GenomeNet

Database: Pfam
Entry: KMP11
LinkDB: KMP11
Original site: KMP11 
#=GF ID   KMP11
#=GF AC   PF03037.17
#=GF DE   Kinetoplastid membrane protein 11
#=GF AU   Griffiths-Jones SR;0000-0001-6043-807X
#=GF SE   Pfam-B_1062 (release 6.4)
#=GF GA   28.30 28.30;
#=GF TC   28.30 154.50;
#=GF NC   26.20 28.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7826346
#=GF RT   Isolation and structural characterization of the Leishmania
#=GF RT   donovani kinetoplastid membrane protein-11, a major
#=GF RT   immunoreactive membrane glycoprotein. 
#=GF RA   Jardim A, Funk V, Caprioli RM, Olafson RW; 
#=GF RL   Biochem J 1995;305:307-313.
#=GF DR   INTERPRO; IPR004132;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Kinetoplastid membrane protein 11 is a major cell surface
#=GF CC   glycoprotein  of the parasite Leishmania donovani.
#=GF SQ   8
#=GS Q4D3A7_TRYCC/1-90  AC Q4D3A7.1
#=GS Q38D58_TRYB2/1-90  AC Q38D58.1
#=GS Q4D3A5_TRYCC/1-76  AC Q4D3A5.1
#=GS A4HMP3_LEIBR/1-90  AC A4HMP3.1
#=GS A4IBB2_LEIIN/1-90  AC A4IBB2.1
#=GS A4IBB3_LEIIN/1-90  AC A4IBB3.1
#=GS E9AF45_LEIMA/1-90  AC E9AF45.1
#=GS Q4D7Y4_TRYCC/1-90  AC Q4D7Y4.1
Q4D3A7_TRYCC/1-90             MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFP..
Q38D58_TRYB2/1-90             MATTYEEFAAKLDRLDAEFAKKMEEQNKRFFADKPDEATLSPEMKEHYEKFEKMIQEHTDKFNKKMREHSEHFKAKFAELLEQQKNAQFP..
Q4D3A5_TRYCC/1-76             MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAK--------------..
A4HMP3_LEIBR/1-90             MATTYEEFAAKLDRLDEEFNKKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKHKFAELLEQQKAAQYP..
A4IBB2_LEIIN/1-90             MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQ--nm
A4IBB3_LEIIN/1-90             MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYP..
E9AF45_LEIMA/1-90             MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYP..
Q4D7Y4_TRYCC/1-90             MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFP..
#=GC seq_cons                 MATTYEEFSAKLDRLDtEFsKKMpEQNtKFFADKPDESTLSPEMKEHYEKFE+MIpEHT-KFNKKMHEHSEHFKtKFAELLEQQKsAQaP..
//
DBGET integrated database retrieval system