#=GF ID Lysis_col
#=GF AC PF02402.20
#=GF DE Lysis protein
#=GF AU Mian N;0000-0003-4284-4749
#=GF AU Bateman A;0000-0002-6982-4660
#=GF SE Pfam-B_1555 (release 5.4)
#=GF GA 25.00 25.00;
#=GF TC 25.60 31.30;
#=GF NC 22.80 22.80;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP Family
#=GF RN [1]
#=GF RM 3323826
#=GF RT Nucleotide sequences from the colicin E8 operon: homology with
#=GF RT plasmid ColE2-P9.
#=GF RA Uchimura T, Lau PC;
#=GF RL Mol Gen Genet 1987;209:489-493.
#=GF DR INTERPRO; IPR003059;
#=GF DR TC; 9.B.41;
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC These small bacterial proteins are required for colicin release
#=GF CC and partial cell lysis. This family contains lysis proteins for
#=GF CC several different forms of colicin. Swiss:Q02112 has been
#=GF CC included in this family, the similarity is not highly
#=GF CC significant, however it is also a short protein, that is
#=GF CC involved in secretion of other proteins (Bateman A pers. obs.).
#=GF CC This family includes a signal peptide motif and a lipid
#=GF CC attachment site.
#=GF SQ 4
#=GS A0A429DQP4_9ACTN/1-18 AC A0A429DQP4.1
#=GS D2TV60_CITRI/1-40 AC D2TV60.1
#=GS A0A7X6QMV6_9MICC/1-49 AC A0A7X6QMV6.1
#=GS A8ARS6_CITK8/1-49 AC A8ARS6.1
A0A429DQP4_9ACTN/1-18 .-------------------------------GGTVAPSSSSKLTGISVQ
D2TV60_CITRI/1-40 m--------IFAISPGIMLLAACQVNNVRDTGGGSVSPSST--VTGVSMG
A0A7X6QMV6_9MICC/1-49 .MKKVKTIFLFILIVAGFLLAACQANYIRDVQGGTVAPSSSSELTGIAVQ
A8ARS6_CITK8/1-49 .MKKVKVVFLFILIFSGFLLVACQANYIRDVQGGTVAPSSSSELTGIAVQ
#=GC seq_cons .........lFhl..uhhLLsACQsN.lRDstGGTVAPSSSScLTGIuVQ
//