#=GF ID   Lysis_col
#=GF AC   PF02402.20
#=GF DE   Lysis protein
#=GF AU   Mian N;0000-0003-4284-4749
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1555 (release 5.4)
#=GF GA   25.00 25.00;
#=GF TC   25.60 31.30;
#=GF NC   22.80 22.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   3323826
#=GF RT   Nucleotide sequences from the colicin E8 operon: homology with
#=GF RT   plasmid ColE2-P9. 
#=GF RA   Uchimura T, Lau PC; 
#=GF RL   Mol Gen Genet 1987;209:489-493.
#=GF DR   INTERPRO; IPR003059;
#=GF DR   TC; 9.B.41;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   These small bacterial proteins are required for colicin release
#=GF CC   and partial cell lysis. This family contains lysis proteins for
#=GF CC   several different forms of colicin. Swiss:Q02112 has been
#=GF CC   included in this family, the similarity is not highly
#=GF CC   significant, however it is also a short protein, that is
#=GF CC   involved in secretion of other proteins (Bateman A pers. obs.).
#=GF CC   This family includes a signal peptide motif and a lipid
#=GF CC   attachment site.
#=GF SQ   4
#=GS A0A429DQP4_9ACTN/1-18  AC A0A429DQP4.1
#=GS D2TV60_CITRI/1-40      AC D2TV60.1
#=GS A0A7X6QMV6_9MICC/1-49  AC A0A7X6QMV6.1
#=GS A8ARS6_CITK8/1-49      AC A8ARS6.1
A0A429DQP4_9ACTN/1-18             .-------------------------------GGTVAPSSSSKLTGISVQ
D2TV60_CITRI/1-40                 m--------IFAISPGIMLLAACQVNNVRDTGGGSVSPSST--VTGVSMG
A0A7X6QMV6_9MICC/1-49             .MKKVKTIFLFILIVAGFLLAACQANYIRDVQGGTVAPSSSSELTGIAVQ
A8ARS6_CITK8/1-49                 .MKKVKVVFLFILIFSGFLLVACQANYIRDVQGGTVAPSSSSELTGIAVQ
#=GC seq_cons                     .........lFhl..uhhLLsACQsN.lRDstGGTVAPSSSScLTGIuVQ
//