq........dsrmVTIT.....CKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A452R045_URSAM/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNVLYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKHK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6J3R659_TURTR/286-432               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtasd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VY..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A151NJE5_ALLMI/284-421               ............................................................EVFETSSLLISSENE.KNR.FN...F.GE...NENVPQYEVMVTGNNGIQWRLKPNI.......................-..QQTDK..EKHK.LK.RK.KL...D..G..KNKK..D..E..LK..TK.....IQEEW.NNFSYFPEITHV.........VI.K..........E..........S..T................VNIN.....KQDNKRM..........E.LK...........L....SSH.AEALSFASLIDGYFRLTADAHH..................
A0A665UQU3_ECHNA/305-367               ........................................................lcic---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----W.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
A0A091EJU9_CORBR/297-379               .................................................srgklkdcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
G3STB4_LOXAF/290-434                   ............................................................QAEGKLCYIQDHGQA.TLD.PG...K.ES...ALGPPTHEVLVTGTGGIQWRPVQAEgsg................gsgsG..SRNPQ..ANLS.GK.KA.QA...Q..-..EVDL..Q..P..AS..RP.....KGLPW.ASFCDFQDISHL.........VV.K..........E..........H..H................VSVY.....CQDNKCL..........E.LT...........L....PSR.ATALSFVSLVDGYFRLTVDSSH..................
A0A4W4EQ74_ELEEL/158-296               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................L..ASAKN..NKSK.SR.KS.KV...D..S..KQKN..E..K..-K..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
A0A452S2S9_URSAM/296-437               ..........................................................qa--GGEPYYIRDGGQP.PPD.PG...P.EL...APGPPTHEVLVTGMGGIQWRPVQAEvs...................dgS..SRNPH..AGPS.GK.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A671V986_SPAAU/279-405               ................................................rkdgvvsssysd------------TNH.AQG.VS...K.AS...YIAPATHEIMVSGTKGIQWRDAPGP.......................-..-----..----.--.KV.RQ...Q..M..SSLS..R..Q..PN..EN.....TPSTW.TSFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFVSLLDGYYRLTADAHH..................
A0A2K5EZD2_AOTNA/327-366               ..................................................snkcfpfgvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....------I..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A672ZL25_9TELE/268-338               ........................................................stgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A671V4M3_SPAAU/279-418               ................................................rkdgvvsssysd------------TNH.AQG.VS...K.AS...YIAPATHEIMVSGTKGIQWRDAPGP.......................K.aQANSY..LRND.PL.NY.IR...R..P..KQQS..S..Q..PN..EN.....TPSTW.TSFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QEARSFVSLLDGYYRLTADAHH..................
A0A2K6DGB5_MACNE/260-344               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A665WVL5_ECHNA/288-370               ...................................................giqwcreki---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQAL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaecR..V................VTIN.....KQDGKNL..........E.LE...........F....PSP.SEALSFVSLIDGYYRLTTDAHH..................
F1N0D6_BOVIN/284-421                   ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...SGNVLCYEVMVTGNLGIQWRQKPHI.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671UNQ4_SPAAU/287-364               .....................................................gscppdg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--ALW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A673XZB3_SALTR/239-314               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EE.....DKEGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3Q4G6U3_NEOBR/271-356               .............................................slvrvtgetgiqtag---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--IEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KKALSFVSLVDGYFRLTTDSSH..................
A0A671UU79_SPAAU/332-409               .....................................................hefslfr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--LQW.QTFCDFKDIIDI.........SI.KracheqapqdS..........R..M................VTVT.....RNDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
K7G2T9_PELSI/280-386                   .........................................eesfativitgnggiqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..S..SE..KL.....TEQEL.QTYCDFPDIIDV.........SI.K..........Q..........A..NqegssesrivtsenriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVSLIDGYYRLTADAHH..................
A0A6Q2Y1N8_ESOLU/387-468               ........................................................qwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..Q..QK..DS.....EQQEL.QTYCDFPDITYI.........SI.K..........Q..........S..Nkegs.......mesrvVTIN.....KQDSKAL..........E.LE...........F....KCL.SEALSFISLIDGYYRLTTDAHH..................
A0A667ZNJ5_9TELE/226-301               ....................................................kgkegdae---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----L.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A3B5R571_XIPMA/299-434               ....................................................tggyygyc---------NQSQL-.QTK.CQ...N.QN...LEPSSDMQVLVTGTTGISWRQKPAA.......................V..PVMPK..DKSK.SK.KS.KQ...D..-..EKQK..N..N..RN..KE.....TGDGW.VLFCDFHMITHT.........VI.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.AEALSFVALVDGYFRLIVDAHH..................
A0A4U5V9B1_COLLU/295-375               .........................................................wsk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..G..K..EE..EE.....GEEEL.QTYCDFPEMIDI.........SI.K..........Q..........S..Nkegs.......aesriVTLT.....KQDNQIL..........E.LE...........F....DLL.SEALSFVSLVDGYYRLVADAHH..................
A0A218VAM0_9PASE/297-379               .................................................srgklkdcetl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....GEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A667XMS8_9TELE/252-374               .............................................fpvshlelrkdgdgn---------------.---.--...-.-S...FGAPVTHEIMVSGTKGIQWRKVSGP.......................-..----G..DTDY.MR.KA.KQ...Q..-..---P..S..Q..SN..AN.....TPNNW.TSFCDFAEISHI.........AI.T..........R..........A..N................VCIS.....KQDNHSM..........E.VQ...........M....NSS.QEARSFISLLDGYFRLTADAHH..................
A0A674DYH7_SALTR/275-415               ....................................................eyepkvlr--------VTDSEGE.IQG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQNv.....................sN..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
L5L344_PTEAL/9-102                     ......................................................ggdggr---------------.---.--...-.--...-------------------------.......................-..RRNPH..AGSS.GK.KI.KA...Q..-..ESVT..Q..P..VD..RL.....QEAPW.TYFCDFQDITHV.........VL.R..........E..........C..H................VSIH.....CQD-KCL..........K.LT...........L....PSR.AMALSLVSLVDGYFRLTADSNH..................
A0A6Q2WQ50_ESOLU/298-376               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A4W2DI55_BOBOX/286-432               ............................................................QADGEPCYIREGGQA.PPD.PG...S.ES...AAGPPTHEVLVSGTEGIRWRLVPAEgpad..............ggaggG..SRMPD..ADPS.GK.KM.KA...E..-..EVGS..E..P..VD..RP.....RESPW.SYFCDFQDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
A0A340XN66_LIPVE/286-433               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEvsgap.............lpsssP..GRVPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
G1N138_MELGA/258-304                   .....................................................itstnws---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................VLIN.....KFSGDLS..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
I3K428_ORENI/253-365                   ......................cvgtetfqvnhssshpmsdfslvrvtgekgiqtagniy---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..D..SQ..DL.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........-.--...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A669E0D1_ORENI/300-434               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................R..AQANN..YMRN.GYlNY.MR...K..Q..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A665VNA1_ECHNA/309-387               ........................................................rgkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A673Y7L2_SALTR/268-402               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQ.......................K..VCLSV..SLDV.YQ.AV.SClcvF..F..VQSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........-.--...........-....-VR.APALSFVSLLDGYFRLTADAHH..................
A0A643BRQ1_BALPH/289-426               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..A................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5QMG0_9TELE/231-366               .......................................................gdgsg------SYLNTSHAH.G-A.SD...P.EN...FGPQAMHEVMVSGTKGIQWRKITAQ.......................A..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SFDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........V.RA...........P....ASQlLEALSFVSLLDGYFRLTADAHH..................
A0A672USC0_STRHB/210-326               ............................................................EIFETSFLLISSENE.INR.SN...C.GD...NEVLPLYEVIVTGNNGIQWRLKPNV.......................-..-----..----.--.--.--...-..-..----..N..E..EK..HK.....IRDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.EEALSFASLIDGYFRLTADAHH..................
A0A672J5V0_SALFA/265-395               ...........................................tcslgselfepvsfsnq---------------.---.--...S.QN...VETSHDMQVLVAGTSGISWRSKPSV.......................-..---VS..KTSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A4W5MKJ5_9TELE/272-350               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
JAK2_MOUSE/299-381                     .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDV.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqecs.......nesriVTVH.....KQDGKVL..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A3Q3W2U8_MOLML/250-376               ...................................................islgsqgqg---------------.---.-Q...S.QN...METSHDTQVLVTGTTGISWRKKPVT.......................-..VSETV..KKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
G5B4Y4_HETGA/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFLDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W5RE27_9TELE/166-281               .................................................vepshgtetfq---------------.---.--...-.--...---------------------VNHP.......................G..SQLQQ..KEPT.FK.LM.RV...A..G..ESGI..Q..F..SG..SH.....CPADW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A2U4A1Y4_TURTR/284-421               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITDI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A5A9NTV3_9TELE/282-420               ..................................................etvepknlkv----------SGENE.GSP.SH...S.LP..lGEDGMGYEVQVSGTTGISWRRKPLP.......................N..LSIVK..EKNK.SK.KN.KN...D..S..KQKN..D..N..KN..DG.....-INGW.TLFSDFYEITHI.........VI.K..........E..........S..C................VTIY.....RQDNKTM..........E.MD...........L....FYR.DAALSFVTLVDGYFRLTVDAHH..................
A0A673YFD4_SALTR/287-365               ...................................................sgklqaihi---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---LW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
I3JQC0_ORENI/285-420                   ................................................mgsevfepssls--------------S.LGH.AQ...S.QN...MEVSRDMQVLVTGTTGISWRKKPAT.......................V..SKNLK..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A4Z2F1C0_9TELE/1-40                  ...........................................................m---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................VTIT.....LED-RRL..........E.AD...........F....QSL.QEALSFVSLVDGYFRLSTDSSH..................
G1RNJ0_NOMLE/285-432                   ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............assgsS..GRNLQ..ASLS.GK.KA.KA...H..-..KAVG..Q..P..AD..RP.....QEPLW.AYFCDFRDITHV.........VL.K..........E..........R..S................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A2K6LW12_RHIBE/273-357               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A669EVS9_ORENI/293-373               ......................................................qwcrel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-S..KD.....SEQEL.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
A0A6I8RC10_XENTR/314-445               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEE.......................-..--VGV..VRLK.GL.I-.-F...S..T..QRPK..Q..P..PI..GK.....SEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A3Q4MT05_NEOBR/298-432               ...................................................cngsyygyy------------NQS.LGH.TQ...S.QN...MEASRDMQVLVTGTTGISWRKKPAT.......................S..SVACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........L....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W5QQE8_9TELE/252-330               .......................................................crdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A2I4CIS9_9TELE/281-413               ...........................................sngsssytrcdgdlrkp---------------.---.--...-.--...CGAEATHEIMVSGTKGIHWRKLSQK.......................K..QTDPR..LRNN.YL.NL.SK...K..S..KQNS..S..E..AN..GE.....SHDDW.EFFCDFPEITVI.........DI.N..........E..........S..N................VRIS.....TQLNQCL..........E.VE...........M....RSS.QEACSFISLLDGYYRLTADAHH..................
A0A672IGX9_SALFA/273-354               ......................................................iqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
M7B4M9_CHEMY/377-462                   .......................................................iqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..D..SE..TL.....TEQEL.QTYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......sesriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVSLIDGYYRLTADAHH..................
A0A665UVI9_ECHNA/282-415               ................................................dggssyanttha---------------.-QG.VS...K.DN...FTASITHEIRVSGTQGIQWRKASAQ.......................R..AQA--..NTYL.RN.DY.MS...T..T..EQQP..S..Q..QK..AN.....TPDEL.TTFCDFPEITHI.........AI.S..........G..........A..T................VCIS.....TQDNRCM..........V.RA...........L...mTSS.QEARSFISLLDGYYRLTADAHH..................
L8I7D4_9CETA/290-436                   ............................................................QADGEPCYIRDGGQA.PPD.PG...S.ES...AVGPPTHEVLVSGTEGIRWRLVPAEgpad..............ggaggG..SRMPD..ADPS.GK.KM.KA...E..-..EVGS..E..P..VD..RP.....RESPW.SYFCDFQDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
A0A672J8H5_SALFA/311-405               ..................................................ghirqsftvi---------------.---.--...-.--...-------------------------.......................-..----C..TDNK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A4W4EQU3_ELEEL/104-227               ........................................................eive----TKSLHVSGEGEvLPG.HA...P.GT...AEEGMAYEVQVSGTTGISWRKKPQL.......................-..--VDS..K---.--.--.--...-..-..--QK..N..E..KK..KE.....SGNGW.IPFSDFYEITHI.........VT.K..........E..........S..C................VTIY.....KQDNKTM..........E.LQ...........L....AYR.GEALSFAALVDGYFRLTVDAHH..................
F1NMJ9_CHICK/284-415                   ............................................................EIFETSSLLISSESE.INR.FN...C.GD...GEIIPLYEVIVTGNNGIQWRLKPSS.......................-..-----..-VQT.EK.KK.KS...D..G..KIKK..D..E..DR..YK.....TRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKKM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A553QH06_9TELE/258-374               ...................................................ssgsylits---------------.---.QT...Q.SE...EAINATHEVRVSGCSGISWRKFSAQ.......................-..-RVND..Y---.--.--.--...-..-..IPSQ..N..R..ET..ES.....VDDGW.NSFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IC...........L....GSS.MQARSLVSLIDGYFRLTTDAHH..................
A0A484DCM4_PERFV/285-370               ................................................adsgiqwcrekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qasre.gatesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTSDAHH..................
A0A670K542_PODMU/277-358               ......................................................qcsrgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..HK..DS.....ETLEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
J9P349_CANLF/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...P.ND...SGNILYYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A1D5PK82_CHICK/315-451               ...........................................................e-GEKAQPYINGGHAM.AEH.GD...A.AV..pGDCSVSHEVLVNGTGGIQWRPVPSE.......................S.vEVISH..RGYF.GR.RS.RR...-..-..--KE..P..E..PP..AP.....PEPPW.VHFCDFQEITHI.........VI.E..........E..........R..R................VSVH.....RQDNKCM..........E.VL...........L....PSH.ASALSFVSLLDGYFRLTADSNH..................
A0A4W2DC00_BOBOX/273-357               ...........................................vaggsgiawspgehevl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QapcigpaaehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTTDSRH..................
A0A498MS24_LABRO/277-361               ..................................................sadngiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..RH.....KETQS.ETYCDFGEVVDI.........SI.R..........Q..........A..Skegt.......nmnriVSIN.....KQDGKTL..........E.LV...........F....SSS.MEALSFVSLIDGYYRLTTDAHH..................
A0A670KD11_PODMU/278-368               .....................................tgsawtihvssekgiltshsggt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.HLFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A5F4D099_CANLF/302-384               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KR..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A673A6D4_9TELE/259-363               .................................fkvnpssseskssftllrvtgedgiqt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..N..GS..SD.....PDDEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A672H6X3_SALFA/280-412               ............................................gdassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................K.tQDNPD..LRND.CL.NY.TK...K..T..KRQP..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........V.RA...........L....---.-EACSFISLLDGYYRLTADAHH..................
W5M4B2_LEPOC/298-380                   ........................................................vnni---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..Q..S..NK..HS.....SPLEW.QTFCDFPEIIDI.........SI.K..........Q..........A..Rrdhvp......legrvVTVT.....RQDDRCL..........E.AE...........F....QSL.TEALSFISLIDGYFRLTTDSSH..................
A0A2I3RU79_PANTR/282-419               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A671FD71_RHIFE/295-440               ............................................................QAEGEPCYIRDSRQA.PLD.PG...P.ES...AVGPPTHEVLVTGTGGIQWRPVQAEgpsg...............gdggR..SRNAH..AGSS.RK.KA.KA...Q..-..ELGN..Q..P..MD..RR.....CEVPW.AYFCDFQDISHV.........VL.R..........E..........R..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AGALSLVSLVDGYFRLTADSSH..................
D2HMR9_AILME/224-306                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........TI.K..........Q..........A..Sqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A665VQ00_ECHNA/309-387               ........................................................rgkv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..EG.....AEEEL.QTYCDFPELIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....YSV.SEALSFVSLVDGYYRLVADAHH..................
A0A1L8HXG0_XENLA/284-359               .........................................................mvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QPFCDFPDIVDI.........RI.T..........Q..........A..Kfdsii......segriVTVT.....KQDNKVL..........E.SQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A671VYV8_SPAAU/278-400               .....................................................lsvqege---------------.---.--...-.-N...METSHDMQVRVTGTTGISWRKKPPT.......................V..SGTAC..EEGK.SK.KN.KQ...D..G..KQKN..D..K..NK..-E.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A484H163_SOUCH/357-494               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IQEEW.NNFSYFPEITDI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
G3WQ34_SARHA/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..D..SE..TL.....TEQDL.QMYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nenrvVTIH.....KQDSKNL..........E.IE...........F....CSL.REALSFVSLIDGYYRLTADAHH..................
A0A2K5BXX9_AOTNA/282-357               ......................................................spggqe---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EL.QPFCDFPEIVDI.........SI.K..........QaprtgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALLDGYFRLTTDSQH..................
A0A673XZ19_SALTR/291-366               ........................................................sree---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....DKEAD.KTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
H2N755_PONAB/284-421                   ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...IGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5QQN5_9TELE/203-280               ........................................................rdgh---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQDL.QTYCDFPDVTDI.........SI.K..........Q..........A..Nkegs.......mesrvVTIN.....KQDGKTL..........E.LE...........F....NCL.SEALSFISLIDGYYRLTTDAHH..................
A0A341BFN8_NEOAA/295-441               ............................................................QAEGEPCYIRDGGQA.PPD.PG...P.ES...AAGPPTHEVLVSGTDGIQWRLVQAEtpsd..............gggggG..RRMPH..AGPS.GK.KA.KA...Q..-..EVGN..Q..P..VH..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........R..R................VSIH.....CQDNKCL..........D.LT...........L....PSQ.AAALSLVSLVDGYFRLTADSSH..................
A0A1S3P9S9_SALSA/298-433               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A2I3LGP0_PAPAN/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q7UA82_URSAR/286-429               ..........................................................qa--GGEPYYIRDGGQP.PPD.PG...P.EL...APGPPTHEVLVTGTGGIQWRPVQAEgpr.................gdgS..SRNPH..AGPS.GK.KT.KA...P..-..EVVD..Q..P..AD..RP.....REAPW.AYFCDFRDITHV.........VL.K..........E..........R..H................VSIH.....CQDNKSL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSSH..................
A0A2I2Y6E6_GORGO/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A3P4LTX5_GULGU/1-35                  ...........................................................m---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....--DNQIL..........E.AE...........F....PGL.PAALSFVALIDGYFRLIADSRH..................
A0A4W6BZX8_LATCA/270-345               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..-E.....LEEGL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A341D0I0_NEOAA/284-421               ............................................................EIFETSMLLISSENE.MNR.FH...P.ND...NGNILCYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A3Q3LLI2_9TELE/286-364               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SEQEL.QTLCDFPDVTDI.........SV.K..........Qaske.gatesR..V................VTIN.....KQDGKNL..........E.LE...........F....PNL.LEALSFVSLIDGYYRLTTDAHH..................
A0A665VJY0_ECHNA/285-361               ......................................................tsalll---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A672ZGE6_9TELE/296-375               ........................................................stvk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..EG..ES.....SEEGL.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A672ZIP5_9TELE/282-352               ........................................................stgl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QIYCDFQAVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....TQDNKVL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVSDAHH..................
A0A3Q3W2N2_MOLML/259-392               ....................................................nggyygcy------------NQS.QGQ.GQ...S.QN...METSHDTQVLVTGTTGISWRKKPVT.......................T..PVNSK..EKGK.SK.KS.RV...D..G..KQKN..N..R..KD..E-.....VNESW.VVFCDFHEITHA.........AI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LL...........M....TSR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W6CM24_LATCA/263-363               ..................................psashsksafslikvtgetgiqtsgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..CH.....PDSEW.QTFCDFHEIIDV.........SI.KrvcheqvpqdS..........R..M................VTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A672Z4E9_9TELE/249-375               .......................................................ellep---------------.-KS.VS...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................V..SETVL..KTNK.SK.KN.KH...D..S..KQ-K..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A673YAN1_SALTR/292-429               .......................................................gdgsg------SYLNSSHAR.-GA.SD...P.EN...VDPQVMHEVMVSGTKGIQWRKITVQk....................aqA..NSYFG..NDYL.GN.RK.SV...K..-..-QSP..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A4W5PYA2_9TELE/340-455               ......................................................sdgsgs-------YLNTSHAR.G-A.SD...P.EN...FGPQVMHEVMVSGTKGIQWRKITQS.......................-..-----..----.--.--.P-...-..-..----..L..Q..QE..PK.....SSDTW.TSFCDFPEISHI.........TI.T..........G..........A..N................VSII.....KQDNFSM..........E.VQ...........M....NSS.LEALSFVSLLDGYFRLTADAHH..................
A0A672J8G8_SALFA/266-386               ..............................................qegdlcnggysgef---------------.---.--...-.--...--------VLVAGTSGISWRSKPSV.......................M..PVISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
G1P7K0_MYOLU/170-254                   ...............................................vaggsgiawspgt---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PASLSFVALVDGYFRLTTDSQH..................
A0A5J5CVA9_9PERO/328-406               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..EG.....AEEEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......vesriVTLT.....RQDNQIL..........E.LE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A091W7X1_NIPNI/274-349               ....................................................gsrggasr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QHFCDFPDIADI.........SI.K..........Q..........A..Sreggp......venriVTLT.....KTDNRVL..........E.VE...........F....PTL.REARSFVALVDGYYRLTADAHH..................
A0A4W6C0F6_LATCA/253-370               .............................................yserfqvtdlsarev---------------.---.--...-.--...-------TIVVMGNKGIQWSKGELE.......................-..-EGAE..EVRT.GR.WV.--...-..-..----..-..-..--..-H.....VAMEL.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkegs.......aesriVTLT.....RQDSQIL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLVADAHH..................
A0A674EBB7_SALTR/268-405               ...................................................ykpevlrvt----------DSEGE.IEG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.NTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A2K6LIG0_RHIBE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPK..ASLS.GK.KA.KA...H..-..KAIG..Q..P..VD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........R..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A3L8R124_CHLGU/329-404               ......................................................cggses---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADI.........SI.K..........Q..........A..Asrdgg.....pvenrlVTVT.....KADNRVL..........E.VE...........F....ATL.REAHSFVALLDGYYRLTADAQH..................
A0A674D891_SALTR/282-419               .................................................emlepralvvt-----------QEVE.TNG.GL...S.DG...PESSLAMEVQVTGTTGISYRRKPPN.......................N..TLILK..EKNK.SK.KN.KF...E..-..GKQT..K..P..KK..KD.....TSDGW.VTFCDFHEITHI.........VI.K..........E..........S..T................VTIF.....RQDNKKM..........E.VQ...........L....EFK.GEALAFAALVDGYFRLTVDAHH..................
A0A3P9AQE5_ESOLU/259-363               ..........................lnqpgsqlpqkeatasllrvsgesgiqisgclrp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EEV.QTFCDFPEIVDI.........SV.Krass.ervaqD.........sR..V................VSIT.....LQDDRCL..........E.AE...........F....HTV.QEALSFVSLVDGYFRLTTDSTH..................
A0A1S3WAF8_ERIEU/284-421               ............................................................EIFETSMLLISAENE.MSR.LY...P.SD...SGSTLCYEVMVTGNLGIQWRQKQNV.......................-..VPVEK..EKNK.LK.RK.KQ...E..G..KHKK..D..E..EK..NK.....AREEW.NNFSYFPEITHI.........VI.K..........E..........S..L................VSIN.....KQDQKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A2K5L5K0_CERAT/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A060XTD4_ONCMY/104-182               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADSHH..................
G1PKC8_MYOLU/290-434                   ............................................................QAEGEPCYIQDSAQA.PGD.PK...P.KS...AVEPPTHEVLVTGTGGIQWRPIQAEgpgg...............gdggS..SRNPH..AGLS.GK.KA.KA...Q..-..QRGG..Q..P..VD..RP.....REAPW.AYFCDFRDITHV.........VL.R..........E..........R..H................VSIH.....CQD-KRL..........E.LT...........L....PSP.ASALSLVSLVDGYFRLTADSNH..................
A0A4W3K5R6_CALMI/203-333               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRVMRKE.......................K.pVTMKK..CGWR.GR.--.-E...D..V..SRKL..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A672JUC3_SALFA/270-372               ...........................................rvnnsssqskppfslvr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.-V...T..G..ETGI..Q..T..SG..SD.....QPDED.LTFCDFQEIIDI.........SV.KrvcheqvqqdS..........R..M................VSIT.....RKDDRCL..........E.AM...........F....QTL.KEAQSFVSLVDGYFRLTTDSSH..................
A0A0D9S727_CHLSB/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A452HKY2_9SAUR/239-381               ...........................................................e-GEKVLLYVNGGHTQ.LED.GC...A.SS..pRDRSTTHEVLVTGTDGIQWRTVPVE.......................S.aESLPH..RGYF.GR.KT.RA...K..E..LDLK..G..P..CRpvER.....NEAKW.VRFCDFQEITHI.........AL.E..........D..........C..K................VSIN.....RQDNKCL..........E.LV...........L....PSY.ETALSLVSLVDGYFRLTADSSH..................
F7GT47_MACMU/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......desrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A667Z364_9TELE/270-342               ......................................................gkegdl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.VFHCDFAEVIDI.........SI.K..........Q..........A..Ntegs.......aesriVTLT.....RQDNFIL..........E.RE...........F....HSL.PEALSFVSLVDGYYRLVADAHH..................
A0A4W5R2Y6_9TELE/160-263               .......................................elagvepshgtetfqvnhpgs---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..QLQQ..K..E..PT..FK.....LMREW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A091TQI1_PHALP/295-380               ..................................................iqcsrgklkd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..CE..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A669BYF6_ORENI/252-360               .......................................sevfepsslsviqegdlcngs---------------.---.--...-.--...-------------------------.......................-..-YYGK..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A673C3A9_9TELE/282-418               .....................................................dgdgsss-------YSNSTH--.AQG.VS...K.DN...YSAPSTHEIMVCGPKGIQWRKVTAQ.......................K..VSNTY..LRNDyMN.YV.RI...T..-..RPQS..S..Q..TN..AN.....APDEW.TSFCDFPEITHI.........AV.T..........E..........S..I................VSII.....TEDNRSM..........E.VQ...........M....NSS.QEARSFISLLDGYYRLTADAHH..................
A0A663FK25_AQUCH/284-420               ............................................................EIFETSFLLISSENE.INI.FN...C.GD...SEILPLYEVIVTGNNGIQWRLKPNV.......................-..-MQKA..FKNK.IK.KK.KS...D..G..KNKK..D..E..EK..QK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A4W4H6Z1_ELEEL/273-366               ...................................keasagqvtiivsadqgiqgpesma---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---DL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A672J848_SALFA/301-436               ........................................................gysg------YYNQSQGQN.QGQ.NQ...S.QN...VETSHDMQVLVAGTSGISWRSKPSV.......................M..PVISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..NK..EP.....-NKGW.LVFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKKM..........E.MQ...........M....ASR.SEALSFAALVDGYFRLTVDAHH..................
A0A402G644_9SAUR/3-107                 ..............................................sdaasflltlqrve---------------.---.--...-.--...-------------------------.......................-..-IHPH..RGYL.GR.KT.KN...K..D..HRPN..W..P..YQpvEK.....CEPKW.AHFCDFQEITHI.........VI.K..........G..........S..K................VSIH.....RQDNKCL..........D.LS...........L....QSH.EAALSLVSLVDGYFRLTADSSH..................
H0X425_OTOGA/285-430                   ............................................................QAEVKPYYNLDSKQS.PGD.PS...P.ES...AAGPSTHEVLVTGTSGIQWRPIQTEdssg...............ssgsR..GRNPR..ASRS.GK.KA.KV...H..-..EAGE..L..P..AD..GQ.....QEPQW.AYFCDFRDITHV.........VL.K..........E..........C..H................VSIH.....RQDNKCL..........D.LI...........L....PSQ.AVALSFVSLVDGYFRLTADSSH..................
A0A6I8QP40_XENTR/189-274               ............................................srdnsggenfativdl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTYCDFTEIIDI.........SI.K..........Q..........A..Nkdds.......tesrvVTIN.....KQDNKILv.......rsE.VE...........F....STL.KEALSFGSLIDGYCRLTTDAHH..................
A0A4W5JJK5_9TELE/247-385               ...........nefnnktvksnkvnthdikvkylatletltcgfgcevcnknilcssvsq---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A672H3C2_SALFA/280-416               ............................................gdassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................K.tQDNPD..LRND.CL.NY.TK...K..T..KRQP..G..S..QN..AD.....TPNKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
A0A671W408_SPAAU/285-403               ...................................................dpillsvqe---------------.---.--...-.--...GETSHDMQVRVTGTTGISWRKKPPT.......................-..----V..KKGK.SK.KN.KQ...D..G..KQKN..D..K..-N..KE.....AAEGW.VNFCDFHEITHT.........VI.K..........E..........A..T................VTIY.....RQDNKRM..........E.LQ...........M....ASK.SEALSFAALVDGYFRLTVDAHH..................
A0A3Q1GI07_9TELE/290-367               ....................................................schsvgal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.HTFCDFQEIIDIgirrvcheqVL.Q..........D.........sR..M................VTIT.....RKDDKCF..........E.AK...........F....QTL.KEALSFVSLVDGYFRLTTDSSH..................
A0A4W3JVH4_CALMI/223-293               .......................................................aqdlq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-PYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A4W4EEC1_ELEEL/283-420               .......................................................gdgsg------SYLNASRMQ.EP-.AE...A.EG...VCGLPSHELTVSGTKGIHWRKLLPQ......................rA..QENSY..LGND.YL.DN.RK...H..R..GQQV..R..Q..QE..MD.....TVEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A553R5W2_9TELE/246-383               ........................................................eife----PSSLIICENEQ.VL-.-T...D.SS...CEAGVQHKILVSGTSGIHCRKFPLK.......................V.fSDKRT..KREK.NK.SK.KD...Y..L..KVST..A..A..SA..DT.....GEEKW.TLFSDFNEITHL.........VI.K..........C..........S..V................VTIH.....TQDNKSM..........E.LH...........M....ASH.EEALSFTSLVDGYFRLTVDAHH..................
G3WN84_SARHA/284-421                   ............................................................EIFETSLLLISSENE.MNK.LN...S.KD...CGNVISYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.RK.KQ...D..N..RHRK..E..E..EK..NK.....AREEW.NSFSYFPEITHV.........VI.K..........E..........S..M................VSIN.....KQDNKKM..........E.LS...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A4W5MKX0_9TELE/193-271               ..........................................................sq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..G..KD..ME.....IEKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkgga.......iesriVTIN.....RQDHQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A4W5JGQ0_9TELE/285-421               ....................................................tpevlrvt----------DSEGE.IEG.TP..tS.CN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..L..AQ..D-.....VSNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A4W4EG50_ELEEL/281-398               ...................................................rphgdegvc---------------.---.--...-.--...--GLPSHELTVSGTKGIHWRKLLPQ.......................R..--VGL..NSAT.RR.KH.RG...Q..-..QVRQ..Q..E..MD..T-.....-VEEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A4W6EKZ3_LATCA/292-370               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....PTL.SEALSFVSLIDGYYRLTTDAHH..................
A0A672Z5C9_9TELE/270-395               .................................................wellepksvsi---------------.---.--...-.--...METSPDVQVLVTGTTGISWRKKPST.......................V..VPVSK..EKNK.SK.KN.KH...D..S..KQK-..N..D..KK..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A2K5XZL8_MANLE/285-432               ............................................................QAEGEPCYIRDSGEA.PTD.PG...P.ES...AAGPPTHEVLVTGTGGIQWWPVQEEvnkee.............gssggS..GRNPQ..ASLS.GK.KA.KA...H..-..KAIG..Q..P..AD..RL.....REPLW.AYFCDFRDITHV.........VL.K..........E..........C..C................VSIH.....RQDNKCL..........E.LS...........L....PSR.AAALSFVSLVDGYFRLTADSSH..................
A0A4U5UL97_COLLU/299-431               ....................................................ggyygyyn-------------QS.QGQ.SQ...S.QN...TETSNDMHVLVTGTTGISWRKKPST.......................T..AMISK..EKSK.SK.KN.KQ...D..G..KQKN..D..R..K-..KE.....ADEGW.QVFCDFHEITHT.........VI.K..........E..........T..T................VTIY.....RQDNKRM..........E.LQ...........M....ACR.AEALSFAALVDGYFRLTVDAHH..................
A0A5E4CD02_MARMO/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQNL.QLYCDFPEVIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKNL..........E.IE...........L....TSL.REALSFVSLIDGYYRLTADAHH..................
A0A6Q2XEE3_ESOLU/255-393               .................................................vfepevlrvmd-----------SEGE.IEGtPL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................S..AWTAI..EKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A5F9CQX7_RABIT/286-339               ............................................................QADGEPCYIRDHRPA.PAD.PG...P.EA...APGPPTHEVLVTGTGGIQWRPVLAE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vragrl............
A0A673YF21_SALTR/291-366               ......................................................cpadvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTIT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A4W2I4Q1_BOBOX/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A670KEB6_PODMU/285-355               ........................................................qgth---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.-LFCDFPEIADI.........TI.K..........KpvrdgqpaksR..L................VSVT.....KTDSRVL..........E.ME...........F....GSL.ADALSFVSLVDGYFRLTVDAQH..................
A0A4W3JKL6_CALMI/269-351               ........................................................mkgk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---R..K..D..NE..YG.....SDQDL.QPYCDFPDIINV.........SI.K..........Q..........A..Nkdss.......tegriVTIN.....RQHSSIL..........E.VE...........F....PSL.KEALSFVSLIDGYYRLTADAHH..................
A0A2Y9I9Q1_NEOSC/286-429               ...........................................................q-AVGEPYYIQDGGQA.PPE.PG...P.EL...ATGPPTHEVLVTGTGGIQWRPIQAEgpr.................gdgS..SRNPR..AGPF.GK.KT.KA...P..-..EVGG..Q..P..AD..RP.....QEAPW.AYFCDFQDITHV.........VL.K..........E..........C..H................VSIR.....CQDNKSL..........E.LT...........L....PSR.AMALSLVSLVDGYFRLTADSSH..................
F1MCX4_BOVIN/286-432                   ............................................................QADGEPCYIREGGQA.PPD.PG...S.ES...AAGPPTHEVLVSGTEGIRWRLVPAEgpad..............ggaggG..SRMPD..ADPS.GK.KM.KA...E..-..EVGS..E..P..VD..RP.....RESPW.SYFCDFQDITHM.........VL.K..........E..........R..H................VSIH.....CQDNKCL..........E.LT...........L....PSR.AAALSLVSLVDGYFRLTADSNH..................
A0A2K6NJZ8_RHIRO/281-357               ......................................................wtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A091SDR0_NESNO/283-416               ............................................................EIFETSFLLFSSENE.IKR.SN...C.GD...NEVLPLYEVIVTGNNGIQWRLKPN-.......................-..---SG..QTEK.EK.KK.KT...D..V..KTRK..D..E..EK..HK.....IQDTW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
F8W4H3_DANRE/286-409                   ...................................................dsgsylits------------RT-.--Q.NP...P.EE...TINEPTHEIRVSGSDGIWWRKFSAQ.......................R..SQSDD..YSHS.Q-.--.--...-..-..--NK..E..T..AA..LN.....EEEDW.NIFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IS...........L....DSS.IQARSLVSLLDGYFRLTTDAHH..................
A0A3Q2ZY34_KRYMA/276-365               ...............................................lvrvsgetgvqtr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..S..SQ..PD.....GTKEW.LTFCDFQEIVDI.........SI.N..........S..........E..Elapq........dsrvVTIT.....RKDDRCL..........E.AK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
A0A6Q2ZI19_ESOLU/283-421               .................................................vfepevlrvmd-----------SEGE.IEGtPL...S.FK...KDQPAQYQVLVSGNTGIKWRRKQQN.......................S..AWTAI..EKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A6I8S906_XENTR/237-313               ........................................................wmvp---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....ETELW.QTFCDFPEIVDI.........RI.T..........Q..........A..Kfdsai......segriVTVT.....KQDNKVL..........E.TQ...........F....PNL.QEALSFVSLVDGYYRLTTDSHH..................
A0A673A7H8_9TELE/281-368               ................................................tngssdpddgkw---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-R..NQ.....KTLEW.QTFCDFQEIIDI.........SI.KrvchenvpqdS..........R..M................VTIT.....RRDDRCL..........E.AK...........F....PSL.KEALSFVSLVDGYFRLTTDSTH..................
A0A0D9QZJ5_CHLSB/218-302               ...............................................vagdggiawtqge---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A2K6RHP9_RHIRO/284-421               ............................................................EIFETSMLLISSENE.MNW.FH...S.ND...SGNVLYYEVMVTGNLGIQWRHKPNV.......................-..VSVEK..EKSK.LK.RK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A668AFF5_9TELE/251-368               ...........................................vsqegdlsnggyhgrhp---------------.---.--...-.--...EEMSHDSQVLVTGTTGISWRKKPAT.......................V..-----..----.--.--.--...S..Q..MGGC..E..D..EK..KD.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
B0V237_DANRE/259-360                   ......................................hsgwleqseqqrvlavkvsgeg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---G..I..Q..IQ..KT.....DRQEW.QTFCDFPQIIDI.........SI.KrlcqeqmpleG..........R..V................VTLT.....RQDDQCM..........E.AE...........F....QTL.TDALSFVSLVDGYFRLTTDSTH..................
A0A4W5RHB5_9TELE/284-419               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KL...E..G..KQKT..D..K..-K..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A1B0GTR9_HUMAN/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPNIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSLIDGYYRLTADAHH..................
A0A669CDA1_ORENI/254-386               ............................................mllpslyserfqvtdt---------------.---.--...-.--...--SSNEVTIIVTGNKGIQWSKGKEE.......................D..RAEEV..RTNL.LQ.VC.CC...H..-..----..-..G..CV..LS.....LMLEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A091K588_COLST/208-260               ............................................................EIFETSFLLISSENE.INR.FN...G.GD...NEILPLYEVIVTGNNGIQWRLKPND.......................E..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------eklk..............
A0A4W5QAT6_9TELE/226-304               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..E..ED..KE.....ADKGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLIADAHH..................
A0A669DTX6_ORENI/275-319               .........................................................aes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
H1A3H7_TAEGU/287-361                   .......................................................ggses---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....----R.QHFCDFPDIADI.........SI.K..........Q..........A..Asrdgg.....pvenrlVTVT.....KADNRVL..........E.VE...........F....ATL.REARSFVALLDGYYRLTADAQH..................
G3P1H3_GASAC/255-366                   .........................gsetfqvnpsssqsqstfslvkvtwergietsgsl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..HP..DE.....ELVRW.HTFSDFKEIIDI.........GI.Krvch.eqvpqD.........sR..V................VTIT.....RKDDRCL..........E.AN...........F....QSL.KEALSFVSLVDGYFRLSTDSNH..................
A0A6I8Q6Y7_XENTR/266-399               ............................................................ESFETNSLIIKSENE.QNG.FN...I.SD...YDSMRRYEVLVTGNSGIQWRRKPTV.......................-..SVYRG..NKVT.SE.KY.K-...-..-..-SKN..S..D..EK..GK.....LKDEW.NCFSYYPEITHI.........AI.K..........E..........D..T................VIIN.....NQDNKSM..........E.LK...........L....SSQ.EEALSFAALIDGYFRLTADAHH..................
W5LHR3_ASTMX/268-407                   ..........................................evfqpslliihenedgas---------------.---.--...-.GF...GDKGARHRVLVSGTGGIKWQKVPVEtl...................pdP..WSNPQ..RRMS.MR.SR.RQ...Q..S..QQSS..G..P..KH..PT.....KHDVW.TTFSNFSEITHI.........VI.R..........D..........S..T................VTVY.....KQDDKRM..........E.VH...........L....AAR.EEALSFASLIDGYFRLTVDAHH..................
A0A669BI32_ORENI/299-432               ...................................................ngsyygyyn-------------QS.LGH.AQ...S.QN...MEVSRDMQVLVTGTTGISWRKKPAT.......................S..SVACR..EKGK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A4W5RDI0_9TELE/289-366               ....................................................shcpadvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A5F9DNU8_RABIT/100-153               ............................................................QADGEPCYIRDHRPA.PAD.PG...P.EA...APGPPTHEVLVTGTGGIQWRPVLAE.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........-.--...........-....---.----------------------vragrl............
A0A087VNE1_BALRE/244-373               ............................................................EGEKVQLYVNGGHSQ.PEH.GH...A.LL..pKDRPVTHEVLVTGTNGIQWRPVPVE.......................-..-----..---V.GR.NK.EL...E..A..KGPT..Q..P..A-..ER.....SEPKW.AHFCDFREITHI.........VV.K..........D..........C..R................VSIN.....RQDNKCL..........E.VV...........L....PSS.ESALSLVSLVDGYFRLTADSSH..................
A0A6I8S2H9_XENTR/287-416               ............................................................EGEKLPFYLNGGYME.HTD.TV...-.-N...REPTSTHQVMVSGMEGIQYRISKEE.......................V..GVVCI..MNTK.GE.--.--...-..-..-DLN..R..K..LR..NE.....NEPKW.VTFCDFQDITHI.........VI.S..........K..........S..R................VSVS.....CQDNRCL..........E.IA...........L....HSC.EDALSFVSLVDGYFRLTTDSNH..................
A0A6Q2YIW7_ESOLU/294-426               ...............................................gvngisiegtpls---------------.---.--...-.FK...KDQPAQYQVLVSGNTGIKWRRKQQNv....................rvW..NLSFD..EKKT.SK.KN.KY...K..I..SSKN..Q..P..AQ..DV.....-SSDW.KSFSELNEITHI.........NI.K..........G..........C..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A2K5RM66_CEBCA/326-400               .....................................................pggqedl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDV.........SI.K..........QapragpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A672Z387_9TELE/284-404               ..................................................epksvsvkqe-----------EELW.QNQ.SQ...C.QI...METSPDVQVLVTGTTGISWRKKPST.......................-..--VS-..ETKN.DK.K-.--...-..-..----..-..-..--..KE.....VDEGW.VVFCDFHEITHT.........VI.K..........D..........S..T................VTIK.....RQDNKRM..........E.LQ...........M....MSR.AEALSFAALVDGYFRLTVDAHH..................
A0A668A5H1_9TELE/281-408               ...........................................ltvsqegdlsnggyhgr---------------.---.--...-.--...----HPEEVLVTGTTGISWRKKPAT.......................N..VMMTK..EKGK.LK.KN.KL...D..G..KQKN..D..R..KK..-D.....AGDDW.EVFCDFHEITHI.........VT.K..........E..........A..A................VTIY.....RQDNKRM..........E.LQ...........L....ASR.AEALSFVALVDGYFRLTVDAHH..................
A0A4W6D9S5_LATCA/307-440               .............................................vslsvtqegeiangg---------------.--Q.SQ...S.QN...METSSDMQVLVTGTTGISWRKKPTS.......................-..-VISK..EKGK.SR.KN.KL...D..G..KQKN..D..R..KK..E-.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....RQDNKRM..........E.ML...........M....ASR.PEALSFAALVDGYFRLTVDAHH..................
A0A401PUU4_SCYTO/117-246               ................................eprheqdvhnfqneslgmavlhlsyiaa---------------.---.--...-.--...-------------QSNRSLSEVAKE.......................P..APNKK..TGWK.GK.PA.DN...G..-..SNKS..N..E..AV..EF.....TEKPW.IHFCGFKDITHI.........SI.S..........D..........C..R................VSVH.....RQDNKCM..........D.LV...........L....LSH.KQALSFAALIDGYSCLTTDSHH..................
A0A485N9K6_LYNPA/284-420               ............................................................EIFETSMLLISSENE.MNW.FH...P.D-...DSGNILYEVMVTGNLGIQWRQKPNV.......................-..VPVEK..EKNK.LK.WK.KL...E..N..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........C..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLVDGYFRLTADAHH..................
A0A6Q2XWB4_ESOLU/221-299               ....................................................skgnsvet---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-DEGL.QAYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDNQTL..........E.LE...........F....HSL.SEALSFVSLVDGYYRLTADAHH..................
A0A669DXS1_ORENI/284-362               .........................................................skg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KE..ED.....RAEEL.QTYCDFPEVIDI.........SI.K..........Qgnke.gsaesR..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A3B5K3X8_TAKRU/282-327               ........................................................ates---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..V................VTIN.....KQDGKNV..........E.LE...........F....PSL.SEALSFVSLIDGYYRLTTDAHH..................
A0A665VK31_ECHNA/283-359               ......................................................tsalll---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--QEW.QTFCDFQEIIDI.........SI.Tri......cqEqlp....qdgR..M................VVVT.....RRDDRCL..........E.VK...........F....QGL.KEALSFVSLVDGYFRLTTDSSH..................
A0A669CQW4_ORENI/272-342               ........................................................cqel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
F1Q6A2_DANRE/283-365                   ........................................................qwch---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..---E..R..H..KD..TQ.....SEDLL.QTYCDFAEVVDI.........SI.R..........Q..........A..Skdgt.......nmnriVSIN.....RQDGTPL..........E.LV...........F....STS.MQALSFVSLIDGYYRLTTDAHH..................
A0A674MBD1_TAKRU/315-420               ...............................clewvyinintiddiqikstssllgknpy---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.-E...I..V..KQQQ..S..D..KK..KE.....ENEGW.AVFCDFHEITHA.........VI.K..........E..........K.tT................VTIY.....RQDNMRM..........E.LQ...........M....ASR.AESLSFVALVDGYFRLTVDAHH..................
H2M2I1_ORYLA/292-430                   .................................................qeeepcngyyg----------YSNPS.QGQ.TQ...S.QN...IQESCDMQVLVTGITGISWRKKPII.......................E..STMSK..ENKK.TK.KN.KQ...D..-..GKQK..N..D..KK..TK.....ASEGW.VVFCDFYEITHT.........VI.K..........E..........K..T................VTIK.....SQDNKKM..........V.VQ...........L....ASS.PEALSFAALVDGYFRLTVDAHH..................
A0A4W4EE62_ELEEL/332-403               .................................................qrvglnsmdtv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EEL.KHFCDFPEISHI.........AI.M..........G..........T..N................VCIS.....RQDNYAM..........D.LR...........L....RSS.LDARSLVSLLDGYFRLTADAHH..................
A0A669DYS8_ORENI/345-389               .........................................................aes---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........R..I................VTLT.....KQDNQIM..........E.LE...........F....RSL.SVAVSFVSLIDGYYRLVADAHH..................
A0A4W3JN40_CALMI/300-424               ........................................essrsahyinnrcppptspl---------------.---.--...-.--...---AQHCQVLVSGNEGIQWRPVTMK.......................-..----K..CGWR.GR.E-.--...D..V..SRKL..N..S..VG..EE.....REQPW.SSFCDFKEVTHV.........VI.S..........N..........N..R................VCVH.....RQDNKCL..........E.LE...........L....GSH.REALSFTALIDGYSRLTTDAHH..................
A0A3Q3B2A8_CHICK/333-415               ....................................................srgklknc---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..-E..TL.....AEQDL.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqegs.......serriVTIH.....KQDSKNL..........E.AE...........F....QSL.REALSFVSLIDGYYRLTADAHH..................
A0A1S3LVA6_SALSA/284-421               ...................................................ykpevlrvt----------DSEGE.IEG.TP...TsCN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................N..AWTAK..EKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.KTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A3Q3LY54_9TELE/281-418               ....................................................dgdrsssy--------SNTTHA-.-HG.VT...K.DN...FRAPPTHEIMVSGIKGIQWREVPNQ.......................K.vHENTY..FRND.YM.NF.MK...K..T..KQQS..S..Q..PN..AN.....TPNEW.TFFCDFPEITHI.........AI.T..........G..........A..N................VCIS.....TQDIHFM..........E.VE...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A4W5R2P0_9TELE/292-366               .......................................................padvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....---EW.QTFCDFPEIIDI.........NI.Krach.eqvpqD.........sR..V................VTVT.....RQDDRCL..........E.AE...........F....QTV.TEALSFVSLVDGYFRLTTDSSH..................
A0A669EYA9_ORENI/313-383               ........................................................cqel---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QTLCDFPDVTNI.........SI.K..........Q..........A..Nkdst.......aesrvVTIN.....KQDGKNL..........E.LE...........F....PSL.LEALSFVSLVDGYYRLTTDAHH..................
G3PKW3_GASAC/285-418                   ...........................................giesssysnstryegap---------------.---.--...E.DD...FIGPATHEVLVSGTKGVRWRPVSEQ.......................-..KAQAN..TYLR.ND.YM.KT...K..-..KQPS..S..Q..PS..EN.....TTDKW.TSFCDFREITHI.........AI.T..........G..........T..N................VCIS.....TLDNRCL..........E.VQ...........M....NSS.QEARSFISLLDGYNRLTAFAHH..................
S7NZR3_MYOBR/299-443                   ............................................................QAEGEPCYIQDSAQA.PGD.PK...P.KS...AVEPPTHEVLVTGNGGIQWRPIQTEgpgg...............gdggS..SRNPH..AGFS.GK.KA.KA...Q..-..QQGG..Q..P..VD..RP.....RDAPW.AYFCDFRDITHV.........VL.R..........G..........R..H................VSIH.....CQD-KRL..........E.LT...........L....PSP.AIALSLVSLVDGYFRLTADSNH..................
A0A4W5RHB9_9TELE/284-415               ......................................lepralvltqegetngglshgp---------------.---.--...-.--...-EPSLAIEVQVTGTTGISYRRKPPN.......................-..---VS..GKTK.SK.KN.KL...E..G..KQKT..D..-..KK..KD.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VQ...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A673XZC8_SALTR/233-308               ..........................................................sr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..EE.....DKEGF.QTYCDFPEVIDI.........SI.K..........Q..........A..Nkdgs.......iesriVTIN.....RQDSQTL..........E.LE...........F....RSL.SEALSFVSLVDGYYRLIADAHH..................
A0A3Q2CA66_CYPVA/274-412               .............................................gltsklgselfepts---------------.---.--...-.--...LSVIQEKEVLTGGYYGKKYIHTSTSthei..............qllynV..PSTLK..DKSK.LK.KS.KQ...D..-..EKQK..N..G..RN..KE.....LNDGW.VLFCDFHEITHT.........II.K..........E..........T..T................VTIM.....RQDNKKM..........E.LQ...........L....LSR.EEALSFAALVDGYFRLIVDAHH..................
A0A667Y3U0_9TELE/281-362               ......................................................iqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..RH..KD.....SEQEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
G3RIC1_GORGO/280-357                   .....................................................awtqgeq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....--EVL.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PEALSFVALVDGYFRLTTDSQH..................
A0A553QH03_9TELE/267-383               ...................................................ssgsylits---------------.---.QT...Q.SE...EAINATHEVRVSGCSGISWRKFSAQ.......................-..-RVND..Y---.--.--.--...-..-..IPSQ..N..R..ET..ES.....VDDGW.NSFCDFPEISLI.........AI.Q..........G..........I..N................VCIS.....RQDNMSM..........D.IC...........L....GSS.MQARSLVSLIDGYFRLTTDAHH..................
A0A672GXK4_SALFA/351-470               .............................................dassshsnaahaqgv---------------.---.--...C.KD..yFGAPATHEIMVSGTKGIQWRKAPVQ.......................-..-----..----.-K.KT.KR...Q..-..-PGS..Q..N..AD..TP.....--NKW.TLFCDFPEITHI.........AI.T..........E..........A..N................VRIS.....TLDNRCM..........E.VQ...........M....NSS.QEACSFISLLDGYYRLTADAHH..................
G1PL96_MYOLU/299-380                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.Kqasq..egsnE..........S..R................VTIH.....KQMVKNQ..........E.IE...........L....SSL.KEALSFVSLIDGYYRLTADAHH..................
A0A6I8N3R9_ORNAN/176-313               ............................................................EVFEATLLQISSENE.KNR.SH...F.GD...HGEVLHFEVMVTGNQGIQWRQKCNV.......................-..VPVEK..EKSK.PK.RK.KL...E..S..KTKK..E..E..EK..IK.....LREEW.ISFSYFPEITHI.........VI.K..........E..........A..T................VSIN.....KQDNKRM..........E.LQ...........L....ASH.EEALSFVSLVDGYFRLTADAHH..................
A0A672IHG4_SALFA/296-378               .....................................................giqwcrk---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..KM..KD.....SDQEL.QTLCDFPDITDI.........GI.K..........Q..........A..Nkdgt.......aesrvVTIN.....KQDGKSL..........E.LE...........F....PNL.CEALSFVSLIDGYYRLTTDAHH..................
A0A091EVH4_CORBR/282-412               ............................................................EIFETSFLLISAENE.INK.FN...C.GD...NE---KYEVMVTGNNGIQWRLKPS-.......................-..---PV..QTEK.EK.KK.KS...D..G..KAKK..E..E..EK..HK.....LRETW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.AEALSFTSLVDGYFRLTADAHH..................
A0A669BNX7_ORENI/320-440               ............................................rsgscsstthaqcgsk---------------.---.--...-.DN...FCGPISHEISVSGTEGIQWRKVSVQ.......................-..-----..----.--.RV.CI...D..-..TDAG..I..Y..VD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCM..........E.VQ...........M....ISS.QEAHSFVSLLDGYYRLTADAHH..................
A0A674DZL2_SALTR/243-377               ...............vqsdnvsthdikvkylatletltcgfgcevcskmyysthnalcnr---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A671VHK2_SPAAU/309-387               .......................................................crekl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..KD.....SDQEL.QTLCDFPDVTDI.........SI.K..........Qaske.gaaesR..V................VTIN.....KQDGKNL..........E.LE...........F....SRL.SEALSFVSLIDGYYRLTTDAHH..................
I3MAE0_ICTTR/280-357                   ......................................................swspaa---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-QEVF.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTIT.....RTDNQIL..........E.AE...........F....PGL.PEALSFLALVDGYFRLICDSRH..................
A0A2U4BB84_TURTR/299-381               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesriVTIH.....KQDGKSL..........E.IE...........L....MSL.REALSFVSLIDGYYRLTADAHH..................
A0A4W2GAR3_BOBOX/218-300               .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QLYCDFPDIIDI.........SI.K..........Q..........A..Nqega.......nesriVTIH.....KQDGKSL..........E.IE...........L....KSL.REALSFVSLIDGYYRLTADAHH..................
A0A667XPA3_9TELE/274-360               .................................................vaadsgiqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..DR..HK.....DSEQL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
F7B2N9_HORSE/274-357                   ............................................aggsgiawspggdeal---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.QPFCDFPEIVDI.........SI.K..........QaprvgpagehR..L................VTVT.....RTDNQIL..........E.AE...........F....PGL.PAALSFVALVDGYFRLTADSRH..................
A0A1U8D4W6_ALLSI/407-547               ........................................................eddr----TPLYVNGEPPM.PVD.AP...-.PH...GDCLPTHEVLVTGADGIRWRPVPVE.......................V.tESPPH..RGYF.GR.KG.RS...K..E..PGSR..E..P..PTlaEH.....NKPKW.VQFCDFQEITHV.........VL.T..........G..........A..C................VGIH.....RQDNQCL..........E.LV...........L....PSP.EVALSLVSLVDGYFRLTADASH..................
A0A482VXW3_9CUCU/233-301               ........................................................kycf---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..ES.....KKDLW.HQICTIEELGFI.........SI.R..........Dg........dG..T................VEIS.....RKNGIPF..........Y.LK...........F....SSN.YSMFSFISLLDGYYRLTC----kw................
A0A667XVD7_9TELE/289-370               ......................................................iqwcrd---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..RH..KD.....SEQEL.QTLCDFPDVTDV.........SI.K..........Qaske.gavesR..V................VTIN.....KQDGKNL..........E.LE...........F....PSL.AEALSFVSLIDGYYRLTTDAHH..................
TYK2_MOUSE/288-431                     ..........................................................qp--ERDPCYIQNSGQT.AGD.PG...P.EL...PSGPPTHEVLVTGTGGIQWHPLQTQese.................rgnS..RGNPH..GSRS.GK.KP.KA...P..-..KAGE..H..L..TE..SP.....QEPPW.TYFCDFQDISHV.........VL.K..........E..........R..R................VHIH.....LQDNKCL..........L.LC...........L....CSQ.AEALSFVALVDGYFRLTADSSH..................
G3U3K6_LOXAF/299-381                   .........................................................srg---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..--KH..K..E..SE..TL.....TEQDL.QIYCDFPDIIDV.........SI.K..........Q..........A..Nqegs.......nesrvVTIH.....KQDGKNL..........E.IE...........L....SSL.REALSFVSVIDGYYRLTADAHH..................
A0A3P8X4U7_CYNSE/283-418               ..................................................gdegssylnr-------------MD.PQD.DE...K.DN...FTAPTTHEIIVSGIKGIRWRKVSVQ.......................A..QDNAC..PGND.YM.NF.SR...K..A..KRQS..A..Q..AS..VK.....SPNKL.TSFCDFPEITHI.........AV.N..........G..........A..N................VCIS.....TQENQCM..........V.VQ...........M....RSS.QEAHSFISLLDGYYRLTADAHH..................
A0A674E0A1_SALTR/284-394               .......................................yysthnalcnrvcrhtlrkki---------------.---.--...-.--...-------------------------.......................N..AWTAK..EKKK.SP.KH.KT...N..I..NWTN..K..P..PQ..GV.....-SNDW.KTFSDFHEITHI.........NI.K..........G..........S..T................VTVH.....KQDNNKM..........E.LS...........L....GFH.AEALSFAALIDGYFRLTVDAHH..................
A0A3Q4GD16_NEOBR/255-360               .......................................etfqvnyssshptsdfslvrv---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...T..G..ETGI..Q..T..AG..SI.....NNIEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KKALSFVSLVDGYFRLTTDSSH..................
U3IXD0_ANAPP/284-417                   ............................................................EIFETSSLLISSENE.INR.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KTKK..E..E..EK..HK.....IRDLW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A091USR2_NIPNI/284-417               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KTKK..D..E..EK..QK.....IRDAW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A3Q4H958_NEOBR/279-392               ............................................drsgscsstthaqcgs---------------.---.--...K.DN...FCGPISHEISVSGTEGIQWRKVSAQ.......................R..AQANN..YMGS.GY.INyMR...K..P..KQHS..S..Q..PD..AD.....TPNDW.TFFSEFPEITHI.........AI.T..........D..........S..N................VCIS.....TRDNLCV..........-.--...........-....---.----------------------frnrksh...........
A0A673YFV2_SALTR/283-418               .....................................lepralvltqegetngglsqgpe---------------.---.--...-.--...--PFLAVEVQVTGTTGISYRRKPPN.......................N..TLMLK..EKTK.SK.KN.KH...E..G..KQKK..D..-..KK..ND.....ASDDW.VTFCDFHEITHI.........VI.K..........E..........S..S................VTIF.....RQDNKKM..........E.VK...........L....EFR.GEALAFAALVDGYFRLTVDAHH..................
A0A674E9P1_SALTR/266-398               ....................................................evcmlrvt----------DSEGE.IEG.TP..tS.CN...QGQPTQYQVLVSGNTGIKWRRKQQN.......................-..---VS..IKKK.SK.KY.KT...D..I..NWKN..K..P..AQ..DL.....-SNDW.NTFSDFYEITHI.........NI.K..........G..........S..T................VTVH.....KQDNKKM..........E.LS...........L....GFH.AEALSFATLIDGYFRLTVDAHH..................
A0A670KAF9_PODMU/295-380               .......................................................iqcsr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..-GKH..K..D..SE..TL.....AEQEI.QTYCDFPDIIDV.........SI.K..........Q..........A..Sqeas.......genriVTIH.....KQDSKNL..........E.AE...........F....HSL.REALSFVALIDGYYRLTADAHH..................
A0A1S3FBE8_DIPOR/255-286               .........................................................teq---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....-----.------------.........--.-..........-..........-..-................----.....-------..........E.IE...........L....NSL.REALSFVSLIDGYYRLTADAHH..................
A0A669ENZ9_ORENI/242-371               ...............tvkdsnittydlkikylatleglvssmgsevfepsslsviqegdl---------------.---.--...-.--...-------------------------.......................-..----C..NGRK.SK.KN.KH...D..-..AKQK..T..D..KK..KD.....ANEGW.VVFCDFHEITHT.........VI.K..........E..........A..M................VTIY.....KQDNKKM..........E.LL...........M....DTR.AEALSFAALVDGYFRLTVDAHH..................
A0A484CG55_PERFV/300-437               ..............................................dedgsssysnttha---------------.-QG.AS...K.DD...FIVPATHEIMVSGTKGIQWRKVSGQ.......................K.aQANTY..FRND.YM.NY.MK...K..T..KQQS..S..Q..PN..AD.....TPNKW.TSFCDFPEITHI.........AI.T..........G..........D..N................VCIS.....TQDNHCM..........E.VQ...........M....NSS.QQARSFISLLDGYNRLTAFAHH..................
A0A4W4H722_ELEEL/285-367               .......................................................iqwcr---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..E..R..QK..EA.....QPEDL.QTYCDFPHIIDI.........SI.R..........Qaske.gvnksR..V................VCIN.....TKDGKTL..........E.LE...........F....SSQ.TEALSFVSLIDGYYRLTADAHH..................
A0A091PZE8_LEPDC/284-417               ............................................................EIFETSFLLISSENE.INR.FN...C.GD...NEILPLYEVIVTGNNGIQWRLKPN-.......................-..---SV..QTEK.EK.KK.KS...D..G..KNKK..D..E..EK..HK.....IRESW.NNFSYFPEITHI.........VI.K..........E..........S..T................VSIN.....KQDNKRM..........E.LK...........L....SSH.DEALSFASLIDGYFRLTADAHH..................
A0A665UQG0_ECHNA/301-432               .....................................................gyhgyyn-------------HS.QTE.SQ...I.QN...IEKSRDVQVLVTGTTGISWRKKPSA.......................V..SLVSK..EKGK.IK.KN.KL...D..G..KQRN..D..K..NK..EP.....-NEGW.VVFCDFHEITHT.........VI.K..........G..........P..T................VTIY.....KQDNKRM..........E.ME...........M....VSR.AEALSFAALVDGYFRLTVDAHH..................
W5KTH7_ASTMX/282-420                   .........................................................evv---ETKSLRLSGEGE.GSP.VH...T.SS..tREEGLAYEVQVSGTVGISWRKKPQQ.......................N..VLAVK..DKSK.SR.KN.KT...D..N..KQKN..D..K..IK..-D.....ASNGW.ILFSDFYEITHI.........VT.K..........E..........S..S................VTIY.....KQDNKTM..........E.LE...........L....AYR.GEALAFAALVDGYFRLTVDAHH..................
A0A286ZLI2_PIG/284-420                 ............................................................EIFETSMLLISSENE.MSR.FH...P.ND...-GGNVLYEVMVTGNLGIQWRQKPNV.......................-..VPIEK..EKNK.LK.RK.KL...E..S..KHKK..D..E..EK..NK.....IREEW.NNFSYFPEITHI.........VI.K..........E..........S..V................VSIN.....KQDNKKM..........E.LK...........L....SSH.EEALSFVSLIDGYFRLTADAHH..................
A0A3P9CMB0_9CICH/283-366               .................................................tagsinnsqvl---------------.---.--...-.--...-------------------------.......................-..-----..----.--.--.--...-..-..----..-..-..--..--.....SRVEW.QTFCDFQEIIDI.........SI.QrvcheqvpqdS..........R..M................VTIT.....RKDDSCL..........E.VK...........F....QSL.KEALSFVSLVDGYFRLTTDSSH..................
#=GC SS_cons                           .........................................................EESCCCEECCEEEECTTE.EEE.EE...E.--...---EEEEEEEEETTTEEEEEE----.......................-..-----..----.--.--.--...-..-..----..T..T..TS..--.....-GGG-.EEEE-GGGEEEE.........EE.E..........T..........T..E----.......---EEEEEE.....ETTSEEE..........E.EE...........E....SSH.HHHHHHHHHHHHHHHHHT-TT-..................
#=GC seq_cons                          ..........................................................t..............................................................................................................................p..p......tppph.psFCDFsEIscI.........sI.K..........p..........s..s................VoIp.....+QDs+sl..........E.lc...........h....sSh.pEALSFVSLlDGYaRLTsDAHH..................
//
DBGET integrated database retrieval system