GenomeNet

Database: Pfam
Entry: MIF4G_like_2
LinkDB: MIF4G_like_2
Original site: MIF4G_like_2 
#=GF ID   MIF4G_like_2
#=GF AC   PF09090.11
#=GF DE   MIF4G like
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1h6k
#=GF GA   21.00 21.00;
#=GF TC   21.00 21.10;
#=GF NC   20.90 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11545740
#=GF RT   Crystal structure of the human nuclear cap binding complex. 
#=GF RA   Mazza C, Ohno M, Segref A, Mattaj IW, Cusack S; 
#=GF RL   Mol Cell. 2001;8:383-396.
#=GF DR   INTERPRO; IPR015174;
#=GF DR   SCOP; 1h6k; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Members of this family are involved in mediating U snRNA export
#=GF CC   from the nucleus. They adopt a highly helical structure, wherein
#=GF CC   the polypeptide chain forms a right-handed solenoid. At the
#=GF CC   tertiary level, the domain is composed of a superhelical
#=GF CC   arrangement of successive antiparallel pairs of helices [1].
#=GF SQ   1148
#=GS A0A139I408_9PEZI/558-809    AC A0A139I408.1
#=GS A0A0D2B4E6_9EURO/538-790    AC A0A0D2B4E6.1
#=GS A0A183DYP9_9BILA/535-705    AC A0A183DYP9.1
#=GS A0A1V8V8D6_9PEZI/542-793    AC A0A1V8V8D6.1
#=GS A0A0W4ZJT8_PNEJ7/523-781    AC A0A0W4ZJT8.1
#=GS A0A094HC41_9PEZI/534-785    AC A0A094HC41.1
#=GS A0A2G9RHF4_LITCT/32-174     AC A0A2G9RHF4.1
#=GS F0YDT9_AURAN/1510-1686      AC F0YDT9.1
#=GS G3SXB3_LOXAF/485-760        AC G3SXB3.1
#=GS A0A1Y2D2L7_9FUNG/467-727    AC A0A1Y2D2L7.1
#=GS B6QVA1_TALMQ/550-804        AC B6QVA1.1
#=GS A0A1Y2EJZ2_9PEZI/539-784    AC A0A1Y2EJZ2.1
#=GS A0A0V1PAT1_9BILA/490-653    AC A0A0V1PAT1.1
#=GS L8FMN0_PSED2/534-785        AC L8FMN0.1
#=GS G0V679_NAUCC/573-742        AC G0V679.1
#=GS A0A1V6T4M5_9EURO/532-785    AC A0A1V6T4M5.1
#=GS A7TKT7_VANPO/594-761        AC A7TKT7.1
#=GS A0A1B8G1Y9_9PEZI/534-785    AC A0A1B8G1Y9.1
#=GS A0A094CPK7_9PEZI/534-785    AC A0A094CPK7.1
#=GS A0A0V0V944_9BILA/490-752    AC A0A0V0V944.1
#=GS A0A1A9UGF8_GLOAU/489-772    AC A0A1A9UGF8.1
#=GS A0A0L0FDS0_9EUKA/1-118      AC A0A0L0FDS0.1
#=GS S6ENQ0_ZYGB2/750-829        AC S6ENQ0.1
#=GS J7S6P4_KAZNA/583-831        AC J7S6P4.1
#=GS D2VH37_NAEGR/629-880        AC D2VH37.1
#=GS X1X825_ACYPI/407-512        AC X1X825.1
#=GS A0A0E0NUZ5_ORYRU/483-829    AC A0A0E0NUZ5.1
#=GS A0A1D8PEB4_CANAL/619-796    AC A0A1D8PEB4.1
#=GS E2LB17_MONPE/113-226        AC E2LB17.1
#=GS I1QET0_ORYGL/454-801        AC I1QET0.1
#=GS A0A093CEQ9_9AVES/187-467    AC A0A093CEQ9.1
#=GS A0A0R3RY35_9BILA/529-796    AC A0A0R3RY35.1
#=GS A0A1E4TS79_PACTA/680-942    AC A0A1E4TS79.1
#=GS A0A0N4YY38_NIPBR/18-177     AC A0A0N4YY38.1
#=GS Q2GXY9_CHAGB/535-778        AC Q2GXY9.1
#=GS L5M790_MYODS/558-833        AC L5M790.1
#=GS M2YNE3_DOTSN/561-812        AC M2YNE3.1
#=GS S7QKB1_GLOTA/537-840        AC S7QKB1.1
#=GS H9G962_ANOCA/602-888        AC H9G962.2
#=GS A0A1B9II90_9TREE/597-892    AC A0A1B9II90.1
#=GS C5DQ64_ZYGRC/757-834        AC C5DQ64.1
#=GS A0A1D1VPL5_RAMVA/510-766    AC A0A1D1VPL5.1
#=GS A0A226F4E1_FOLCA/26-306     AC A0A226F4E1.1
#=GS NCBP1_MOUSE/485-760         AC Q3UYV9.2
#=GS A0A165CE58_EXIGL/461-559    AC A0A165CE58.1
#=GS A0A2C6LAC5_9APIC/712-785    AC A0A2C6LAC5.1
#=GS A0A2G2VR77_CAPBA/485-827    AC A0A2G2VR77.1
#=GS G8ZLM5_TORDC/581-751        AC G8ZLM5.1
#=GS A0A086TBE1_ACRC1/534-792    AC A0A086TBE1.1
#=GS M2P8U5_CERS8/532-836        AC M2P8U5.1
#=GS A0A2D0SDQ6_ICTPU/484-765    AC A0A2D0SDQ6.1
#=GS A0A1G4JAP1_9SACH/581-821    AC A0A1G4JAP1.1
#=GS A0A178AY30_9PLEO/559-812    AC A0A178AY30.1
#=GS A0A1V6S0E5_9EURO/531-784    AC A0A1V6S0E5.1
#=GS A0A0D2EPL9_9EURO/555-807    AC A0A0D2EPL9.1
#=GS A0A218UIU8_9PASE/735-796    AC A0A218UIU8.1
#=GS A0A177VKY6_9BASI/789-1181   AC A0A177VKY6.1
#=GS A0A1I8GZ77_9PLAT/452-762    AC A0A1I8GZ77.1
#=GS W0T9K6_KLUMD/580-825        AC W0T9K6.1
#=GS I1N7Z9_SOYBN/489-828        AC I1N7Z9.1
#=GS A0A0F4YQT7_TALEM/531-784    AC A0A0F4YQT7.1
#=GS A0A026WWH0_OOCBI/488-764    AC A0A026WWH0.1
#=GS A0A0G4MMZ4_9PEZI/2521-2765  AC A0A0G4MMZ4.1
#=GS A0A238FEX2_9BASI/692-957    AC A0A238FEX2.1
#=GS A0A0C9UKP4_9HOMO/543-829    AC A0A0C9UKP4.1
#=GS H0YTB3_TAEGU/483-763        AC H0YTB3.1
#=GS A0A1W5CYM6_9LECA/544-795    AC A0A1W5CYM6.1
#=GS A0A1C7M6I6_GRIFR/468-765    AC A0A1C7M6I6.1
#=GS A0A0B4GP33_9HYPO/534-779    AC A0A0B4GP33.1
#=GS H0XA17_OTOGA/487-762        AC H0XA17.1
#=GS NCBP1_ARATH/479-814         AC Q9SIU2.2
#=GS A0A182V1T5_ANOME/24-310     AC A0A182V1T5.1
#=GS A0A1L1RQK9_CHICK/1-42       AC A0A1L1RQK9.1
#=GS K4AKQ7_SETIT/483-829        AC K4AKQ7.1
#=GS F9XIC9_ZYMTI/534-785        AC F9XIC9.1
#=GS A0A084FX57_9PEZI/537-776    AC A0A084FX57.1
#=GS B2VVN1_PYRTR/556-810        AC B2VVN1.1
#=GS G3BB60_CANTC/620-878        AC G3BB60.1
#=GS W3X2I8_PESFW/541-785        AC W3X2I8.1
#=GS B8APF3_ORYSI/471-817        AC B8APF3.1
#=GS A0A1Q9DRU3_SYMMI/1197-1409  AC A0A1Q9DRU3.1
#=GS A0A074SNC0_HAMHA/836-1116   AC A0A074SNC0.1
#=GS A0A0D2UPB5_CAPO3/632-939    AC A0A0D2UPB5.1
#=GS A0A1B8D2S1_9PEZI/534-779    AC A0A1B8D2S1.1
#=GS A0A194QDU2_PAPXU/21-297     AC A0A194QDU2.1
#=GS A0A2H3JXV5_WOLCO/535-840    AC A0A2H3JXV5.1
#=GS G8JUZ8_ERECY/578-824        AC G8JUZ8.1
#=GS A0A0N4V760_ENTVE/502-756    AC A0A0N4V760.2
#=GS R0HWP4_9BRAS/473-814        AC R0HWP4.1
#=GS V8NT05_OPHHA/422-695        AC V8NT05.1
#=GS A0A0D3BDL2_BRAOL/484-811    AC A0A0D3BDL2.1
#=GS A0A1S3TW25_VIGRR/1-252      AC A0A1S3TW25.1
#=GS A0A0C2FV02_9BILA/1-108      AC A0A0C2FV02.1
#=GS A0A162XBG2_DIDRA/751-1004   AC A0A162XBG2.1
#=GS A0A1Y1HIP1_KLENI/8-158      AC A0A1Y1HIP1.1
#=GS A0A0L0HNA1_SPIPN/523-800    AC A0A0L0HNA1.1
#=GS A0A0C4E5K4_MAGP6/541-788    AC A0A0C4E5K4.1
#=GS A0A200QUS7_9MAGN/492-829    AC A0A200QUS7.1
#=GS M7NT24_PNEMU/460-716        AC M7NT24.1
#=GS K0KXE4_WICCF/568-840        AC K0KXE4.1
#=GS A0A158Q6Q1_9BILA/507-768    AC A0A158Q6Q1.1
#=GS A0A0R3UKK7_9CEST/651-959    AC A0A0R3UKK7.2
#=GS G7PRW1_MACFA/475-750        AC G7PRW1.1
#=GS A0A0V0ZNM0_9BILA/512-675    AC A0A0V0ZNM0.1
#=GS A0A0V0W3X3_9BILA/487-764    AC A0A0V0W3X3.1
#=GS T1PBD2_MUSDO/488-771        AC T1PBD2.1
#=GS A0A0V1C9Y7_TRIBR/512-774    AC A0A0V1C9Y7.1
#=GS Q0UGB2_PHANO/647-900        AC Q0UGB2.2
#=GS A0A0L0UTP9_9BASI/619-991    AC A0A0L0UTP9.1
#=GS A0A287D3Z9_ICTTR/485-760    AC A0A287D3Z9.1
#=GS A0A0K0DHJ6_ANGCA/491-660    AC A0A0K0DHJ6.1
#=GS M5GC50_DACPD/570-871        AC M5GC50.1
#=GS A0A2I2ZGH0_GORGO/418-693    AC A0A2I2ZGH0.1
#=GS A0A1X7R021_9SACH/564-812    AC A0A1X7R021.1
#=GS NCBP1_CAEEL/489-768         AC O01763.3
#=GS A0A0D1XB98_9EURO/542-794    AC A0A0D1XB98.1
#=GS A0A2I3G0S7_NOMLE/399-674    AC A0A2I3G0S7.1
#=GS A0A0D9REV2_CHLSB/485-760    AC A0A0D9REV2.1
#=GS L0PFW0_PNEJ8/1-115          AC L0PFW0.1
#=GS A0A167KRK7_9BASI/576-878    AC A0A167KRK7.1
#=GS A0A2I0M5B7_COLLI/462-742    AC A0A2I0M5B7.1
#=GS A0A1I8BZT3_MELHA/478-814    AC A0A1I8BZT3.1
#=GS A0A0B2UV61_TOXCA/5-175      AC A0A0B2UV61.1
#=GS R9ALM1_WALI9/528-818        AC R9ALM1.1
#=GS H0GZD5_SACCK/578-825        AC H0GZD5.1
#=GS A0A150GSQ0_GONPE/590-762    AC A0A150GSQ0.1
#=GS A0A0M4E2J4_DROBS/486-700    AC A0A0M4E2J4.1
#=GS NCBP1_ASHGO/582-827         AC Q754H6.2
#=GS S6ENQ0_ZYGB2/585-754        AC S6ENQ0.1
#=GS A0A1S4BFB3_TOBAC/469-814    AC A0A1S4BFB3.1
#=GS A0A183MIW9_9TREM/612-954    AC A0A183MIW9.1
#=GS N1J947_BLUG1/530-769        AC N1J947.1
#=GS A0A0L0S6J2_ALLMA/545-800    AC A0A0L0S6J2.1
#=GS M7WDI9_RHOT1/709-986        AC M7WDI9.1
#=GS B9HP11_POPTR/485-830        AC B9HP11.2
#=GS A0A2I2UL89_FELCA/410-679    AC A0A2I2UL89.1
#=GS A0A1E4RLN9_9ASCO/674-920    AC A0A1E4RLN9.1
#=GS R1EFH6_BOTPV/627-881        AC R1EFH6.1
#=GS A0A146G0W8_9EURO/548-801    AC A0A146G0W8.1
#=GS NCBP1_DICDI/524-756         AC Q55D17.1
#=GS F6ZI49_XENTR/488-764        AC F6ZI49.1
#=GS A0A0R3T645_HYMNN/573-887    AC A0A0R3T645.1
#=GS J4W7Z6_BEAB2/534-789        AC J4W7Z6.1
#=GS A0A087UQ45_9ARAC/341-614    AC A0A087UQ45.1
#=GS A0A0V0W479_9BILA/471-748    AC A0A0V0W479.1
#=GS A0A2A4JLT7_HELVI/1-66       AC A0A2A4JLT7.1
#=GS A0A1D6RVT1_WHEAT/531-645    AC A0A1D6RVT1.1
#=GS A0A091I4X6_CALAN/444-724    AC A0A091I4X6.1
#=GS A0A1J9NZL3_9EURO/359-617    AC A0A1J9NZL3.1
#=GS A0A1E5RQ73_HANUV/624-874    AC A0A1E5RQ73.1
#=GS A0A1E1L6D8_9HELO/537-785    AC A0A1E1L6D8.1
#=GS Q6BLJ6_DEBHA/674-939        AC Q6BLJ6.1
#=GS A0A0H5C952_CYBJA/584-823    AC A0A0H5C952.1
#=GS A0A1Y1UNP5_9TREE/606-897    AC A0A1Y1UNP5.1
#=GS A0A1S3BQ48_CUCME/485-828    AC A0A1S3BQ48.1
#=GS A0A0D0B601_9HOMO/543-850    AC A0A0D0B601.1
#=GS M4AV18_XIPMA/485-766        AC M4AV18.1
#=GS U6G7J2_9EIME/828-985        AC U6G7J2.1
#=GS A0A067LWN8_9HOMO/535-823    AC A0A067LWN8.1
#=GS A0A1A6A871_9TREE/589-885    AC A0A1A6A871.1
#=GS H2AU78_KAZAF/579-812        AC H2AU78.1
#=GS A0A1D6K2X8_MAIZE/74-420     AC A0A1D6K2X8.1
#=GS I2K0B9_DEKBR/369-655        AC I2K0B9.2
#=GS A0A0C3PRH3_PHLGI/531-835    AC A0A0C3PRH3.1
#=GS K2QJ30_MACPH/499-753        AC K2QJ30.1
#=GS A0A0C2N1X6_THEKT/491-730    AC A0A0C2N1X6.1
#=GS N1QI61_SPHMS/567-818        AC N1QI61.1
#=GS A0A2I3GLG5_NOMLE/485-760    AC A0A2I3GLG5.1
#=GS W6A2M7_ICTPU/484-766        AC W6A2M7.1
#=GS A0A0V0W3U1_9BILA/485-762    AC A0A0V0W3U1.1
#=GS A0A0L6UA42_9BASI/648-1012   AC A0A0L6UA42.1
#=GS G4TF65_SERID/529-819        AC G4TF65.1
#=GS A0A179H7K3_9HYPO/534-779    AC A0A179H7K3.1
#=GS A0A0E0D0E4_9ORYZ/463-809    AC A0A0E0D0E4.1
#=GS A0A1S3ST51_SALSA/485-765    AC A0A1S3ST51.1
#=GS A0A093X5E1_9PEZI/534-785    AC A0A093X5E1.1
#=GS E5ABN2_LEPMJ/742-995        AC E5ABN2.1
#=GS A0A0L8I1R9_OCTBM/487-758    AC A0A0L8I1R9.1
#=GS W9X406_9EURO/538-790        AC W9X406.1
#=GS A0A1U8A4C5_NELNU/485-828    AC A0A1U8A4C5.1
#=GS A0A091G5E2_9AVES/474-754    AC A0A091G5E2.1
#=GS A0A0D1Z7K5_9EURO/540-792    AC A0A0D1Z7K5.1
#=GS A0A1I8G0E4_9PLAT/461-771    AC A0A1I8G0E4.1
#=GS H3DUI8_PRIPA/68-343         AC H3DUI8.1
#=GS T1GNS6_MEGSC/18-236         AC T1GNS6.1
#=GS A0A1Q5TEA8_9EURO/539-792    AC A0A1Q5TEA8.1
#=GS A0A1S3JU09_LINUN/488-761    AC A0A1S3JU09.1
#=GS F0ZKI8_DICPU/494-724        AC F0ZKI8.1
#=GS E3KEG4_PUCGT/487-821        AC E3KEG4.2
#=GS C4V887_NOSCE/295-389        AC C4V887.1
#=GS A0A015LJ81_9GLOM/314-574    AC A0A015LJ81.1
#=GS A0A0D1ZYX0_9PEZI/908-1170   AC A0A0D1ZYX0.1
#=GS A0A0B1NXU2_UNCNE/535-780    AC A0A0B1NXU2.1
#=GS F8PPT7_SERL3/540-853        AC F8PPT7.1
#=GS A0A1Y2G2Z9_9BASI/602-868    AC A0A1Y2G2Z9.1
#=GS A0A067CB45_SAPPC/616-817    AC A0A067CB45.1
#=GS G0WB81_NAUDC/580-755        AC G0WB81.1
#=GS A0A1A8W4L0_PLAMA/879-1089   AC A0A1A8W4L0.1
#=GS A0A176VS48_MARPO/489-844    AC A0A176VS48.1
#=GS W7IGH9_9PEZI/535-781        AC W7IGH9.1
#=GS A0A0R3SJB0_HYMDI/513-700    AC A0A0R3SJB0.1
#=GS J9J348_9SPIT/488-774        AC J9J348.1
#=GS A0A139AC44_GONPR/473-777    AC A0A139AC44.1
#=GS A0A1W2TLB9_ROSNE/531-770    AC A0A1W2TLB9.1
#=GS E9F5L4_METRA/538-783        AC E9F5L4.1
#=GS A0A225AFC9_9EURO/546-800    AC A0A225AFC9.1
#=GS A0A0D2J479_9EURO/535-787    AC A0A0D2J479.1
#=GS A0A1E3QFL2_LIPST/522-773    AC A0A1E3QFL2.1
#=GS B4LSE0_DROVI/496-710        AC B4LSE0.1
#=GS N1RS65_FUSC4/531-775        AC N1RS65.1
#=GS F0VR04_NEOCL/894-1134       AC F0VR04.1
#=GS A0A1E4SN74_9ASCO/649-908    AC A0A1E4SN74.1
#=GS A0A1S3ST44_SALSA/485-766    AC A0A1S3ST44.1
#=GS A0A084RQR2_STACH/535-780    AC A0A084RQR2.1
#=GS W5J8I3_ANODA/6-291          AC W5J8I3.1
#=GS G3H7F1_CRIGR/276-551        AC G3H7F1.1
#=GS A0A1L9MSQ8_ASPTU/548-801    AC A0A1L9MSQ8.1
#=GS M0SWM8_MUSAM/81-421         AC M0SWM8.1
#=GS A0A066WJ86_9BASI/636-951    AC A0A066WJ86.1
#=GS NCBP1_ORYSJ/483-829         AC Q10LJ0.1
#=GS A0A0V1MPI7_9BILA/490-752    AC A0A0V1MPI7.1
#=GS G0SE05_CHATD/536-786        AC G0SE05.1
#=GS G2XE50_VERDV/537-781        AC G2XE50.1
#=GS A0A0V1KN04_9BILA/510-787    AC A0A0V1KN04.1
#=GS E1Z775_CHLVA/534-793        AC E1Z775.1
#=GS A0A1L9VDH3_ASPGL/532-785    AC A0A1L9VDH3.1
#=GS X6R941_HUMAN/1-124          AC X6R941.1
#=GS A0A0E0GMC1_ORYNI/530-876    AC A0A0E0GMC1.1
#=GS M2ML26_BAUCO/552-803        AC M2ML26.1
#=GS A0A1X7UJX9_AMPQE/516-780    AC A0A1X7UJX9.1
#=GS A0A1D6K2X7_MAIZE/124-470    AC A0A1D6K2X7.1
#=GS M1VV04_CLAP2/553-807        AC M1VV04.1
#=GS E6ZW71_SPORE/641-959        AC E6ZW71.1
#=GS A0A0E0D0E2_9ORYZ/483-829    AC A0A0E0D0E2.1
#=GS C9S8W0_VERA1/460-704        AC C9S8W0.1
#=GS A0A0B2UWP0_TOXCA/547-823    AC A0A0B2UWP0.1
#=GS A0A251PR15_PRUPE/373-718    AC A0A251PR15.1
#=GS A0A0M8MQP6_9BASI/617-925    AC A0A0M8MQP6.1
#=GS A0A151IDL5_9HYME/498-774    AC A0A151IDL5.1
#=GS A0A0F8X6W2_9EURO/534-787    AC A0A0F8X6W2.1
#=GS W6QLA4_PENRF/531-784        AC W6QLA4.1
#=GS A0A0V1KLZ0_9BILA/510-765    AC A0A0V1KLZ0.1
#=GS A0A2I2U867_FELCA/516-791    AC A0A2I2U867.1
#=GS G1X9L4_ARTOA/544-790        AC G1X9L4.1
#=GS E9E5T2_METAQ/604-848        AC E9E5T2.1
#=GS A0A084QBE8_STAC4/545-790    AC A0A084QBE8.1
#=GS A0A1U7RSW8_ALLSI/480-760    AC A0A1U7RSW8.1
#=GS A0A1R3GP05_COCAP/484-829    AC A0A1R3GP05.1
#=GS A0A194XJ01_9HELO/529-776    AC A0A194XJ01.1
#=GS A0A162PQY1_PHYB8/540-812    AC A0A162PQY1.1
#=GS A0A183BVH2_GLOPA/465-568    AC A0A183BVH2.1
#=GS A0A165JR76_9BASI/573-875    AC A0A165JR76.1
#=GS A0A068RLR1_9FUNG/535-804    AC A0A068RLR1.1
#=GS A0A0C2SVC1_AMAMU/529-840    AC A0A0C2SVC1.1
#=GS A0A1D5XWX2_WHEAT/534-880    AC A0A1D5XWX2.1
#=GS A0A0D9Z790_9ORYZ/516-862    AC A0A0D9Z790.1
#=GS A0A0Q3PEA5_AMAAE/294-574    AC A0A0Q3PEA5.1
#=GS J3KLQ5_COCIM/532-785        AC J3KLQ5.2
#=GS A0A182Q9S1_9DIPT/521-726    AC A0A182Q9S1.1
#=GS A0A182YHU0_ANOST/12-294     AC A0A182YHU0.1
#=GS A0A094A8W6_9PEZI/534-785    AC A0A094A8W6.1
#=GS A0A1Y1W9M0_9FUNG/536-790    AC A0A1Y1W9M0.1
#=GS W6MLD3_9ASCO/663-881        AC W6MLD3.1
#=GS G3PX26_GASAC/498-780        AC G3PX26.1
#=GS A0A183E094_9BILA/122-198    AC A0A183E094.1
#=GS A0A0C2G297_9BILA/1-190      AC A0A0C2G297.1
#=GS A0A0F9Y2U7_TRIHA/533-778    AC A0A0F9Y2U7.1
#=GS C4R1D3_KOMPG/635-804        AC C4R1D3.1
#=GS A0A0M9VU67_9HYPO/533-781    AC A0A0M9VU67.1
#=GS A0A1B1E2I1_9APIC/862-1044   AC A0A1B1E2I1.1
#=GS E4XB39_OIKDI/505-584        AC E4XB39.1
#=GS A0A287NZ18_HORVV/511-857    AC A0A287NZ18.1
#=GS V4AG41_LOTGI/488-760        AC V4AG41.1
#=GS A0A183AS36_9TREM/148-288    AC A0A183AS36.1
#=GS A0A1C1X5M8_9PEZI/575-842    AC A0A1C1X5M8.1
#=GS A0C585_PARTE/471-686        AC A0C585.1
#=GS H0VLR0_CAVPO/459-734        AC H0VLR0.2
#=GS E9HSG0_DAPPU/486-779        AC E9HSG0.1
#=GS A0A2K5JE12_COLAP/485-760    AC A0A2K5JE12.1
#=GS A0A1Y3B454_EURMA/459-730    AC A0A1Y3B454.1
#=GS A0A090CDX4_PODAN/550-796    AC A0A090CDX4.1
#=GS A0A0D7ACD2_9AGAR/526-861    AC A0A0D7ACD2.1
#=GS A0A182Q9S1_9DIPT/468-531    AC A0A182Q9S1.1
#=GS V2XHE6_MONRO/531-843        AC V2XHE6.1
#=GS A0A0S6XJP0_9FUNG/556-806    AC A0A0S6XJP0.1
#=GS A0A1Y1Z7A9_9FUNG/529-775    AC A0A1Y1Z7A9.1
#=GS A0A182HEA1_AEDAL/1-208      AC A0A182HEA1.1
#=GS A0A182FS60_ANOAL/1-282      AC A0A182FS60.1
#=GS A0A061H137_9BASI/660-1034   AC A0A061H137.1
#=GS V9FGR1_PHYPR/604-856        AC V9FGR1.1
#=GS J9EBN4_WUCBA/332-503        AC J9EBN4.1
#=GS W9CCH7_9HELO/603-851        AC W9CCH7.1
#=GS A0A1D2VCP4_9ASCO/768-1023   AC A0A1D2VCP4.1
#=GS A0A093T3B9_PHACA/444-724    AC A0A093T3B9.1
#=GS A0A183E8Y0_9BILA/2-111      AC A0A183E8Y0.1
#=GS A0A178ZB25_9EURO/542-794    AC A0A178ZB25.1
#=GS W6YSZ7_COCMI/564-817        AC W6YSZ7.1
#=GS A0A2K5KP79_CERAT/485-760    AC A0A2K5KP79.1
#=GS U6GML4_EIMAC/790-1033       AC U6GML4.1
#=GS W9XJL5_9EURO/548-800        AC W9XJL5.1
#=GS A1CM21_ASPCL/541-794        AC A1CM21.1
#=GS V8NB45_OPHHA/410-682        AC V8NB45.1
#=GS A0A0F8BJB3_CERFI/535-804    AC A0A0F8BJB3.1
#=GS A6R994_AJECN/500-752        AC A6R994.1
#=GS L5KQH9_PTEAL/808-1083       AC L5KQH9.1
#=GS A0A0D2PP43_9AGAR/538-857    AC A0A0D2PP43.1
#=GS A0A2I3RA69_PANTR/485-760    AC A0A2I3RA69.1
#=GS A0A1U8N6C8_GOSHI/485-831    AC A0A1U8N6C8.1
#=GS A0A0V0W4J6_9BILA/495-772    AC A0A0V0W4J6.1
#=GS A0A1Y1ITB5_KLENI/213-427    AC A0A1Y1ITB5.1
#=GS A0A0N4T883_BRUPA/218-330    AC A0A0N4T883.1
#=GS F0UQX4_AJEC8/556-808        AC F0UQX4.1
#=GS A7AR12_BABBO/737-959        AC A7AR12.1
#=GS A0A100IH77_ASPNG/557-810    AC A0A100IH77.1
#=GS A0A1Z5TEM8_HORWE/556-806    AC A0A1Z5TEM8.1
#=GS H6BYI9_EXODN/537-789        AC H6BYI9.1
#=GS A0A165I6S9_9APHY/533-832    AC A0A165I6S9.1
#=GS A0A1A8W0Y8_9APIC/884-1102   AC A0A1A8W0Y8.1
#=GS A0A2H3H679_FUSOX/531-776    AC A0A2H3H679.1
#=GS NCBP1_AEDAE/488-783         AC Q16UN6.1
#=GS G1PRS5_MYOLU/474-749        AC G1PRS5.1
#=GS A0A182RSG4_ANOFN/1-236      AC A0A182RSG4.1
#=GS A0A1V6N7F5_9EURO/531-784    AC A0A1V6N7F5.1
#=GS A0A093RI00_PYGAD/462-742    AC A0A093RI00.1
#=GS A0A2G3BCC5_CAPCH/485-827    AC A0A2G3BCC5.1
#=GS G4UD99_NEUT9/533-786        AC G4UD99.1
#=GS A4RZY8_OSTLU/213-445        AC A4RZY8.1
#=GS A0A2H3T545_FUSOX/531-776    AC A0A2H3T545.1
#=GS A0A2G9H3Y7_9LAMI/485-826    AC A0A2G9H3Y7.1
#=GS Q4UGZ6_THEAN/708-949        AC Q4UGZ6.1
#=GS A0A135TKZ0_9PEZI/539-785    AC A0A135TKZ0.1
#=GS A0A091CMF8_FUKDA/413-542    AC A0A091CMF8.1
#=GS A0A0N5CYW2_THECL/527-792    AC A0A0N5CYW2.1
#=GS W9XQM4_9EURO/539-791        AC W9XQM4.1
#=GS I4YFG6_WALMC/517-808        AC I4YFG6.1
#=GS A0A067QQW6_9HOMO/541-846    AC A0A067QQW6.1
#=GS A0A2I3MJE3_PAPAN/399-674    AC A0A2I3MJE3.1
#=GS A0A2I2YF43_GORGO/484-759    AC A0A2I2YF43.1
#=GS A0A1V6YZX3_PENNA/531-784    AC A0A1V6YZX3.1
#=GS A0A1E5VRZ3_9POAL/392-747    AC A0A1E5VRZ3.1
#=GS H0GL41_SACCK/578-825        AC H0GL41.1
#=GS A0A2B7WGA8_9EURO/541-793    AC A0A2B7WGA8.1
#=GS A0A0L1HPT4_9PLEO/1067-1320  AC A0A0L1HPT4.1
#=GS A0A0C3C356_9HOMO/541-856    AC A0A0C3C356.1
#=GS A0A179V4R3_BLAGS/559-818    AC A0A179V4R3.1
#=GS A0A151NE25_ALLMI/484-764    AC A0A151NE25.1
#=GS A0A0C3B106_9HOMO/529-820    AC A0A0C3B106.1
#=GS A0A0V1PAT1_9BILA/657-777    AC A0A0V1PAT1.1
#=GS E6R1F1_CRYGW/587-885        AC E6R1F1.1
#=GS A0A182T382_9DIPT/1-281      AC A0A182T382.1
#=GS A0A1X2I935_9FUNG/533-805    AC A0A1X2I935.1
#=GS W5PNL6_SHEEP/487-762        AC W5PNL6.1
#=GS A0A183WZJ3_TRIRE/1-167      AC A0A183WZJ3.1
#=GS A0A0V0W484_9BILA/495-757    AC A0A0V0W484.1
#=GS A0A0A2VE17_BEABA/534-788    AC A0A0A2VE17.1
#=GS NCBP1_DROPS/488-770         AC Q29G82.1
#=GS A0A0P0VXC6_ORYSJ/66-412     AC A0A0P0VXC6.1
#=GS J4GS84_9APHY/535-843        AC J4GS84.1
#=GS A0A2H3ZAZ5_PHODC/483-828    AC A0A2H3ZAZ5.1
#=GS A0A0D3FIE9_9ORYZ/483-829    AC A0A0D3FIE9.1
#=GS A0A166DVT6_9HOMO/531-813    AC A0A166DVT6.1
#=GS U6LAT1_EIMTE/168-380        AC U6LAT1.1
#=GS M9M7J7_PSEA3/633-929        AC M9M7J7.1
#=GS A0A2D3VJ10_9PEZI/560-811    AC A0A2D3VJ10.1
#=GS C7YU08_NECH7/533-778        AC C7YU08.1
#=GS G3JGQ9_CORMM/555-803        AC G3JGQ9.1
#=GS Q5KMU1_CRYNJ/587-885        AC Q5KMU1.1
#=GS A0A024TE12_9STRA/641-769    AC A0A024TE12.1
#=GS A0A226NEY1_CALSU/448-724    AC A0A226NEY1.1
#=GS A0A067NZ14_PLEOS/550-856    AC A0A067NZ14.1
#=GS A0A0G4MMZ4_9PEZI/1971-2215  AC A0A0G4MMZ4.1
#=GS A0A013VIN7_9SPHN/43-160     AC A0A013VIN7.1
#=GS A0A2H3ZQA9_PHODC/463-807    AC A0A2H3ZQA9.1
#=GS A0A0F4GTG5_9PEZI/559-810    AC A0A0F4GTG5.1
#=GS U4TQ91_DENPD/16-284         AC U4TQ91.1
#=GS A0A1I8MX69_MUSDO/19-298     AC A0A1I8MX69.1
#=GS A0A1S9DA39_ASPOZ/529-782    AC A0A1S9DA39.1
#=GS A0A194RIN0_PAPMA/26-261     AC A0A194RIN0.1
#=GS M4BIG7_HYAAE/207-459        AC M4BIG7.1
#=GS E3QAL0_COLGM/535-781        AC E3QAL0.1
#=GS A0A1S3RRL3_SALSA/485-765    AC A0A1S3RRL3.1
#=GS I7M7J6_TETTS/614-872        AC I7M7J6.1
#=GS A0A1X7S087_ZYMTR/559-810    AC A0A1X7S087.1
#=GS A0A0V0Y0P9_TRIPS/258-520    AC A0A0V0Y0P9.1
#=GS H3GMP6_PHYRM/614-860        AC H3GMP6.1
#=GS A0A016WZ31_9BILA/488-747    AC A0A016WZ31.1
#=GS J9VFC5_CRYNH/587-885        AC J9VFC5.2
#=GS A9S1J0_PHYPA/495-842        AC A9S1J0.1
#=GS A0A0R3WB30_TAEAS/622-950    AC A0A0R3WB30.1
#=GS A1DM04_NEOFI/529-782        AC A1DM04.1
#=GS A0A059D9L3_EUCGR/68-412     AC A0A059D9L3.1
#=GS R4X9M8_TAPDE/503-766        AC R4X9M8.1
#=GS A0A1S3FQC8_DIPOR/492-767    AC A0A1S3FQC8.1
#=GS E9CS92_COCPS/532-785        AC E9CS92.1
#=GS A0A1A9WAT5_9MUSC/7-270      AC A0A1A9WAT5.1
#=GS A0A194V8W7_9PEZI/574-831    AC A0A194V8W7.1
#=GS A0A1Y2G5P3_9FUNG/567-829    AC A0A1Y2G5P3.1
#=GS A0A1Y1YIV7_9PLEO/542-796    AC A0A1Y1YIV7.1
#=GS A0A2C5ZX71_9HYPO/534-781    AC A0A2C5ZX71.1
#=GS A0A182E5C2_ONCOC/552-816    AC A0A182E5C2.1
#=GS A0A1D6K2X6_MAIZE/1-286      AC A0A1D6K2X6.1
#=GS F0XRE3_GROCL/583-838        AC F0XRE3.1
#=GS A0A0D3E2U7_BRAOL/301-596    AC A0A0D3E2U7.1
#=GS A0A2G8KM06_STIJA/431-705    AC A0A2G8KM06.1
#=GS A0A212F7L2_DANPL/487-767    AC A0A212F7L2.1
#=GS A0A2C5X7X8_9PEZI/535-804    AC A0A2C5X7X8.1
#=GS W7MK74_GIBM7/531-776        AC W7MK74.1
#=GS A0A1C1CQN4_9EURO/451-703    AC A0A1C1CQN4.1
#=GS A0A074XXI9_9PEZI/537-788    AC A0A074XXI9.1
#=GS A0A094F7J6_9PEZI/549-800    AC A0A094F7J6.1
#=GS A0A1Y2ATD1_9TREE/508-805    AC A0A1Y2ATD1.1
#=GS A0A0P7WT97_9TELE/450-693    AC A0A0P7WT97.1
#=GS A0A1X1BHP6_9APIC/754-979    AC A0A1X1BHP6.1
#=GS A0A1U8MNA5_GOSHI/500-846    AC A0A1U8MNA5.1
#=GS G0WF93_NAUDC/582-835        AC G0WF93.1
#=GS NCBP1_DROME/488-770         AC Q7K4N3.1
#=GS W4KGI1_9HOMO/537-838        AC W4KGI1.1
#=GS A0A2A4IXL6_HELVI/8-216      AC A0A2A4IXL6.1
#=GS K1VU75_TRIAC/513-813        AC K1VU75.1
#=GS A0A067R587_ZOONE/487-775    AC A0A067R587.1
#=GS F6ZXS3_ORNAN/474-623        AC F6ZXS3.1
#=GS T1HND5_RHOPR/491-769        AC T1HND5.1
#=GS A0A0G2IYJ0_9EURO/566-823    AC A0A0G2IYJ0.1
#=GS A0A0K8L8H3_9EURO/529-791    AC A0A0K8L8H3.1
#=GS A0A0C3GXC8_9PEZI/524-771    AC A0A0C3GXC8.1
#=GS G8BCS6_CANPC/643-904        AC G8BCS6.1
#=GS A0A0V1PBN6_9BILA/490-752    AC A0A0V1PBN6.1
#=GS A0A195AT54_9HYME/528-802    AC A0A195AT54.1
#=GS D6W9J4_TRICA/8-280          AC D6W9J4.2
#=GS A0A0L0NHN1_9HYPO/531-776    AC A0A0L0NHN1.1
#=GS A0A1Y2EGM1_9FUNG/519-803    AC A0A1Y2EGM1.1
#=GS A0A1G4KL50_9SACH/581-821    AC A0A1G4KL50.1
#=GS A0A0G4IX35_PLABS/559-706    AC A0A0G4IX35.1
#=GS A0A1D6RVT3_WHEAT/666-874    AC A0A1D6RVT3.1
#=GS A0A182JWI5_9DIPT/6-289      AC A0A182JWI5.1
#=GS A0A284QXT3_9AGAR/520-815    AC A0A284QXT3.1
#=GS A0A0A2JUZ3_PENEN/531-784    AC A0A0A2JUZ3.1
#=GS A0A0R3PMY3_ANGCS/475-640    AC A0A0R3PMY3.1
#=GS A0A1D6K2V4_MAIZE/137-483    AC A0A1D6K2V4.1
#=GS A0A1B8CNJ7_9PEZI/534-785    AC A0A1B8CNJ7.1
#=GS A0A0C2X9S7_HEBCY/536-856    AC A0A0C2X9S7.1
#=GS A0A0N1P1T4_9EURO/543-788    AC A0A0N1P1T4.1
#=GS A0A0P5IV70_9CRUS/486-779    AC A0A0P5IV70.1
#=GS A0A182L8H1_9DIPT/11-294     AC A0A182L8H1.1
#=GS C5DI24_LACTC/581-829        AC C5DI24.1
#=GS A0A1V6QAU9_9EURO/531-784    AC A0A1V6QAU9.1
#=GS I1MLB1_SOYBN/485-828        AC I1MLB1.2
#=GS A0A094CF23_9PEZI/534-785    AC A0A094CF23.1
#=GS G4VPN2_SCHMA/522-896        AC G4VPN2.1
#=GS A0A0D2W9D3_GOSRA/483-829    AC A0A0D2W9D3.1
#=GS A0A0N4ZFL0_PARTI/493-768    AC A0A0N4ZFL0.1
#=GS A0A091LIY9_CATAU/358-638    AC A0A091LIY9.1
#=GS A0A1D6K2V7_MAIZE/443-789    AC A0A1D6K2V7.1
#=GS A0A0F0I9Q9_ASPPU/529-782    AC A0A0F0I9Q9.1
#=GS B7Q634_IXOSC/481-749        AC B7Q634.1
#=GS A0A152A233_9MYCE/489-709    AC A0A152A233.1
#=GS A0A010Q1H3_9PEZI/545-791    AC A0A010Q1H3.1
#=GS G7YES0_CLOSI/524-852        AC G7YES0.1
#=GS G1S4W7_NOMLE/484-759        AC G1S4W7.2
#=GS K7FR76_PELSI/202-482        AC K7FR76.1
#=GS A0A1V8SXE7_9PEZI/559-810    AC A0A1V8SXE7.1
#=GS A0A1A9Y8W0_GLOFF/3-254      AC A0A1A9Y8W0.1
#=GS A0A078A463_STYLE/472-727    AC A0A078A463.1
#=GS A0A061GTR0_THECC/484-830    AC A0A061GTR0.1
#=GS J3P394_GAGT3/538-792        AC J3P394.1
#=GS A0A0P7B6P1_9HYPO/534-779    AC A0A0P7B6P1.1
#=GS A0A177UPK9_9BASI/692-1080   AC A0A177UPK9.1
#=GS A0A0B2WQP4_9HYPO/534-780    AC A0A0B2WQP4.1
#=GS A0A1D6K2V6_MAIZE/538-884    AC A0A1D6K2V6.1
#=GS A0A182J1C2_9DIPT/5-267      AC A0A182J1C2.1
#=GS A0A167W2D8_9HYPO/535-773    AC A0A167W2D8.1
#=GS A0A2B7WM85_9EURO/561-813    AC A0A2B7WM85.1
#=GS A0A0H2RDM1_9HOMO/527-814    AC A0A0H2RDM1.1
#=GS G2YWH9_BOTF4/338-585        AC G2YWH9.1
#=GS M2T3B7_COCH5/564-819        AC M2T3B7.1
#=GS A0A093H9N5_STRCA/499-777    AC A0A093H9N5.1
#=GS D0MS56_PHYIT/605-857        AC D0MS56.1
#=GS M1URS2_CYAM1/727-1017       AC M1URS2.1
#=GS A0A136J743_9PEZI/534-773    AC A0A136J743.1
#=GS M5WNM4_PRUPE/485-830        AC M5WNM4.1
#=GS A0A068YAH4_ECHMU/628-946    AC A0A068YAH4.1
#=GS A0A180GCG6_PUCT1/625-960    AC A0A180GCG6.1
#=GS A0A093HJ93_STRCA/444-717    AC A0A093HJ93.1
#=GS A0A0E0GMC2_ORYNI/483-829    AC A0A0E0GMC2.1
#=GS A0A2H3E336_ARMGA/520-815    AC A0A2H3E336.1
#=GS A0A0F2M4P4_SPOSC/607-939    AC A0A0F2M4P4.1
#=GS A0A182NQV2_9DIPT/1-282      AC A0A182NQV2.1
#=GS A0A0E0KDN5_ORYPU/442-788    AC A0A0E0KDN5.1
#=GS A0A287D7F1_ICTTR/449-724    AC A0A287D7F1.1
#=GS A0A1B9I912_9TREE/593-882    AC A0A1B9I912.1
#=GS A0A1I8GTG6_9PLAT/742-1052   AC A0A1I8GTG6.1
#=GS A0A0A0M082_CUCSA/485-828    AC A0A0A0M082.1
#=GS NCBP1_CAEBR/487-763         AC A8XG63.3
#=GS S8ADJ2_DACHA/535-781        AC S8ADJ2.1
#=GS G3UGQ0_LOXAF/485-760        AC G3UGQ0.1
#=GS A0A2G2YIC8_CAPAN/485-827    AC A0A2G2YIC8.1
#=GS K9GB08_PEND2/520-773        AC K9GB08.1
#=GS C3Y2C6_BRAFL/446-544        AC C3Y2C6.1
#=GS X0CZL2_FUSOX/531-776        AC X0CZL2.1
#=GS A0A090N3S9_OSTTA/510-740    AC A0A090N3S9.1
#=GS A0A0V1KLW1_9BILA/510-772    AC A0A0V1KLW1.1
#=GS A0A059IYW6_9EURO/548-801    AC A0A059IYW6.1
#=GS B6K6M4_SCHJY/513-724        AC B6K6M4.1
#=GS A0A250WP45_9CHLO/634-1008   AC A0A250WP45.1
#=GS A0A0A2KK18_PENIT/534-787    AC A0A0A2KK18.1
#=GS A0A1B8GSX3_9PEZI/534-785    AC A0A1B8GSX3.1
#=GS A0A0J6Y631_COCIT/532-785    AC A0A0J6Y631.1
#=GS A0A093XLE1_9PEZI/534-785    AC A0A093XLE1.1
#=GS A0A094IIM4_9PEZI/549-800    AC A0A094IIM4.1
#=GS A0A0N4TG51_BRUPA/1-160      AC A0A0N4TG51.1
#=GS A0A161VER2_9PEZI/546-792    AC A0A161VER2.1
#=GS G1LDU0_AILME/487-762        AC G1LDU0.1
#=GS M3HQQ7_CANMX/613-790        AC M3HQQ7.1
#=GS B4I3F9_DROSE/496-719        AC B4I3F9.1
#=GS A0A1Z5TEZ1_HORWE/557-807    AC A0A1Z5TEZ1.1
#=GS A0A167MD15_9HYPO/533-785    AC A0A167MD15.1
#=GS F9FRW4_FUSOF/531-776        AC F9FRW4.1
#=GS W9WCJ0_9EURO/542-794        AC W9WCJ0.1
#=GS A0A0U1M141_TALIS/531-784    AC A0A0U1M141.1
#=GS NCBP1_YEAST/581-828         AC P34160.2
#=GS G3ATF2_SPAPN/671-853        AC G3ATF2.1
#=GS NCBP1_DROVI/552-753         AC B4M7T6.1
#=GS A0A024GLJ2_9STRA/647-873    AC A0A024GLJ2.1
#=GS A0A158NPN5_ATTCE/488-762    AC A0A158NPN5.1
#=GS C5DQ64_ZYGRC/585-760        AC C5DQ64.1
#=GS U4L4H6_PYROM/539-791        AC U4L4H6.1
#=GS A0A0J7NBX7_LASNI/408-640    AC A0A0J7NBX7.1
#=GS C1GXS9_PARBA/567-819        AC C1GXS9.2
#=GS L1IJA4_GUITH/538-815        AC L1IJA4.1
#=GS V7CU42_PHAVU/486-827        AC V7CU42.1
#=GS A0A1F5LTQ7_9EURO/531-784    AC A0A1F5LTQ7.1
#=GS A0A088A145_APIME/488-764    AC A0A088A145.1
#=GS A0A094DN20_9PEZI/550-800    AC A0A094DN20.1
#=GS A0A286ULN3_9HOMO/535-820    AC A0A286ULN3.1
#=GS A0A1D6K2X2_MAIZE/137-386    AC A0A1D6K2X2.1
#=GS A0A1V4J6J9_PATFA/481-761    AC A0A1V4J6J9.1
#=GS A0A1Q8RKW6_9PEZI/538-784    AC A0A1Q8RKW6.1
#=GS A0A218WME2_PUNGR/485-831    AC A0A218WME2.1
#=GS A0A1L9SZE2_9EURO/530-783    AC A0A1L9SZE2.1
#=GS A0A1L8HX89_XENLA/485-761    AC A0A1L8HX89.1
#=GS A0A137QAE7_9AGAR/530-841    AC A0A137QAE7.1
#=GS A0A0C9YV80_9HOMO/543-848    AC A0A0C9YV80.1
#=GS G5C1C6_HETGA/252-527        AC G5C1C6.1
#=GS A0A0P0VXC8_ORYSJ/1-244      AC A0A0P0VXC8.1
#=GS A0A0C3DJ93_9HOMO/544-850    AC A0A0C3DJ93.1
#=GS A0A0A1NA79_9FUNG/153-420    AC A0A0A1NA79.1
#=GS A0A1S8W419_9FUNG/531-800    AC A0A1S8W419.1
#=GS A0A154PSU0_9HYME/488-764    AC A0A154PSU0.1
#=GS A0A1B9GWC1_9TREE/588-886    AC A0A1B9GWC1.1
#=GS A5DTG5_LODEL/721-913        AC A5DTG5.1
#=GS A0A093YR42_9PEZI/534-785    AC A0A093YR42.1
#=GS W4GQH0_9STRA/654-868        AC W4GQH0.1
#=GS K8EBJ4_9CHLO/510-783        AC K8EBJ4.1
#=GS A0A2B7XVE1_9EURO/534-787    AC A0A2B7XVE1.1
#=GS A0A077ZBZ7_TRITR/409-664    AC A0A077ZBZ7.1
#=GS A0A093FVP3_GAVST/444-724    AC A0A093FVP3.1
#=GS A0A0N0P9G8_PAPXU/41-313     AC A0A0N0P9G8.1
#=GS A0A0P1BIA5_9BASI/737-1103   AC A0A0P1BIA5.1
#=GS A0A091PUG5_HALAL/444-724    AC A0A091PUG5.1
#=GS NCBP1_DROPE/488-770         AC B4GW22.1
#=GS A0A0W7VGT1_9HYPO/518-763    AC A0A0W7VGT1.1
#=GS U5HA64_USTV1/692-970        AC U5HA64.1
#=GS A0A167UN26_9PEZI/605-861    AC A0A167UN26.1
#=GS A0A0V0TEK0_9BILA/514-776    AC A0A0V0TEK0.1
#=GS B1N4Y9_ENTHI/2-83           AC B1N4Y9.1
#=GS A0A1Y2HV68_9FUNG/457-608    AC A0A1Y2HV68.1
#=GS G4YES6_PHYSP/618-870        AC G4YES6.1
#=GS A0A2H3FKG4_9HELO/534-779    AC A0A2H3FKG4.1
#=GS D3BF03_POLPP/465-691        AC D3BF03.1
#=GS B9RIH1_RICCO/444-789        AC B9RIH1.1
#=GS J9EFK0_WUCBA/484-675        AC J9EFK0.1
#=GS A0A091CMF8_FUKDA/333-418    AC A0A091CMF8.1
#=GS A0A1D6K2X5_MAIZE/141-487    AC A0A1D6K2X5.1
#=GS G2QS19_THITE/535-793        AC G2QS19.1
#=GS NCBP1_DROMO/488-770         AC B4L2J8.1
#=GS A0A1I7XEC4_HETBA/492-619    AC A0A1I7XEC4.1
#=GS C4JPG9_UNCRE/529-782        AC C4JPG9.1
#=GS A0A0L6WMN3_9AGAR/545-843    AC A0A0L6WMN3.1
#=GS A0A1Z5S9J1_SORBI/483-829    AC A0A1Z5S9J1.1
#=GS I1RT35_GIBZE/532-777        AC I1RT35.1
#=GS F4W7L2_ACREC/18-291         AC F4W7L2.1
#=GS S7PPW1_MYOBR/483-758        AC S7PPW1.1
#=GS C6HGR2_AJECH/477-709        AC C6HGR2.1
#=GS A0A0L1J250_ASPNO/554-805    AC A0A0L1J250.1
#=GS A0A091EPF3_CORBR/444-724    AC A0A091EPF3.1
#=GS R9P1P9_PSEHS/526-840        AC R9P1P9.1
#=GS J3LNQ4_ORYBR/483-828        AC J3LNQ4.1
#=GS A0A177WVJ4_BATDE/518-788    AC A0A177WVJ4.1
#=GS A0A1D5XT71_WHEAT/483-829    AC A0A1D5XT71.1
#=GS A0A226PNU8_COLVI/29-305     AC A0A226PNU8.1
#=GS M3VW75_FELCA/470-739        AC M3VW75.2
#=GS M5BLJ3_THACB/522-726        AC M5BLJ3.1
#=GS L8X8T5_THACA/522-802        AC L8X8T5.1
#=GS A0A0D0AV19_9AGAR/534-847    AC A0A0D0AV19.1
#=GS W2LIH0_PHYPR/604-856        AC W2LIH0.1
#=GS D7T129_VITVI/485-830        AC D7T129.1
#=GS A0A1W4WJ55_AGRPL/487-766    AC A0A1W4WJ55.1
#=GS A0A0M8P211_9EURO/531-784    AC A0A0M8P211.1
#=GS A0A177CE24_9PLEO/557-811    AC A0A177CE24.1
#=GS Q4Z3J7_PLABA/85-308         AC Q4Z3J7.1
#=GS A0A1B0CVJ0_LUTLO/11-117     AC A0A1B0CVJ0.1
#=GS G0VGQ5_NAUCC/583-831        AC G0VGQ5.1
#=GS A0A1D6RVT2_WHEAT/678-886    AC A0A1D6RVT2.1
#=GS A0A2C5XL02_9HYPO/535-777    AC A0A2C5XL02.1
#=GS A0A0V0S086_9BILA/466-715    AC A0A0V0S086.1
#=GS A0A1E4RTW3_CYBJA/573-812    AC A0A1E4RTW3.1
#=GS E1BMM0_BOVIN/485-760        AC E1BMM0.2
#=GS W2RVM6_9EURO/542-793        AC W2RVM6.1
#=GS V5ENX7_KALBG/658-969        AC V5ENX7.1
#=GS A5DCB1_PICGU/640-902        AC A5DCB1.2
#=GS A0A1S3TVT3_VIGRR/491-827    AC A0A1S3TVT3.1
#=GS Q6CH33_YARLI/537-707        AC Q6CH33.1
#=GS A0A091SIX8_9AVES/187-467    AC A0A091SIX8.1
#=GS C5MAR3_CANTT/620-797        AC C5MAR3.1
#=GS A0A0A0A8E0_CHAVO/186-466    AC A0A0A0A8E0.1
#=GS S8D3A0_9LAMI/487-821        AC S8D3A0.1
#=GS A0A1G4K715_9SACH/581-829    AC A0A1G4K715.1
#=GS A0A0J8R493_COCIT/532-785    AC A0A0J8R493.1
#=GS A0A1W0WKL7_HYPDU/516-782    AC A0A1W0WKL7.1
#=GS M3AD00_PSEFD/560-811        AC M3AD00.1
#=GS NCBP1_XENTR/485-761         AC Q6DIE2.1
#=GS A0A1L0DEC1_9ASCO/661-929    AC A0A1L0DEC1.1
#=GS A0A093FXU4_DRYPU/455-735    AC A0A093FXU4.1
#=GS R1EHV8_EMIHU/505-759        AC R1EHV8.1
#=GS E3NEH5_CAERE/504-779        AC E3NEH5.1
#=GS S9XU20_CAMFR/244-494        AC S9XU20.1
#=GS A0A1D6K2V8_MAIZE/357-703    AC A0A1D6K2V8.1
#=GS A0A066X9Z7_COLSU/534-780    AC A0A066X9Z7.1
#=GS A0A1U7T2V3_TARSY/1-153      AC A0A1U7T2V3.1
#=GS A0A093Q1T5_9PASS/444-724    AC A0A093Q1T5.1
#=GS Q4N8N4_THEPA/710-964        AC Q4N8N4.1
#=GS W6NQB7_HAECO/631-891        AC W6NQB7.1
#=GS Q4WDL2_ASPFU/362-611        AC Q4WDL2.1
#=GS G3QGA9_GORGO/485-760        AC G3QGA9.2
#=GS W4Y6T8_STRPU/494-770        AC W4Y6T8.1
#=GS A0A1W4VZW0_DROFC/497-721    AC A0A1W4VZW0.1
#=GS A0A0K6FSW1_9HOMO/543-823    AC A0A0K6FSW1.1
#=GS W1QCA3_OGAPD/671-917        AC W1QCA3.1
#=GS A0A1B7NR61_9EURO/546-749    AC A0A1B7NR61.1
#=GS A0A101M9Z8_9EURO/531-784    AC A0A101M9Z8.1
#=GS G8BVZ2_TETPH/580-828        AC G8BVZ2.1
#=GS A0A0K9QQ75_SPIOL/496-811    AC A0A0K9QQ75.1
#=GS A0A0D2AUR0_9EURO/543-795    AC A0A0D2AUR0.1
#=GS A0A0N4YK42_NIPBR/693-912    AC A0A0N4YK42.2
#=GS V4MF45_EUTSA/484-814        AC V4MF45.1
#=GS A0A091Q804_LEPDC/444-724    AC A0A091Q804.1
#=GS A0A182UHZ3_9DIPT/14-299     AC A0A182UHZ3.1
#=GS A0A1D6RVT1_WHEAT/678-886    AC A0A1D6RVT1.1
#=GS F2PUZ7_TRIEC/541-794        AC F2PUZ7.1
#=GS A0A074YS93_AURPU/536-787    AC A0A074YS93.1
#=GS X1XHK1_ACYPI/1-136          AC X1XHK1.1
#=GS A0A0W8D1U9_PHYNI/604-856    AC A0A0W8D1U9.1
#=GS A0A0D0DS55_9HOMO/544-867    AC A0A0D0DS55.1
#=GS H0EIC4_GLAL7/760-946        AC H0EIC4.1
#=GS A0A1D6RVT2_WHEAT/531-645    AC A0A1D6RVT2.1
#=GS A0A1B0FFF1_GLOMM/489-772    AC A0A1B0FFF1.1
#=GS F7AA70_XENTR/484-760        AC F7AA70.1
#=GS A0A1B0DJX8_PHLPP/1-271      AC A0A1B0DJX8.1
#=GS A0A0N5AUR6_9BILA/501-762    AC A0A0N5AUR6.1
#=GS A0A1V8UBP4_9PEZI/557-808    AC A0A1V8UBP4.1
#=GS A0A2A9PB92_9HYPO/536-778    AC A0A2A9PB92.1
#=GS B9QCY2_TOXGV/839-1114       AC B9QCY2.1
#=GS U6LS04_9EIME/792-994        AC U6LS04.1
#=GS A0A0D8Y6M5_DICVI/129-382    AC A0A0D8Y6M5.1
#=GS A0A1V6PMX9_9EURO/532-785    AC A0A1V6PMX9.1
#=GS A0A1Q2YI43_9ASCO/802-1047   AC A0A1Q2YI43.1
#=GS A0A0R3RDS9_9BILA/1-89       AC A0A0R3RDS9.1
#=GS A0A197KG16_9FUNG/563-821    AC A0A197KG16.1
#=GS A0A1R1Y852_9FUNG/673-916    AC A0A1R1Y852.1
#=GS F7DG19_HORSE/473-748        AC F7DG19.1
#=GS B4NU09_DROSI/1-276          AC B4NU09.1
#=GS A0A0P1AD86_9STRA/607-861    AC A0A0P1AD86.1
#=GS NCBP1_HUMAN/485-760         AC Q09161.1
#=GS NCBP1_HUMAN/485-760         DR PDB; 3FEX A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OOB C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 G; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2V C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2T C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 P; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1N54 A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OOB I; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2U B; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OOB F; 498-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 M; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K B; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1N52 A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 J; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 3FEY A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2U A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 6D0Y C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 V; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OOB A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 D; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 5OO6 S; 485-760;
#=GS A0A135LQB8_PENPA/531-784    AC A0A135LQB8.1
#=GS A0A0N0V7F8_FUSLA/532-777    AC A0A0N0V7F8.1
#=GS A0A0J8RXD1_COCIT/512-765    AC A0A0J8RXD1.1
#=GS A0A0S7DEN9_9EURO/529-782    AC A0A0S7DEN9.1
#=GS A0A0D2E9Y8_9EURO/540-792    AC A0A0D2E9Y8.1
#=GS I1BQW9_RHIO9/543-807        AC I1BQW9.1
#=GS E2AC77_CAMFO/488-764        AC E2AC77.1
#=GS A0A0R3X3V2_HYDTA/565-899    AC A0A0R3X3V2.1
#=GS A0A165DYG8_EXIGL/560-843    AC A0A165DYG8.1
#=GS A0A0L7LUP8_9NEOP/6-205      AC A0A0L7LUP8.1
#=GS W5MTK1_LEPOC/490-771        AC W5MTK1.1
#=GS I1H5J0_BRADI/483-829        AC I1H5J0.1
#=GS E0VJH5_PEDHC/460-735        AC E0VJH5.1
#=GS E5SWE1_TRISP/494-764        AC E5SWE1.1
#=GS A0A0F7VEW1_9EURO/535-788    AC A0A0F7VEW1.1
#=GS A0A0D2FBL8_9EURO/536-788    AC A0A0D2FBL8.1
#=GS A0A194SD53_RHOGW/1349-1632  AC A0A194SD53.1
#=GS A0A067SWU0_GALM3/537-857    AC A0A067SWU0.1
#=GS A0A0B1SE47_OESDE/4-235      AC A0A0B1SE47.1
#=GS S0DTB1_GIBF5/531-776        AC S0DTB1.1
#=GS B4JE26_DROGR/498-712        AC B4JE26.1
#=GS A0A0E0D0E6_9ORYZ/419-744    AC A0A0E0D0E6.1
#=GS A0A1L9S994_9EURO/535-788    AC A0A1L9S994.1
#=GS H2QXJ3_PANTR/484-759        AC H2QXJ3.2
#=GS A0A0G2ETS1_9EURO/477-729    AC A0A0G2ETS1.1
#=GS G8YCN1_PICSO/650-914        AC G8YCN1.1
#=GS A0A094ECF2_9PEZI/534-785    AC A0A094ECF2.1
#=GS B0DK62_LACBS/550-863        AC B0DK62.1
#=GS A0A072PND4_9EURO/542-794    AC A0A072PND4.1
#=GS NCBP1_DROGR/488-770         AC B4JM29.1
#=GS A0A094D5U6_9PEZI/549-800    AC A0A094D5U6.1
#=GS C1GGW1_PARBD/565-817        AC C1GGW1.1
#=GS H3B1S7_LATCH/487-774        AC H3B1S7.1
#=GS A0A0D1DTA6_USTMA/651-975    AC A0A0D1DTA6.1
#=GS A0A0F7ZZG8_9HYPO/534-779    AC A0A0F7ZZG8.1
#=GS A7EUS0_SCLS1/1-149          AC A7EUS0.1
#=GS A0A182PJ47_9DIPT/2-285      AC A0A182PJ47.1
#=GS A0A1V6QHL3_9EURO/531-784    AC A0A1V6QHL3.1
#=GS A0A1L9UC19_9EURO/548-801    AC A0A1L9UC19.1
#=GS A0A1Y9J003_ANOQN/488-777    AC A0A1Y9J003.1
#=GS A0A287NYS4_HORVV/524-870    AC A0A287NYS4.1
#=GS A0A0K0DWY0_STRER/507-791    AC A0A0K0DWY0.1
#=GS G9NFI7_HYPAI/533-778        AC G9NFI7.1
#=GS A0A090LDE9_STRRB/494-767    AC A0A090LDE9.1
#=GS A0A1D6K2X1_MAIZE/137-392    AC A0A1D6K2X1.1
#=GS W1PP24_AMBTC/486-817        AC W1PP24.1
#=GS E9J6J3_SOLIN/475-751        AC E9J6J3.1
#=GS A0A2B7Z7F1_9EURO/566-823    AC A0A2B7Z7F1.1
#=GS A0A2H3ISB7_9EURO/551-805    AC A0A2H3ISB7.1
#=GS U6N3Z9_9EIME/131-340        AC U6N3Z9.1
#=GS D8QLP8_SCHCM/488-803        AC D8QLP8.1
#=GS A0A165TRK3_9HOMO/535-838    AC A0A165TRK3.1
#=GS A0A0E0KDN3_ORYPU/464-810    AC A0A0E0KDN3.1
#=GS A0A0M4EZ67_DROBS/488-770    AC A0A0M4EZ67.1
#=GS A0A151GNH5_9HYPO/534-587    AC A0A151GNH5.1
#=GS A0A1Y3NCQ6_PIRSE/448-640    AC A0A1Y3NCQ6.1
#=GS A0A1R3R9C5_ASPC5/555-808    AC A0A1R3R9C5.1
#=GS I3IZ41_ORENI/483-765        AC I3IZ41.1
#=GS A0A231M019_9EURO/529-782    AC A0A231M019.1
#=GS G4NH07_MAGO7/543-787        AC G4NH07.1
#=GS W5LAI3_ASTMX/483-767        AC W5LAI3.1
#=GS A0A075B041_9FUNG/473-612    AC A0A075B041.1
#=GS A0A0M3IY46_ANISI/456-735    AC A0A0M3IY46.1
#=GS A0A1D5XT72_WHEAT/464-810    AC A0A1D5XT72.1
#=GS A0A1I7SAE3_BURXY/485-757    AC A0A1I7SAE3.1
#=GS A0A177DJ54_ALTAL/563-816    AC A0A177DJ54.1
#=GS Q6FN07_CANGA/580-828        AC Q6FN07.2
#=GS M3Y4U2_MUSPF/485-760        AC M3Y4U2.1
#=GS A0A165YTR7_9HOMO/520-810    AC A0A165YTR7.1
#=GS W5PNL4_SHEEP/485-760        AC W5PNL4.1
#=GS A0A1B7SZ66_9ASCO/366-543    AC A0A1B7SZ66.1
#=GS A0A2C9K216_BIOGL/491-764    AC A0A2C9K216.1
#=GS A0A1J1GKZ1_PLARL/758-1012   AC A0A1J1GKZ1.1
#=GS G7KX77_MEDTR/493-829        AC G7KX77.2
#=GS R0KSP6_NOSB1/298-432        AC R0KSP6.1
#=GS NCBP1_SCHPO/514-779         AC O14253.1
#=GS G3WTF4_SARHA/476-708        AC G3WTF4.1
#=GS I0Z3N8_COCSC/528-857        AC I0Z3N8.1
#=GS H9IWE9_BOMMO/2-278          AC H9IWE9.1
#=GS R8BBG4_TOGMI/542-796        AC R8BBG4.1
#=GS T1JMW3_STRMM/488-758        AC T1JMW3.1
#=GS A0A0K0F7J2_9BILA/489-774    AC A0A0K0F7J2.1
#=GS F4RMF2_MELLP/640-988        AC F4RMF2.1
#=GS A0A0J0XWS4_9TREE/506-798    AC A0A0J0XWS4.1
#=GS J9DTD6_WUCBA/1-85           AC J9DTD6.1
#=GS A0A2I3HWH4_NOMLE/418-693    AC A0A2I3HWH4.1
#=GS A0A2I3MJB0_PAPAN/418-693    AC A0A2I3MJB0.1
#=GS A0A2K5KPD1_CERAT/399-674    AC A0A2K5KPD1.1
#=GS A0A2K3D496_CHLRE/803-948    AC A0A2K3D496.1
#=GS E7QJB4_YEASZ/578-825        AC E7QJB4.1
#=GS A0A084W0C9_ANOSI/488-776    AC A0A084W0C9.1
#=GS A0A0D2H838_9EURO/542-794    AC A0A0D2H838.1
#=GS A0A1D6K2V5_MAIZE/427-773    AC A0A1D6K2V5.1
#=GS A0A0L7QUG2_9HYME/438-639    AC A0A0L7QUG2.1
#=GS E2BW56_HARSA/488-760        AC E2BW56.1
#=GS A0A168HDL9_CORDF/550-802    AC A0A168HDL9.1
#=GS Q6CJM2_KLULA/577-822        AC Q6CJM2.2
#=GS Q7RSR4_PLAYO/824-987        AC Q7RSR4.1
#=GS A0A060SP03_PYCCI/543-845    AC A0A060SP03.1
#=GS S9X512_SCHCR/515-731        AC S9X512.1
#=GS M7SBY9_EUTLA/537-793        AC M7SBY9.1
#=GS A0A1F7ZQ36_9EURO/554-805    AC A0A1F7ZQ36.1
#=GS A0A1J8QCH2_9HOMO/541-867    AC A0A1J8QCH2.1
#=GS A0A0N4TRQ3_BRUPA/517-776    AC A0A0N4TRQ3.2
#=GS E3S7J3_PYRTT/731-984        AC E3S7J3.1
#=GS A0A1C7NQ92_9FUNG/537-799    AC A0A1C7NQ92.1
#=GS A0A179FGW8_METCM/534-779    AC A0A179FGW8.1
#=GS G1T696_RABIT/486-761        AC G1T696.1
#=GS W6UR31_ECHGR/540-866        AC W6UR31.1
#=GS A0A1A6FT60_NEOLE/464-752    AC A0A1A6FT60.1
#=GS E4UYW2_ARTGP/547-800        AC E4UYW2.1
#=GS A0A1S2ZT80_ERIEU/485-759    AC A0A1S2ZT80.1
#=GS A0A2I4CS12_9TELE/485-765    AC A0A2I4CS12.1
#=GS NCBP1_ANOGA/488-777         AC Q7PX35.4
#=GS B8ND12_ASPFN/529-782        AC B8ND12.1
#=GS V5G4F2_BYSSN/534-787        AC V5G4F2.1
#=GS A0A195EM70_9HYME/485-759    AC A0A195EM70.1
#=GS A0A194W4V9_9PEZI/574-831    AC A0A194W4V9.1
#=GS A0A022QJ29_ERYGU/485-802    AC A0A022QJ29.1
#=GS B3MVZ8_DROAN/524-753        AC B3MVZ8.1
#=GS A0A1U7TER2_TARSY/485-599    AC A0A1U7TER2.1
#=GS A0A0D9NJH6_METAN/534-779    AC A0A0D9NJH6.1
#=GS A0A0L7LU78_9NEOP/1-42       AC A0A0L7LU78.1
#=GS A0A165U6U3_9APHY/542-849    AC A0A165U6U3.1
#=GS A0A095CIX4_CRYGR/593-871    AC A0A095CIX4.1
#=GS A0A1Y2FNJ7_9ASCO/516-860    AC A0A1Y2FNJ7.1
#=GS A0A2H2JN60_CAEJA/1-205      AC A0A2H2JN60.1
#=GS A0A0V0ZPG9_9BILA/662-782    AC A0A0V0ZPG9.1
#=GS A0A2I2UKG0_FELCA/487-756    AC A0A2I2UKG0.1
#=GS E2QD75_DROME/488-770        AC E2QD75.1
#=GS G8BW33_TETPH/543-781        AC G8BW33.1
#=GS A0A232EZH0_9HYME/488-761    AC A0A232EZH0.1
#=GS A0A0F9ZCP9_9MICR/295-389    AC A0A0F9ZCP9.1
#=GS A0A091URB6_NIPNI/474-754    AC A0A091URB6.1
#=GS A0A0V0ZPG9_9BILA/495-658    AC A0A0V0ZPG9.1
#=GS F7HCL0_CALJA/418-693        AC F7HCL0.1
#=GS A0CRM1_PARTE/469-689        AC A0CRM1.1
#=GS Q1K7E2_NEUCR/533-786        AC Q1K7E2.1
#=GS A0A091VHI6_PHORB/444-724    AC A0A091VHI6.1
#=GS A0A1E3I5P4_9TREE/591-893    AC A0A1E3I5P4.1
#=GS A0A074SCM4_9HOMO/536-816    AC A0A074SCM4.1
#=GS A0A1G4MA39_LACFM/581-829    AC A0A1G4MA39.1
#=GS A0A1G4B1X6_9PEZI/539-785    AC A0A1G4B1X6.1
#=GS A0A251PU76_PRUPE/380-725    AC A0A251PU76.1
#=GS A0A1B8ADM9_FUSPO/532-777    AC A0A1B8ADM9.1
#=GS A0A166KBE3_9HOMO/543-862    AC A0A166KBE3.1
#=GS H2YUE8_CIOSA/1-163          AC H2YUE8.1
#=GS Q2U9I0_ASPOR/529-782        AC Q2U9I0.1
#=GS A0A0C3P6R7_PISTI/545-849    AC A0A0C3P6R7.1
#=GS A0A2H3EXF6_9HELO/479-563    AC A0A2H3EXF6.1
#=GS A0A2H3XWT8_PHODC/483-827    AC A0A2H3XWT8.1
#=GS A0A1I7VPM8_LOALO/529-796    AC A0A1I7VPM8.1
#=GS A0A1S4D9Z6_TOBAC/485-828    AC A0A1S4D9Z6.1
#=GS A0A0D7BGY7_9AGAR/554-869    AC A0A0D7BGY7.1
#=GS A0A132AE10_SARSC/492-606    AC A0A132AE10.1
#=GS A0A0L0CL87_LUCCU/488-771    AC A0A0L0CL87.1
#=GS C5FRD0_ARTOC/547-798        AC C5FRD0.1
#=GS A0A081CLN2_PSEA2/689-985    AC A0A081CLN2.1
#=GS A8PGT3_COPC7/535-854        AC A8PGT3.1
#=GS A0A093D5Y2_TAUER/444-724    AC A0A093D5Y2.1
#=GS H2SJV6_TAKRU/485-765        AC H2SJV6.1
#=GS A0A0N5DLP0_TRIMR/524-779    AC A0A0N5DLP0.1
#=GS B8MTN8_TALSN/547-801        AC B8MTN8.1
#=GS A0A085NGJ1_9BILA/2175-2430  AC A0A085NGJ1.1
#=GS A0A1E3PI47_9ASCO/533-757    AC A0A1E3PI47.1
#=GS A0A182VW37_9DIPT/12-295     AC A0A182VW37.1
#=GS B4R0Z6_DROSI/496-717        AC B4R0Z6.1
#=GS A0A2K5JE53_COLAP/418-693    AC A0A2K5JE53.1
#=GS A0A087XF49_POEFO/485-769    AC A0A087XF49.1
#=GS A0A1V6UX36_9EURO/531-784    AC A0A1V6UX36.1
#=GS V4U5T8_9ROSI/271-616        AC V4U5T8.1
#=GS A0A1V8SZY2_9PEZI/557-808    AC A0A1V8SZY2.1
#=GS NCBP1_DROSE/488-770         AC B4I0W6.1
#=GS G3XXC7_ASPNA/548-801        AC G3XXC7.1
#=GS X6MHP4_RETFI/46-337         AC X6MHP4.1
#=GS A0A151GNH5_9HYPO/580-739    AC A0A151GNH5.1
#=GS A0A1D6K2X0_MAIZE/138-484    AC A0A1D6K2X0.1
#=GS K3WAB2_PYTUL/691-934        AC K3WAB2.1
#=GS A0A1J7IPW5_9PEZI/536-793    AC A0A1J7IPW5.1
#=GS A0A183NDY7_9TREM/110-484    AC A0A183NDY7.1
#=GS D8LFZ4_ECTSI/632-863        AC D8LFZ4.1
#=GS X0K335_FUSOX/531-775        AC X0K335.1
#=GS A0A183TMB5_SCHSO/236-421    AC A0A183TMB5.1
#=GS A0A183I1Y9_9BILA/503-744    AC A0A183I1Y9.1
#=GS A0A182HK84_ANOAR/6-292      AC A0A182HK84.1
#=GS A0A1E4TEV2_9ASCO/527-706    AC A0A1E4TEV2.1
#=GS C1E0M0_MICCC/524-801        AC C1E0M0.1
#=GS A0A1E3BHL4_9EURO/533-786    AC A0A1E3BHL4.1
#=GS A0A0N5B8K9_STREA/489-776    AC A0A0N5B8K9.1
#=GS A0A061GUF2_THECC/484-829    AC A0A061GUF2.1
#=GS U3JEQ1_FICAL/473-756        AC U3JEQ1.1
#=GS I1PB96_ORYGL/483-830        AC I1PB96.1
#=GS A0A077TQU0_PLACH/798-1021   AC A0A077TQU0.1
#=GS H2YUE9_CIOSA/492-771        AC H2YUE9.1
#=GS A0A095AF41_SCHHA/477-821    AC A0A095AF41.1
#=GS NCBP1_DROAN/488-770         AC B3MS75.1
#=GS Q4V551_DROME/498-719        AC Q4V551.1
#=GS X1WQ84_ACYPI/491-791        AC X1WQ84.1
#=GS A0A0B2UIA8_9MICR/305-412    AC A0A0B2UIA8.1
#=GS B4KJA1_DROMO/497-712        AC B4KJA1.1
#=GS A0A1V8U9T9_9PEZI/557-808    AC A0A1V8U9T9.1
#=GS A0A1I7XEC4_HETBA/639-723    AC A0A1I7XEC4.1
#=GS NCBP1_SALSA/485-766         AC C0H906.1
#=GS F7VZ09_SORMK/533-786        AC F7VZ09.1
#=GS A0A183GD92_HELBK/1-115      AC A0A183GD92.1
#=GS A0A1E5R0G2_9ASCO/600-854    AC A0A1E5R0G2.1
#=GS M7BPB3_CHEMY/114-292        AC M7BPB3.1
#=GS A0A1B0AEE3_GLOPL/519-800    AC A0A1B0AEE3.1
#=GS A0A0R3QZB8_9BILA/166-424    AC A0A0R3QZB8.1
#=GS U6NYV9_HAECO/687-947        AC U6NYV9.1
#=GS A0A044SD50_ONCVO/527-809    AC A0A044SD50.1
#=GS N4VJM2_COLOR/521-766        AC N4VJM2.1
#=GS B3L6S4_PLAKH/822-1086       AC B3L6S4.1
#=GS C4XYV4_CLAL4/259-527        AC C4XYV4.1
#=GS A0A1Y1XG42_9FUNG/517-807    AC A0A1Y1XG42.1
#=GS A0A1B7MUG0_9HOMO/542-868    AC A0A1B7MUG0.1
#=GS A0A0U5FQ40_9EURO/529-782    AC A0A0U5FQ40.1
#=GS F7H7F0_CALJA/487-762        AC F7H7F0.1
#=GS A0A1I7UXL3_9PELO/490-694    AC A0A1I7UXL3.1
#=GS M7TI29_BOTF1/577-824        AC M7TI29.1
#=GS A0A1L8HNS1_XENLA/486-761    AC A0A1L8HNS1.1
#=GS A0A0E0D0E5_9ORYZ/483-829    AC A0A0E0D0E5.1
#=GS S2JP86_MUCC1/537-805        AC S2JP86.1
#=GS A0A229WY43_9EURO/528-781    AC A0A229WY43.1
#=GS D8SFU6_SELML/513-831        AC D8SFU6.1
#=GS A0A093UPX8_TALMA/550-804    AC A0A093UPX8.1
#=GS A0A091N9U0_9PASS/444-631    AC A0A091N9U0.1
#=GS A0A175W1F6_9PEZI/535-790    AC A0A175W1F6.1
#=GS A0A1Q3C5A7_CEPFO/485-825    AC A0A1Q3C5A7.1
#=GS R0KNI0_SETT2/564-817        AC R0KNI0.1
#=GS G0R794_HYPJQ/533-778        AC G0R794.1
#=GS D8TCU0_SELML/476-804        AC D8TCU0.1
#=GS A0A164TT96_9HOMO/531-813    AC A0A164TT96.1
#=GS A0A0V0ZNM0_9BILA/679-799    AC A0A0V0ZNM0.1
#=GS A0A150V1P5_9PEZI/559-810    AC A0A150V1P5.1
#=GS A0A0Y9Y4I5_PLABE/821-1034   AC A0A0Y9Y4I5.1
#=GS A0A158Q3I3_DRAME/453-717    AC A0A158Q3I3.1
#=GS A7TKT7_VANPO/762-842        AC A7TKT7.1
#=GS A0A0C3BDA5_HEBCY/536-856    AC A0A0C3BDA5.1
#=GS W2TXD0_NECAM/111-232        AC W2TXD0.1
#=GS A0A0K3C3Q0_RHOTO/1107-1384  AC A0A0K3C3Q0.1
#=GS A0A1U7QQL0_MESAU/485-760    AC A0A1U7QQL0.1
#=GS A0A1E3I8C5_9TREE/586-885    AC A0A1E3I8C5.1
#=GS A0A074WCR7_9PEZI/537-788    AC A0A074WCR7.1
#=GS W4Y6T9_STRPU/44-126         AC W4Y6T9.1
#=GS F1ST49_PIG/485-760          AC F1ST49.3
#=GS A0A1M2VJA4_TRAPU/604-907    AC A0A1M2VJA4.1
#=GS K7IVH0_NASVI/488-761        AC K7IVH0.1
#=GS I3M0Y3_ICTTR/450-725        AC I3M0Y3.2
#=GS A0A168R4W7_ABSGL/536-804    AC A0A168R4W7.1
#=GS A0A091WMS4_OPIHO/444-724    AC A0A091WMS4.1
#=GS A0A0K0IMQ3_BRUMA/539-807    AC A0A0K0IMQ3.2
#=GS G0SWX6_RHOT2/1107-1384      AC G0SWX6.1
#=GS A0A109FMQ8_9BASI/1157-1436  AC A0A109FMQ8.1
#=GS K5X9H4_PHACS/528-832        AC K5X9H4.1
#=GS A0A1S2X690_SALSA/485-766    AC A0A1S2X690.1
#=GS A0A1D6AXA9_WHEAT/483-829    AC A0A1D6AXA9.1
#=GS A0A0V0W3Y5_9BILA/495-750    AC A0A0V0W3Y5.1
#=GS A0A1D6K2W1_MAIZE/524-870    AC A0A1D6K2W1.1
#=GS A0A0A1SKZ6_9HYPO/535-774    AC A0A0A1SKZ6.1
#=GS A3LQD0_PICST/647-909        AC A3LQD0.2
#=GS NCBP1_CHICK/487-763         AC Q5ZJZ6.1
#=GS A0A1L9PT36_ASPVE/527-780    AC A0A1L9PT36.1
#=GS S3C9N4_OPHP1/649-983        AC S3C9N4.1
#=GS A0A1R1XNW6_9FUNG/673-916    AC A0A1R1XNW6.1
#=GS A0A0E0KDN4_ORYPU/444-790    AC A0A0E0KDN4.1
#=GS F7GRU0_CALJA/485-760        AC F7GRU0.1
#=GS A0A068XIS9_HYMMI/572-890    AC A0A068XIS9.2
#=GS T0QV77_9STRA/622-838        AC T0QV77.1
#=GS F1PUP7_CANLF/485-760        AC F1PUP7.2
#=GS W6Y7K4_COCCA/564-819        AC W6Y7K4.1
#=GS W2QF76_PHYPN/604-856        AC W2QF76.1
#=GS S7Z6B7_PENO1/534-787        AC S7Z6B7.1
#=GS A0A1L9RUD9_ASPWE/531-784    AC A0A1L9RUD9.1
#=GS A0A1E3NLA1_9ASCO/806-989    AC A0A1E3NLA1.1
#=GS F6PKJ4_CIOIN/486-765        AC F6PKJ4.2
#=GS A0A1E5RKN9_9ASCO/623-869    AC A0A1E5RKN9.1
#=GS J9ETZ7_WUCBA/3-74           AC J9ETZ7.1
#=GS D7L031_ARALL/484-814        AC D7L031.1
#=GS A0A182M596_9DIPT/12-295     AC A0A182M596.1
#=GS A0A0F4Z9T5_9PEZI/534-803    AC A0A0F4Z9T5.1
#=GS A0A017SKH2_9EURO/532-785    AC A0A017SKH2.1
#=GS A0A0N4WSI7_HAEPC/468-732    AC A0A0N4WSI7.1
#=GS A0A1V9XNU1_9ACAR/489-773    AC A0A1V9XNU1.1
#=GS K1Y1E7_MARBU/538-779        AC K1Y1E7.1
#=GS A0A091JSB2_EGRGA/474-754    AC A0A091JSB2.1
#=GS A0A1B8ERI9_9PEZI/534-785    AC A0A1B8ERI9.1
#=GS A0A1X7R0F8_9SACH/583-830    AC A0A1X7R0F8.1
#=GS A0A1Y1VNE9_9FUNG/518-801    AC A0A1Y1VNE9.1
#=GS A0A1J7HSE2_LUPAN/379-719    AC A0A1J7HSE2.1
#=GS A0A177B5F9_9METZ/504-709    AC A0A177B5F9.1
#=GS J5PTH5_SACK1/578-825        AC J5PTH5.1
#=GS A0A2I4F1E8_9ROSI/485-831    AC A0A2I4F1E8.1
#=GS C3Y2C6_BRAFL/550-659        AC C3Y2C6.1
#=GS A0A067E938_CITSI/419-764    AC A0A067E938.1
#=GS A0A0D2XCF3_FUSO4/531-776    AC A0A0D2XCF3.1
#=GS A0A0D9Z791_9ORYZ/483-829    AC A0A0D9Z791.1
#=GS A0A1J1I559_9DIPT/491-774    AC A0A1J1I559.1
#=GS B6GXX9_PENRW/531-784        AC B6GXX9.1
#=GS A0A1U7VU43_NICSY/485-830    AC A0A1U7VU43.1
#=GS A0A099ZWJ3_TINGU/444-707    AC A0A099ZWJ3.1
#=GS U3J9Q4_ANAPL/448-727        AC U3J9Q4.1
#=GS T1JFR4_STRMM/1-270          AC T1JFR4.1
#=GS A0A1D5R216_MACMU/483-758    AC A0A1D5R216.1
#=GS A0A0B2NVG2_GLYSO/416-755    AC A0A0B2NVG2.1
#=GS G8YF32_PICSO/650-914        AC G8YF32.1
#=GS H1V5N6_COLHI/541-787        AC H1V5N6.1
#=GS D5GA59_TUBMM/542-791        AC D5GA59.1
#=GS G4VPN1_SCHMA/511-885        AC G4VPN1.1
#=GS A0A161W7F8_9PEZI/543-789    AC A0A161W7F8.1
#=GS A2R4E7_ASPNC/548-801        AC A2R4E7.1
#=GS A0A0D1ZGM6_9EURO/558-810    AC A0A0D1ZGM6.1
#=GS A0A1B8E7F6_9PEZI/534-785    AC A0A1B8E7F6.1
#=GS A0A1W4UII4_DROFC/488-770    AC A0A1W4UII4.1
#=GS G1N980_MELGA/39-270         AC G1N980.2
#=GS A0A287NZM5_HORVV/514-860    AC A0A287NZM5.1
#=GS A0A0B4HUY3_9HYPO/539-784    AC A0A0B4HUY3.1
#=GS A0A1E4SYQ3_9ASCO/712-985    AC A0A1E4SYQ3.1
#=GS G7XZ90_ASPKW/542-795        AC G7XZ90.1
#=GS A0A2H2YWM7_9HYPO/533-778    AC A0A2H2YWM7.1
#=GS A0A163A1Y6_MUCCL/569-838    AC A0A163A1Y6.1
#=GS Q0CKX2_ASPTN/541-794        AC Q0CKX2.1
#=GS K1Q4J3_CRAGI/488-760        AC K1Q4J3.1
#=GS A0A0G2GV22_9PEZI/613-867    AC A0A0G2GV22.1
#=GS F7DRW1_MACMU/399-674        AC F7DRW1.2
#=GS A0A067JRI3_JATCU/485-830    AC A0A067JRI3.1
#=GS A0A1A0H5C9_9ASCO/659-927    AC A0A1A0H5C9.1
#=GS A0A183H0E3_9BILA/1-214      AC A0A183H0E3.1
#=GS A0A1R3G8L3_9ROSI/326-671    AC A0A1R3G8L3.1
#=GS A0A024TDB5_9STRA/641-840    AC A0A024TDB5.1
#=GS K4CX85_SOLLC/485-827        AC K4CX85.1
#=GS A0A0N1ITN1_9HYME/18-294     AC A0A0N1ITN1.1
#=GS A0A0B0NP59_GOSAR/483-829    AC A0A0B0NP59.1
#=GS A0A1I7VVJ8_LOALO/497-756    AC A0A1I7VVJ8.1
#=GS A0A0G2FZI4_9PEZI/575-841    AC A0A0G2FZI4.1
#=GS L8GQR7_ACACA/416-673        AC L8GQR7.1
#=GS A0A1Q3EIC2_LENED/534-846    AC A0A1Q3EIC2.1
#=GS A0A1D6K2W2_MAIZE/483-829    AC A0A1D6K2W2.1
#=GS A0A094FNT1_9PEZI/276-526    AC A0A094FNT1.1
#=GS A0A0B7N130_9FUNG/564-832    AC A0A0B7N130.1
#=GS A0A287NYN3_HORVV/370-649    AC A0A287NYN3.1
#=GS A0A1E3PC71_WICAO/585-755    AC A0A1E3PC71.1
#=GS A0A1S2XQT2_CICAR/492-829    AC A0A1S2XQT2.1
#=GS A0A0D2GA75_9EURO/541-793    AC A0A0D2GA75.1
#=GS F6VFW6_MONDO/484-756        AC F6VFW6.2
#=GS A0A251TAG5_HELAN/486-820    AC A0A251TAG5.1
#=GS A0A087HCT4_ARAAL/484-815    AC A0A087HCT4.1
#=GS W9R4S8_9ROSA/127-468        AC W9R4S8.1
#=GS A5K2V0_PLAVS/884-1094       AC A5K2V0.1
#=GS A0A1V2L3Y0_CYBFA/588-764    AC A0A1V2L3Y0.1
#=GS M8A6M1_TRIUA/684-1030       AC M8A6M1.1
#=GS A9RK96_PHYPA/507-848        AC A9RK96.1
#=GS A0A151WJ36_9HYME/513-759    AC A0A151WJ36.1
#=GS A0A1E3QXL8_9ASCO/605-881    AC A0A1E3QXL8.1
#=GS A0A1I8P6V7_STOCA/1-234      AC A0A1I8P6V7.1
#=GS A0A179U527_AJEDR/559-818    AC A0A179U527.1
#=GS A0A0C3QBB1_9HOMO/576-869    AC A0A0C3QBB1.1
#=GS R0MH35_NOSB1/37-153         AC R0MH35.1
#=GS T1GNS5_MEGSC/1-42           AC T1GNS5.1
#=GS S3E6W8_GLAL2/538-786        AC S3E6W8.1
#=GS A0A0V1HKN4_9BILA/490-752    AC A0A0V1HKN4.1
#=GS A0A1J9SG84_9PEZI/700-954    AC A0A1J9SG84.1
#=GS A0A2A2K211_9BILA/636-867    AC A0A2A2K211.1
#=GS A8Q346_MALGO/616-928        AC A8Q346.1
#=GS A0A0D2BYG8_9EURO/443-695    AC A0A0D2BYG8.1
#=GS A0A0W0EUJ1_9AGAR/567-879    AC A0A0W0EUJ1.1
#=GS I2FPC6_USTH4/662-980        AC I2FPC6.1
#=GS A7ST09_NEMVE/485-774        AC A7ST09.1
#=GS G9MDX5_HYPVG/533-778        AC G9MDX5.1
#=GS A0A1U7KTY6_9APHY/437-740    AC A0A1U7KTY6.1
#=GS F4P8H5_BATDJ/518-788        AC F4P8H5.1
#=GS U7PJE0_SPOS1/607-939        AC U7PJE0.1
#=GS D4AJ42_ARTBC/547-800        AC D4AJ42.1
#=GS A0A0G4PVB3_PENCA/531-784    AC A0A0G4PVB3.1
#=GS A0A137PDC9_CONC2/526-780    AC A0A137PDC9.1
#=GS A0A2C5YCM1_9HYPO/535-780    AC A0A2C5YCM1.1
#=GS A0A0C9X633_9AGAR/550-863    AC A0A0C9X633.1
#=GS A0A151V6S8_HYPMA/533-848    AC A0A151V6S8.1
#=GS T1KXW2_TETUR/489-765        AC T1KXW2.1
#=GS A0A1Y2C3G2_9FUNG/519-803    AC A0A1Y2C3G2.1
#=GS A0A099ZV46_CHAVO/444-724    AC A0A099ZV46.1
#=GS A0A195ESJ1_9HYME/470-744    AC A0A195ESJ1.1
#=GS A0A1Y1JMF0_PLAGO/822-1066   AC A0A1Y1JMF0.1
#=GS S8FY88_FOMPI/543-854        AC S8FY88.1
#=GS A0A091S9S0_NESNO/444-724    AC A0A091S9S0.1
#=GS A0A2A2K1X5_9BILA/636-822    AC A0A2A2K1X5.1
#=GS A0A074W1V9_9PEZI/537-788    AC A0A074W1V9.1
#=GS A0A151T923_CAJCA/251-584    AC A0A151T923.1
#=GS M2SZS5_COCSN/564-817        AC M2SZS5.1
#=GS NCBP1_DROWI/488-770         AC B4NC41.1
#=GS A0A0E0KDN6_ORYPU/422-768    AC A0A0E0KDN6.1
#=GS A0A2G5VKZ6_9PELO/487-764    AC A0A2G5VKZ6.1
#=GS A0A0L0SA89_ALLMA/500-755    AC A0A0L0SA89.1
#=GS A0A135ULP5_9PEZI/550-796    AC A0A135ULP5.1
#=GS Y827_ENCCU/281-386          AC Q8SUT4.1
#=GS A0A178E5K1_9PLEO/670-923    AC A0A178E5K1.1
#=GS A0A2H1A616_CANAR/657-925    AC A0A2H1A616.1
#=GS A0A099P1G9_PICKU/793-992    AC A0A099P1G9.1
#=GS A0A261BH03_9PELO/491-766    AC A0A261BH03.1
#=GS A0A199V2B7_ANACO/475-803    AC A0A199V2B7.1
#=GS A0A2H3BI64_9AGAR/520-815    AC A0A2H3BI64.1
#=GS A0A091RMM7_9GRUI/444-724    AC A0A091RMM7.1
#=GS E7NLK7_YEASO/578-825        AC E7NLK7.2
#=GS A0A165FR70_9PEZI/753-983    AC A0A165FR70.1
#=GS A0A1B0C056_9MUSC/35-287     AC A0A1B0C056.1
#=GS B8PDA0_POSPM/533-842        AC B8PDA0.1
#=GS A0A1W4VM06_DROFC/511-735    AC A0A1W4VM06.1
#=GS A0A1S3CX94_DIACI/489-766    AC A0A1S3CX94.1
#=GS K5WYN1_AGABU/531-842        AC K5WYN1.1
#=GS NCBP1_RAT/485-760           AC Q56A27.1
#=GS A0A093J3B4_FULGA/444-724    AC A0A093J3B4.1
#=GS L2GAU7_COLGN/554-798        AC L2GAU7.1
#=GS A0A0C7MUB1_9SACH/581-821    AC A0A0C7MUB1.1
#=GS H2M5S5_ORYLA/497-777        AC H2M5S5.1
#=GS Q5AYX3_EMENI/530-783        AC Q5AYX3.1
#=GS A0A0V0ZPC0_9BILA/512-774    AC A0A0V0ZPC0.1
#=GS A0A218UIU8_9PASE/484-742    AC A0A218UIU8.1
#=GS A0A287NYM9_HORVV/130-476    AC A0A287NYM9.1
#=GS C0P170_AJECG/349-601        AC C0P170.1
#=GS G8ZLM5_TORDC/745-825        AC G8ZLM5.1
#=GS A0A183IDA2_9BILA/18-224     AC A0A183IDA2.1
#=GS M4D9I5_BRARP/484-811        AC M4D9I5.1
#=GS A0A0E9NFN8_9ASCO/514-758    AC A0A0E9NFN8.1
#=GS A0A1U7LI97_9ASCO/195-446    AC A0A1U7LI97.1
#=GS H2AM81_KAZAF/590-839        AC H2AM81.1
#=GS W2TV46_NECAM/2-128          AC W2TV46.1
#=GS A0A0L9U7B4_PHAAN/1-321      AC A0A0L9U7B4.1
#=GS A0A166A9C5_DAUCA/503-843    AC A0A166A9C5.1
#=GS T5A852_OPHSC/537-782        AC T5A852.1
#=GS A0A080WN96_TRIRC/1-237      AC A0A080WN96.1
#=GS A0A1I8Q2I0_STOCA/488-771    AC A0A1I8Q2I0.1
#=GS M2XU86_GALSU/503-777        AC M2XU86.1
#=GS B3RS52_TRIAD/484-748        AC B3RS52.1
#=GS T0KME7_COLGC/556-801        AC T0KME7.1
#=GS A0A1V1SVX1_9FUNG/548-787    AC A0A1V1SVX1.1
#=GS A0A0G4GWN0_VITBC/656-1015   AC A0A0G4GWN0.1
#=GS A0A1I7ZNX0_9BILA/332-581    AC A0A1I7ZNX0.1
#=GS T1FTY1_HELRO/365-635        AC T1FTY1.1
#=GS A0A0K9PAN6_ZOSMR/452-784    AC A0A0K9PAN6.1
#=GS A0A170QZN0_9ASCO/553-717    AC A0A170QZN0.1
#=GS A0A1S3KF50_LINUN/488-761    AC A0A1S3KF50.1
#=GS H2PSU5_PONAB/485-760        AC H2PSU5.1
#=GS A0A2K1Z2X9_POPTR/305-650    AC A0A2K1Z2X9.1
#=GS A0A1R0GVB6_9FUNG/545-794    AC A0A1R0GVB6.1
#=GS R0HJI6_9BRAS/365-706        AC R0HJI6.1
#=GS A0A044V1Z9_ONCVO/492-766    AC A0A044V1Z9.1
#=GS A0A096P136_PAPAN/485-760    AC A0A096P136.2
#=GS W9IX68_FUSOX/531-776        AC W9IX68.1
#=GS A0A182EBY5_ONCOC/492-759    AC A0A182EBY5.1
#=GS A0A158PZ94_BRUMA/503-761    AC A0A158PZ94.1
#=GS A0A063BR68_9HYPO/534-785    AC A0A063BR68.1
#=GS G7E5Q5_MIXOS/591-844        AC G7E5Q5.1
#=GS A0A1L9WMH2_ASPAC/546-799    AC A0A1L9WMH2.1
#=GS A0A2A9MNF0_9APIC/888-1149   AC A0A2A9MNF0.1
#=GS A0A1U7W5G2_NICSY/485-828    AC A0A1U7W5G2.1
#=GS W7UBY3_9STRA/647-888        AC W7UBY3.1
#=GS A0A0V1KN10_9BILA/479-756    AC A0A0V1KN10.1
#=GS A0A1R2CXP6_9CILI/432-630    AC A0A1R2CXP6.1
#=GS A0A091KLV1_9GRUI/474-754    AC A0A091KLV1.1
#=GS G2Q7P7_MYCTT/533-786        AC G2Q7P7.1
#=GS B0X1G3_CULQU/19-311         AC B0X1G3.1
#=GS A0A139HLR8_9PEZI/561-812    AC A0A139HLR8.1
#=GS A0A1I8CCG5_9BILA/505-789    AC A0A1I8CCG5.1
#=GS A0A1D6RVT3_WHEAT/519-633    AC A0A1D6RVT3.1
#=GS A0A074Z4P7_9TREM/631-927    AC A0A074Z4P7.1
#=GS A0A2B4SX82_STYPI/487-776    AC A0A2B4SX82.1
#=GS R7YXK7_CONA1/626-880        AC R7YXK7.1
#=GS A0A087RD86_APTFO/444-724    AC A0A087RD86.1
#=GS A0A1B9FT45_9TREE/587-880    AC A0A1B9FT45.1
#=GS A0A1V6SGL0_9EURO/531-784    AC A0A1V6SGL0.1
#=GS A0A1D3D6Q9_9EIME/96-371     AC A0A1D3D6Q9.1
#=GS I2H7H4_TETBL/583-827        AC I2H7H4.1
#=GS A0A0D9VTY5_9ORYZ/464-811    AC A0A0D9VTY5.1
#=GS A0A1L7X1R8_9HELO/530-780    AC A0A1L7X1R8.1
#=GS A0A0L7LTZ4_9NEOP/6-96       AC A0A0L7LTZ4.1
A0A139I408_9PEZI/558-809               ..............................................................................................................FKFA......NDQ...TPYAKEGREVLALL.KK.KAP.......EDE....IQKVLDSVHEQA..TA.LG.--H....ADPLA.....................PSTDIYMT..SIL...SIGSKSLSHVL.S.TID.R..C.........KDR..LLSV...........gRRS......................................................ELARR..Q...I....I.ESVVQFWS.DHP...G...TAINIVDK.LLNYT.IV.TPM.SVIQWA..LQd....................................................rMDR...GRA.L.A.S.S.Q.V..YEMVSI.TMFKVTNR..............---VRQVL----RERNNL..........---...............----............................................................................SLPY....ESRK.QID.EALPNE.R.Q...A.M.RDLFAAIE.........D.............AVAAVANGA...................QDEM.I..-.-ERF.DG.ASAEQ...............................................DLIMLW..GK..RW..ERVWQRKAAVEE-a............................................................................................
A0A0D2B4E6_9EURO/538-790               ..............................................................................................................FKYN......DDS...TPFATQGKAIAQLV.RT.KAA.......NEE....FSPLLETIEQEA..MA.SG.--M....ADPEL.....................ASTDAFVT..SIC...WIGSKSLSHVL.A.CIE.R..C.........KER..LLAI...........sSKS......................................................PACRK..Q...I....M.TSVMNYWK.SQT...G...VGVIILDK.LLNYQ.IL.TPS.SIVEWA..LVd....................................................hVAR...GTL.L.A.S.A.W.C..YELVEK.TTKKVGSR..............---VHSIVHAIRQL----..........---...............----............................................................................GLTD....DQKS.ELQ.QTLTKE.L.E...S.M.KTLYESIQ.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEDE...............................................ELLKSW..GG..KW..AKTFQRKCAVEE-n............................................................................................
A0A183DYP9_9BILA/535-705               ..............................................................................................................YDLN......DEE...HPDHDLAMALEKAF.RE.KCS.......AED....MIDLLKNKTAEW..SD.SS.---....-----.....................AGLSVFLK..VLL...YLARKTFSHNF.A.ALT.R..H.........-VI..FYALlis.....vdilRRSlpkdeyys.....................................tlkelignkEDAQL..T...V....L.RTIYETWK.LHR...Q...MVTVLITK.LLKMS.LL.DAS.AVVAWI..FS......................................................DEM...KPE.F.E.R.F.V.R..F-----.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ssiacs.......................................................................................
A0A1V8V8D6_9PEZI/542-793               ..............................................................................................................FKYA......NDE...LPFATEARALLKLL.KE.KAS.......EEQ....VQAILDDIRDQA..AS.HG.V--....ADPLV.....................SSTDVYMT..CIL...NVGSKSMSHVI.S.NID.R..L.........KDK..LSAL...........aTQS......................................................EAARR..Q...I....I.SSVVDFWS.LHP...G...NAANIVDK.LLNYT.II.TPM.SVIEWA..LHe....................................................rIDR...GRA.L.A.S.A.Q.M..YELVSH.TVAKVSAR..............---VRQVLQQRANT----..........---...............----............................................................................SLPF....DQRQ.VID.AVLPRE.R.Q...T.L.RDLYATIE.........D.............AVASVANGSqd...............emMERY.-..-.EGE-.--.-EEER...............................................AIIMQW..GE..RW..ARVWRRKAAVEE-a............................................................................................
A0A0W4ZJT8_PNEJ7/523-781               ..............................................................................................................FDYD......LPN...SKYFAEVETLLETM.KV.NTE.......QSE....TDVALEIIEKTA..AE.NN.E--....EDPQF.....................EALKALVQ..CVL...HLGAKSFSNAL.N.TIE.R..N.........LPG..LRAR...........cNAS......................................................KKACR..Q...T....I.DIIMKFWK.DQP...G...IAVTLIDK.FLNYS.II.NIV.SIIEWV..FL......................................................DVD...IEY.I.N.R.G.F.I..WELMKI.VLDKINSR..............VIQTKRHLKNTDTFLN--..........---...............----............................................................................-DNS....EDLL.KYE.KTYKKV.F.S...D.Q.KDVLIAIF.........E.............MFPKLYDRIknl.............hgkSNGC.Q..E.NGFS.DN.Q---V...............................................SWQLQW..VK..GL..FEEFVRKCHHEI-s............................................................................................
A0A094HC41_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHSLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A2G9RHF4_LITCT/32-174                ............................................................................................................is----......--A...LPGYAVAVTLTNSI.KN.KAV.......NDD....IFNILKDLPNPN..QD.DD.DDE...gISFNP.....................LKIEVFLQ..CLL...NLACKSFSHSF.S.ALA.K..F.........HEV..LKAL............TDS......................................................EEGKL..H...V....L.RVAYDVWK.NHP...Q...MTAVLVDK.LIRTQ.IV.DCA.AVANWI..FS......................................................PEL...APE.F.T.R.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------.............................................................................................
F0YDT9_AURAN/1510-1686                 ...............................................................................dppedaageareprpadaalaaafdalgdda----......---...--------------.--.---.......---....------------..--.--.---....-----.....................AKAAAVMR..GVF...ARGAASFTHAL.A.PLD.DaeL.........SAA..LRNL...........vRDD......................................................DDCEA..A...A....L.DALADVWA.ASA...Q...HVALLADA.LVRRG.VV.RCR.AVAAWV..LD......................................................PRN...ESP.W.A.G.S.N.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------vgasfkphellqvavdrsldllsaavasaaargadaatdgvvraqlde.............................................
G3SXB3_LOXAF/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMSKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTN.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHL----iiqq.........................................................................................
A0A1Y2D2L7_9FUNG/467-727               ...................................................................................................fkyatgyssgd----......---...EEYDALLTRLNRAM.VS.KGD.......HES....IVSILEEVYRHR..VQ.LQ.SNA....MATDDysrpgs.........awnqdaIVRDVFVQ..NVL...FLGTKSFSHFL.N.VVE.R..Y.........VKT..LQQF............NTN......................................................EQDKL..H...T....V.QIITTFWA.SNT...Q...NLEICLDK.LMNYR.VI.DPV.SIIHWV..LS.....................................................eEVL...RGQ.Y.S.R.W.H.V..WQILKN.VVTKVNSK..............VNQLREKVGVNAMEEDD-..........---...............----............................................................................----....----.VSQ.ESLDGA.L.R...D.Q.KAAFILAF.........T.............KFQAYLKEL...................LAAG.H..I.---P.GQ.-----...............................................SAEWRW..VA..GQ..MREFGRSFHKE--ink..........................................................................................
B6QVA1_TALMQ/550-804                   ..............................................................................................................FKYT......LET...TPYSKQGLELMQLI.RK.KAS.......DEE....IEPVIAEIETQA..KE.HG.--I....EDPIV.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................APGRR..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LLd....................................................hIDA...GRI.L.A.K.A.H.I..YEMLSS.TVGKVTNR..............---IRQIVAARTQR----..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QTLFTLIE.........D.............SIAPVAAGS..................nDELM.E..R.SEDD.PS.TRDEN...............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
A0A1Y2EJZ2_9PEZI/539-784               ..............................................................................................................FKFK......DAH...TPFSAEGIELAALL.RR.KAP.......DEE....MQPVIDRIHAAA..LE.HS.---....IDPLV.....................SSTDVFMT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDI...........gAAS......................................................EAARL..Q...I....I.TSVVTYWS.AHP...G...TAISIIEK.LLNYS.IV.TPG.AVIDWA..LVsg..................................................kaGSG...GEA.L.S.K.A.W.V..FELVFS.TVVKVTTR..............VRQVATSG----------..........---...............----............................................................................----....----.AAD.GTAEAE.V.T...A.M.RELFKSME.........D.............TLVSWAQGTkd...............qmMDPA.-..-.EPMD.GA.GGNRE...............................................ELVQRW..GL..RW..LRVFRRRSAIEE-a............................................................................................
A0A0V1PAT1_9BILA/490-653               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.F.T.L..I-----.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------clfiysvqksvec................................................................................
L8FMN0_PSED2/534-785                   ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDVYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..YEMVAG.TVQKVTNR..............---IRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIQRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
G0V679_NAUCC/573-742                   .............................................................................................................l-YFR......NSM...VPMNEAVNWMKEYI.QK.HPT.......SPS....LPVLENALTKIK..NN.FN.SII....SKFDH.....................FSIVLLIH..MTL...YCGKKALSLTS.N.YIL.G..M.........HHI..LKGI............FDKin.................................................ipqIEKEF..M...I....V.EAILRFWN.SNP...H...IGFLVTEM.FLFHG.FV.SIQ.VILQFI..FNd....................................................yNGK...VYG.L.V.D.E.S.T..ILFTFR.ILD-----..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------yhtlp........................................................................................
A0A1V6T4M5_9EURO/532-785               ..............................................................................................................FKYL......SEM...TPYSKEGQELGQLI.RK.KAG.......DEE....IEPVIRSIEEQA..QE.QG.VE-....-DVKI.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KDR..LLAI...........gNES......................................................PKARL..Q...I....I.TSVMEYWA.DQT...G...IAINIIDK.LLNYT.IL.SPL.SVMEWA..LTe....................................................hISA...GTI.L.S.K.P.H.I..FEMISA.TIGKVTNR..............---MRQIVAARLQS----..........---...............----............................................................................SLYE....PQLS.ALD.ETLARE.R.V...E.M.GSLFKFLE.........D.............AVVSVAAGSnd...............elMERG.D..G.SGDL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAGVEE-a............................................................................................
A7TKT7_VANPO/594-761                   .............................................................................................................l-YFK......QDS...LPFAELTRRLIDFM.HK.NGE.......EKK....IEELESIVEEFK..EN.YG.TMF....TNFDK.....................FIVTIIVQ..CLA...HSGSRSLSHAN.K.YIN.D..L.........ADD..IKHI............FNKle.................................................iedDIKQF..T...A....I.EAIVRFWN.SNS...Q...TGFLITDA.FKYAE.II.SSK.SIFEFC..FFe....................................................kDNR...NYG.L.V.D.S.T.V..IEAIFR.NLSQ----..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------dp...........................................................................................
A0A1B8G1Y9_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHAQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----VSRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.A...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A094CPK7_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.EQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQT.M..E.GGNG.DT.--SDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A0V0V944_9BILA/490-752               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A1A9UGF8_GLOAU/489-772               ..............................................................................................................YKYAs...eeAGS...LAGTQVAHQLVVAI.RQ.KCS.......PEE....VINILKELPNSG..EN.SD.QEM....SDSSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKIQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLSNELNDAKEKFAKA..........DSSs.............sDS-Edeatpkr.............................................................kkpvtvvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..VG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0L0FDS0_9EUKA/1-118                 ...........................................................................................qvraavkklevplteeeiq----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............-----------------Aa........iAARed..........imnM--Dedlpa..................................................................dvdpeEYRK....DKLA.DMN.ETLTDV.L.Q...E.Q.KEAFLVVF.........Q.............QFIVVIGTY...................FEEK.G..Y.IEGT.NI.S--SD...............................................PWCTVV..LG..RL..LSFG-RRYHR---eia..........................................................................................
S6ENQ0_ZYGB2/750-829                   ...........................................................................................................qhl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...D.N.HDCFAFVS.........E.............RLVNIVNQC...................ISDL.G..L.QVDE.EI.N-IPDvsanpetni.............................gtdlpqwdlLWKYET..TM..GF..LKSILRKYVDEYR.............................................................................................
J7S6P4_KAZNA/583-831                   .............................................................................................................l-YFK......QEN...VPFAEITVELLDYI.HK.QND.......ART....YTELEEIINKLK..EG.HQ.SII....PDFDR.....................FVVILVTQ..AVV...HSGSRSLSHAN.K.YIS.D..L.........QED..LKTL............FNSlq.................................................ideSVKET..A...I....I.EAVMSYWN.SNS...Q...NGFLIVDA.FKFGG.MV.SSN.SIYSFC..LAd....................................................lEGN...IHG.L.T.D.V.T.A..IDTIFR.TLSQQLDT..............------------------..........---...............----............................................................................----....----.---.------.D.A...A.D.TADFELVF.........E.............KLCLIVNKT...................VEEL.E..I.QPED.QI.-VIPEieddtpvdp.............................vtevprldlMWKYSS..AV..SF..TKSLVRKYSDQFK.............................................................................................
D2VH37_NAEGR/629-880                   ..............................................................................................................FKYT......-PD...SPYHADATKLLDAIkGK.KKD.......NTE....VIELFSTLDCKD..DK.I-.---....-----.....................LLLDIFIS..CIL...S-NQKNLTEFS.D.LLT.Y..Y.........KEA..ISQLm..........dFDV......................................................LPQRV..N...I....I.RCLWRYWH.KSP...Q...RIILLMKKlLLQHD.II.SCQ.SLANYL..FT......................................................D-N...ELL.F.S.Y.G.Y.S..WDILKS.CLDTQITR..............ALRAFEYGDDSTSTSDTVpk......ikK-D..............nQPSDh..........................................................................fDLDK....AVKG.LDS.MFFKML.L.G...E.I.RETVYIIT.........R.............LLTEKLLTY...................D---.-..-.----.NV.K----...............................................SWEFNH..LY..GL..LKEVARLYQVYV-k............................................................................................
X1X825_ACYPI/407-512                   ..............................................................................................................FKYAi....eKSS...LPGQFLSNTLLTKI.RN.KTT.......PED....IIEILKE---PL..MS.EN.GEI....LEPADigi...............snpTKVDAFVQ..TLL...FIASKSFSHAF.A.AIT.K..F.........ISI..FKAL............GET......................................................DD---..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------gpianikk.....................................................................................
A0A0E0NUZ5_ORYRU/483-829               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A1D8PEB4_CANAL/619-796               ..............................................................................................................FNFT......NSE...LPFHETASKVYDFIlTH.WKS.......NTD....FNELYKSVLESI..TA.PN.---....--NER.....................FAINLIIQ..TYA...YIGSRSIYSVV.S.ILS.R..D.........INK..LKFL............SGApidyvgdear.................................fedlhfteeekQNRQN..W...I....I.EAVFRIWI.HQP...Q...VVFLILEY.LIEFG.II.DPK.YILVKA..LE......................................................S--...NLI.I.D.N.V.S.C..MESINR.ILSKAES-..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------k............................................................................................
E2LB17_MONPE/113-226                   ..............................................................................................................FEYN......DPA...KPHHDAAQSILNLF.RG.RAQ.......AGD....VIAHLDTLKSNL..ES.ES.SDSg.qlVNVDA.....................VMRSIAIQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LSL..LRFI............ASGgvsea............................................pgggiPEAKS..D...I....L.NA------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------.............................................................................................
I1QET0_ORYGL/454-801                   ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidnen.....ggdndssqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A093CEQ9_9AVES/187-467               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFGILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIDVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHRELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0R3RY35_9BILA/529-796               ..............................................................................................................YDLN......DDE...HPDRDFAMVLEKAF.RE.KIS.......ADE....MIDLLRSKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDAQL..T...I....L.RTLYETWK.LHG...Q...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KPE.F.E.R.L.W.I..WEVLNR.ALEHVSGH..............VRRSRQAIENAKLEKEQKe.......seH-Ekd..........dfgM--Etde.....................................................................hdmaDPNI....VGSF.VKE.SEFADL.Y.E...C.L.KNLLLDVL.........H.............KFTITLTEH...................IVNS.E..G.SGSD.FQ.N----...............................................NWYLYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
A0A1E4TS79_PACTA/680-942               .............................................................................................................m-KFL......KVS...NPLKDICFRIFENL.QN.YGS.......FEE....FNNLVADLKQQA..EP.FN.--I....PNIDR.....................YIINLVYQ..SAC...VIGSRSISHIS.S.FIG.V..A.........EFK..LKKTvg........ldV-Snilkeeeeyqg...............................dqfaviesegelKTRQQ..W...V....I.ESVLRIWN.HEP...Q...VGFLILEM.LLTRR.IL.TVD.ELLRTA..FD......................................................QEN...YAI.L.T.N.V.S.C..TESILR.ILENLK--..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lfnisnpkevqecymlffklivqnmnlvilkinpdentlitspdnedqvseenearwcfiglfllmksylrkfsneyi...............
A0A0N4YY38_NIPBR/18-177                ...........................................................................................................arr----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...-IIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESI...RSE.T.D.R.Q.W.V..WDVLNT.ALERLSRH..............IHKVAHDVHILQKRVERQ..........RAEt............geE-MEdg.......................................................................dakTREQ....EELE.QQQ.EKLDNL.K.D...F.Q.KSLFLDVL.........H.............KFTVLITEY...................IVHC.E..T.EGTD.FR.T----...............................................PYFSWI..NG..RF..KQIFLMHGS----dlh..........................................................................................
Q2GXY9_CHAGB/535-778                   ..........................................................................................................pklt----......KID...TPFAAEGREIAGLL.KR.KAD.......DEE....IDAVIQRIQSQA..ID.RE.---....IDALV.....................ASTDVFVT..CVL...HVGSKSLSHVL.A.AIE.R..T.........KDR..LADA...........gAAS......................................................DAARS..Q...I....I.SATMAYWS.AHP...G...VALSIIEK.LLNYS.IL.TPE.TVITWA..LVsr..................................................agNTR...GEA.L.S.V.S.H.V..YEMVFN.TVIKVTGR..............---VRQLVAKPALA----..........---...............----............................................................................----....----.---.AEDEDE.I.K...A.M.RALFAAIE.........D.............ALASWASGS...................KDEM.I..E.SSET.EA.NSEGE...............................................KLVRSW..GA..RW..LRVFRRRAAIEE-a............................................................................................
L5M790_MYODS/558-833                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......SDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.I.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELDEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
M2YNE3_DOTSN/561-812                   ..............................................................................................................FKYN......SDA...TPFAKEGREVLAAL.KK.KAP.......EEE....VQRILDSVHEQA..TA.M-.-SF....ADPLV.....................PSTDIYTT..SIL...SIGSKSLSHVL.S.TID.R..C.........KDR..LLSI...........gQQS......................................................EAARR..Q...I....I.ASVIDFWA.EHP...G...TAVNIIDK.LLNYM.II.TPM.AVIQYA..LHd....................................................rMDR...GRA.L.A.S.S.Q.I..YEMVSI.TMFKVTNR..............---VRQVL----RERNNM..........---...............----............................................................................SLPF....DQRK.QID.EALPRE.R.E...G.M.RELFAAIE.........D.............AVSAVANGA...................QDEM.I..E.--RY.DG.DSAER...............................................DMIILW..GN..RW..TRVWRRKAAVEE-a............................................................................................
S7QKB1_GLOTA/537-840                   ..............................................................................................................FEYD......EPS...NPYHNAAQSVLNLL.KG.RAK.......ADD....VLAHLETLKTTI..GE.TA.EGD....VNVDS.....................VIRSVAVQ..SLL...NIGSRSFSHFL.N.AIE.R..Y.........LAV..LRSL...........sTGG......................................................IDART..D...I....L.TAVSLFWK.RNR...Q...MISIVFDK.LMQYQ.IV.DPT.DVVAWT..FTngvg..............................................nergDTE...GPS.A.I.N.A.H.D..WDLLKG.ALDKANGR..............VLVARKRVSALRKEEDDTra......rvKASggd.........vasM--Evdae...................................................................akpdePPES....AALT.TAV.KAFTSL.T.T...Q.Q.KNALARAL.........D.............GFIACLAPL...................SSD-.-..R.RANP.YA.REVLTekawhn..................................ranwtddDWNAWE..TW..GW..YRHFCRAYSPYL-r............................................................................................
H9G962_ANOCA/602-888                   ..............................................................................................................YKYGd...esNKS...LPGYNVALCLNIAI.KN.KAS.......NDE....IFTILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TVL...HLAAKSFSHSF.S.ALG.K..F.........REV..FKTL............AES......................................................DEGKL..H...V....L.RVMYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VVTIQKELEETKARLAKQ.........hKRRds...........ddD--Ddddddddd...........................................................ddhsidredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VM.T----...............................................PWYKNC..IE..RL..EQIFLQHHQII--hq...........................................................................................
A0A1B9II90_9TREE/597-892               .............................................................................................................w-PYE......KPD...HPLHTEAKELLQLF.RS.KTS.......PSD....IRTHIENLPNSS..SG.NG.ESI....SED--.....................-IRKMVFE..TLL...HLGSRSFSHFL.N.ATE.R..Y.........LDL..LRYL............TSE......................................................SSSRK..L...L....L.ESVWTYWK.YSH...Q...MKLISIDK.YLQYG.IL.EGL.DIVEYL..FEsad................................................sdeVEE...GDG.W.T.D.G.W.K..FEILKM.TIEKHVGR..............TQSIKNRLKMIEREDEMAr.......arR-Aaellekg.gdvgegtG--Eedme....................................................................edtrAEGS....KAFN.DAQ.TSLDIQ.S.T...R.L.EKILIATI.........K.............QFVSSLLPT...................NSAS.-..-.-SNQ.GL.KGVLTllks.......................................geegLWSVRA..RL..GW..YKEFVRMWSA---hl...........................................................................................
C5DQ64_ZYGRC/757-834                   ............................................................................................................gd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.QECLTFIF.........E.............KLINITNEC...................ITQL.A..L.QPEE.AV.-NIPDvndtnieid............................wqndlpkldlLWKYET..TM..SF..FKSILRKYVDEYR.............................................................................................
A0A1D1VPL5_RAMVA/510-766               ...................................................................................................fdvenpetieg----......---...---VKQALEVHEAA.RD.KKE.......VTR....ILEIIKEVPRPE..--.-G.TSE....TDFNP.....................LQIEVFVH..VIL...GMYAKTFTHLF.T.ALN.K..Y.........APV..MRDL............LTG......................................................EQEQI..F...F....L.QSLYDCFV.NRE...Y...TIIVLIDR.LLRMQ.LV.DAT.SVVNWI..FS......................................................PEM...SMY.F.S.D.H.H.V..WEILQQ.TIHRVSTL..............VQKSQSELNEARARSKEA..........---...............ADAE...........................................................................vVREE....DAVE.ALE.EALDRS.L.S...Q.Q.KSMFLVIF.........Q.............RFVMAFTDY...................LEQQ.G..V.KGKP.TD.S----...............................................SWWKTA..IG..HM..QYILMTNYE----li...........................................................................................
A0A226F4E1_FOLCA/26-306                .....................................................................................................eeknivgwt----......---...-----QSKQLQAAF.RG.KAA.......LDE....ISVIMREVPNPL..DD.DE.AT-....HNP--.....................IAIDIFSQ..TVF...MLGSKSISHCQ.T.AIA.K..Y.........QLI..FKACl..........fN-Myile..............................................lvpnEDAQL..C...V....L.KAAHDVWK.NDT...Q...MMAIVVEL.LLKYH.II.ECA.SVANWV..FM......................................................KEM...TGQ.F.T.R.I.Y.L..WEILHM.TIRKMNKH..............VGKLSTELTDARDKLRKAemn....ssdS--...............---Eaeeenth..............................................................kgkenkdIPTE....EQVD.KME.EMLEAA.Q.A...D.Q.KNLFLIVF.........Q.............RFIMILSEH...................ITRC.D..T.DGKA.FN.T----...............................................PWFRWT..IG..RL..QQVFSQHADQV--aq...........................................................................................
NCBP1_MOUSE/485-760                    ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QV.DD.DDE....-GFRFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DKGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVEAA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQTIQ-q............................................................................................
A0A165CE58_EXIGL/461-559               .........................................................................................eaeslptkapgttfeyedpsa----......---...--------------.--.-QK.......AEQ....VISETETLRNHL..QE.SG.DAG....AEK-S.....................VVRVITLR..ALV...HVGSRSFSH-L.N.AIE.R..Y.........LPV..LRSL............VTS......................................................ARNAR..A...A....V.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------rlvqr........................................................................................
A0A2C6LAC5_9APIC/712-785               ......................................................................................................eerrilqv----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................---EN..A...I....L.TAIFGFWK.NSQ...Q...KTVMTLRH.FERFG.VV.SKE.AIIRFI..FE......................................................SLS...GVD.R.D.D.S.R.I..MEV---.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------fdllfqlc.....................................................................................
A0A2G2VR77_CAPBA/485-827               ..............................................................................................fkysaeegtdpteral----......---...------SLELKDMV.KG.RKT.......ARE....IISWVEENVFPT..HG.F-.---....----D.....................ITLGVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........AQV..IAKM............CTD......................................................DDQQV..K...L....I.TEVSSYWQ.NNV...Q...MTAIAIDR.MMSYR.LI.SNL.AIVRWV..FS.....................................................pLNL...DRF.H.V.S.D.S.P..WEILRN.AVSKTYNR..............ISDLRKEISSLERSVVLAe.......gaA-Srar.........qelE--Saesklsivdgepvlge...........................................npvrikrltsyaekakeE--EvsirESLE.AKE.ALLARA.V.D...E.I.EALFLSLY.........K.............SFVTALAEP...................LHDA.S..R.DGTL.RP.SGDADdmtidvedssvmeldkdde.........rpkksrpngsrerngynldEKQQWCltTL..GY..LKAFTRQYASE--i............................................................................................
G8ZLM5_TORDC/581-751                   .............................................................................................................l-YFN......QES...VPFSEEVRQVLDYI.HK.SND.......VRE....VSELETILESIK..EK.YG.ALI....SDFDR.....................FTIVLLVQ..TVV...HSGSRSLSHAN.K.YIG.D..L.........RDD..LNVI............FEKlq.................................................isnESKEF..I...I....V.EAVVRFWN.SNS...Q...NGFLIADA.FKHAG.LI.KPQ.AILSFS..FTe....................................................yDNK...NYG.L.V.D.G.T.S..IESTFR.SLSQEA--..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ddn..........................................................................................
A0A086TBE1_ACRC1/534-792               ..............................................................................................................FKFA......NPD...TPFSAEGQEIAALL.RK.KAP.......DDD....FQPIIDRIQAQA..SE.QG.---....LDPLV.....................ASTDVFMT..AVC...WVGAKSLSHVL.A.CID.R..T.........KVR..LLDV...........gGAS......................................................EVARS..Q...I....V.ASVMSYWS.AHP...G...VALAIVEK.LLNYS.IL.TPL.AVIDWA..VVgst...............................................psngTNG...GES.L.V.Q.A.H.V..FEIVSN.TVAKVTGR..............---VRQLY----N-----..........---...............----............................................................................--TP....AGGE.ADL.EARSKA.A.R...D.M.RDMFRSLN.........D.............ALSSWAGGSkdel..........megggG-GG.G..G.GGGD.DG.SDERE...............................................GLIRRW..GQ..RW..LRVYQRKVALEE-a............................................................................................
M2P8U5_CERS8/532-836                   ..............................................................................................................FEYD......DPA...RPYHDSAQSVLNML.RG.RAK.......ADD....VVAHVQSLKNTL..AE.GA.EGD....VNVDA.....................VVCSIAVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRSLa.........ggA-Gtgagg............................................gaaahHDARM..D...I....L.GAVYAFWK.RSR...H...MVAIVFDK.LMQYQ.IV.DPT.DVIAWT..FAh...................................................ggGRG...ARG.T.F.D.A.F.Q..WALLKG.ALDKANGR..............VMIARRKVAALRKEADDNa.......arA-Ka.............sETMEvdaea.................................................................kpdvipAAET....PALN.TAL.KAFATL.T.R...E.Q.KAALARAL.........D.............GFVDYLVLE...................-GTA.A..A.KTRE.VI.T---Ekawhar...................................aswdegEWEAWE..TW..CW..FRHFVRAYSPYL-r............................................................................................
A0A2D0SDQ6_ICTPU/484-765               .............................................................................................................qYKYAd...esGSS...LPGYVVATSVGNAI.KN.RAS.......NEE....ILTVLKEVPNPN..QD.ED.DDE....GDGFN....................pLKIDVFLQ..TLL...HLAAKSCSHSF.S.ALA.K..F.........HEV..LKTL............TES......................................................DEGKL..H...I....L.RVVYEAWK.NHP...Q...MISVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PDM...AHD.F.T.K.L.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLEKQq.......hkK-Kds..........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.ASVD.IN.T----...............................................CWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A1G4JAP1_9SACH/581-821               ............................................................................................................lf--FA......QSC...FPFSEQIQNVVNYF.HQ.QPL.......DRN....VSELAAIFEDIQ..KA.YG.NII....VDFNR.....................FVTTILIQ..ALT...FSGNRSLSHAN.K.YIG.D..S.........KND..VLEL............LSKmd.................................................vtqELKER..W...L....I.EAIIRFWN.SNS...Q...NGFLIVDT.CKNFE.LV.SAK.SVLHFS..FLe....................................................dNDR...VWG.L.V.D.A.T.S..VESTFR.TLTELSLR..............------------------..........---...............----............................................................................----....----.---.------.R.D...A.D.VETFIYLF.........E.............RLVDIAAET...................TEKL.G..T.SPDV.PV.AVN-Esstdf.....................................relelGWKYES..CL..GF..IKSVLRKYGDEY-a............................................................................................
A0A178AY30_9PLEO/559-812               ..............................................................................................................FKYD......NPQ...TPYAAEGQTLLAQL.RK.KAP.......AED....MQATIDKIHEKA..LE.QG.--I....AEVLV.....................PSTDAFVT..AIC...RLGSKSLSHVL.S.CIE.R..G.........KDR..LLEL............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGn....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA-SARLE---K..........---...............----............................................................................NLPQ....EQID.MVE.ATLAKD.R.Q...N.A.RELFTYIE.........D.............SMRGVEEGSa................dvL--I.E..K.QSNG.AL.SEE-E..............................................vMLIRAW..GK..RW..HTVFNRKRAVEE-s............................................................................................
A0A1V6S0E5_9EURO/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELTQLI.RK.KAT.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...YVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gAES......................................................QRARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVAKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLS.IID.ETLARE.R.A...D.M.QTLFKYIE.........D.............SIVSIAAGSnd...............eqMERG.D..G.SGTQ.PQ.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-a............................................................................................
A0A0D2EPL9_9EURO/555-807               ..............................................................................................................FKYN......DDS...APFAAEGKEIAQLI.RR.KAA.......DEE....FSPIMDKIEQEA..TA.S-.-NI....PDPQL.....................ASADAFVT..SIC...WVGSKSVSHVL.A.CIE.R..C.........KER..LLAI...........sSTS......................................................AACRK..Q...I....V.TSVMDYWK.DST...G...VGVVILDK.LLNYQ.IL.TPA.SIVEWA..LId....................................................hVAR...GTL.L.A.R.T.W.C..YELVDK.TTRKVASR..............---VRSIVHAIRQP----..........---...............----............................................................................GLAD....DQKS.ELQ.QALTEE.L.E...G.M.KALFAIIE.........D.............AVVSIRDGN...................QDEM.I..E.-SSD.AL.RAEDE...............................................DLLRSW..GA..KW..AKVFQRKYGVEE-s............................................................................................
A0A218UIU8_9PASE/735-796               ....................................................................................................fnlmrlnefg----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--FFSPLL.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A177VKY6_9BASI/789-1181              ..............................................................................................................FTYE......PQS...HPLHSHASEILRAI.RA.KAT.......HAV....VDTQLESLRRDI..VV.AS.GSD....VPPMDidgaqsdkl...avsepdaehVQRDVFIQ..CLL...LAGSRSFSHFL.N.VVE.R..Y.........HSV..LRQL............SSN......................................................PNARL..A...M....L.GAASRFWA.RSP...Q...WTLIVFDK.LLQYR.IV.EPA.DVITFV..FHpptaldiitqgsgngvstsf..............sktnevqveistgaagastvTER...LRD.W.S.T.F.G.W..WDIVKL.TVEKVNGR..............VDQLQARLATNEKKDEADqe......rkD-Aaat.........tatA--Kkegqaadesgtngngatgaggtss............................slfpssaaeversmreaaekaereRVMK....NATG.EAR.KALEAI.R.V...E.Q.RKVLVGTT.........S.............GFVHLLRVTeal............agpkVAEM.D..E.DAEE.GG.VG--Nddvp.......................................ateaEWQAWW..VG..KW..YHEFVRLFVKH--la...........................................................................................
A0A1I8GZ77_9PLAT/452-762               .................................................................................................ykydieedfspev----......---...---VQSAQRLIDAI.RE.RCT.......PER....AIEVLNTLPVPA..GG.AE.NGG....PNERHl...................lLKVDVFFS..TLL...FLGSKSFSHSF.A.ALA.K..F.........HSV..CKALv..........pLDN......................................................QAAKL..R...V....L.ASLYECWR.WHE...Q...MLIVLLDK.LVKVQ.LV.DCQ.AVFDWL..FGdclg.............................................dsgegLLP...KQE.L.S.R.C.Y.S..WDAAES.TLSKMCKQ..............LARLNEDWAKARQRYDSY.........hE-Kmrs.........gtaGDEDaaaaqklptdq......................................................sgpaamlvdedTPTR....DELD.AKL.DRLEKA.R.Q...E.L.RLLVAC--.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------llrcavwgaegggipsdeacsgsgdeeanerhlrrlvyerslacltmhysdv.........................................
W0T9K6_KLUMD/580-825                   .............................................................................................................l-YFR......SPS...FPFHEDVTRLLDFF.HK.QPD.......TRT....VGELEDILKDIT..ES.NS.AII....QDVNR.....................FAVTLLIQ..TVV...FCGSRSLSHAN.K.YID.D..S.........KKE..LAAVld.......qleVSQ......................................................EIKDQ..W...I....C.EAVVRYWD.SNS...Q...TGYLILDS.FRYNG.LV.SNK.AVLNFS..LT......................................................EQYg.vNMS.L.V.D.S.T.S..IESIFR.LLNEMAVT..............------------------..........---...............----............................................................................----....----.---.------.E.D...K.N.VELFEYVF.........N.............RLVAAANTV...................VGEI.G..T.ADPI.--.-VAPDleseiqtt..............................eqelplldlAWKYEG..IM..SF..LKSILRKYADEY-s............................................................................................
I1N7Z9_SOYBN/489-828                   ....................................................................................................aedgkesneh----......---...----VLSGQLNNMV.KG.KAP.......VRE....IISWIDESVFPS..N-.--.---....--GLE.....................VTLRVVVQ..TFL...NIGSKSFTHLM.T.VLE.R..Y.........GQV..FAKV............CPD......................................................QDKQV..M...L....I.AEVSAFWK.SNT...Q...MTAIAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................AEN...IEQ.F.H.T.SdR.P..WEILRN.AVSKTHNR..............ISDLRKEILSLKKNFSSAee.....takE-A..............kA--Eldaaeskltlvdgepvlgd......................................nptrlnrlklhaektknevVSLQ....KSSE.AKE.ALLAQA.M.E...E.N.EALFLLLY.........K.............SFSNVLIER...................LPEG.-..-.----.--.-----...............................................------..--..--..-------------artlhelksaqvdvvmavdpeepssmeldnesqrpqnsqtngekkggaynvgekeqwciitlgyvkafsrqyaaei.................
A0A0F4YQT7_TALEM/531-784               ..............................................................................................................FKYD......TDT...TPYAKEGRELMQLI.RK.KAS.......DEE....IQPVINAIEEQA..KE.HG.V--....SDPMI.....................PSTDAFVT..SIC...YVGAKSLSHVL.S.CIE.R..N.........KER..LLSI...........gPRS......................................................STARR..Q...I....I.TSVMEYWA.DQP...G...IGINIVDK.LLNYT.IL.TPL.SVLEWA..LVd....................................................nLDA...GKI.L.A.K.T.H.I..YEMVSA.TVGKVTNR..............---MRQIV----LARTQP..........---...............----............................................................................GLYE....PQLS.VLD.ETLKRE.K.G...D.M.QTLFTLIE.........D.............SLVSVAGGS...................NDEL.M..E.RSNE.GD.TFTEN...............................................ELIRHW..AH..RW..LRVFRRKAAVEE-s............................................................................................
A0A026WWH0_OOCBI/488-764               ..............................................................................................................YKYSs...egASS...LPGTAAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPR..EN.EE.TNN....YNP--.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.KNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIATWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELAEAREKLRRA.........eS-Rsg...........ssS--Deedtn.................................................................rernreRPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..VG..RL..QQVFLSHQEQVQK.............................................................................................
A0A0G4MMZ4_9PEZI/2521-2765             ..............................................................................................................FKFS......DET...TPFSAEGRELAALL.KR.KVP.......DED....FQPVLDRIHAAA..TE.HS.---....LDALV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..V.........KDR..LLDI...........gAAS......................................................EAARA..Q...I....I.TAVMAYWR.AQP...G...VAISIIEK.LLNYS.IL.TPL.SVIEWS..LVyn..................................................hsERE...GDA.L.A.E.A.H.V..FELVSN.TVTKVTGR..............---VRQIMTAPELD----..........---...............----............................................................................----....---A.DAE.ASKELD.K.K...A.M.RDLFSSLK.........D.............ALSSWKAGI..................kDEML.D..E.PDSE.E-.---RK...............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
A0A238FEX2_9BASI/692-957               ........................................................................................................lvaveh----......--A...SPYAALAGRILDLV.RA.KGS.......TSD....IETELKGIDATL..QT.DH.SLT....ADQAR....................dLILDMAVQ..SIL...SVGSRSFSHFL.N.VLE.R..Y.........LLL..LRSL............TPS......................................................SSARL..K...L....L.KSAATFWM.HHR...Q...FHLIVLDK.LLQYR.LV.DAA.DVITWV..FD......................................................PTR...NGS.W.S.D.M.D.D..WLALSA.TIKTLQGR..............VKAAQGRLEGLFTEADTQr........aQ-Eqv...........tsT--Dlddst.................................................................mdaltePSDT....TDIT.LAR.TQLSTL.T.T...D.L.CTLLLTIL.........T.............HFSTLLPES...................R---.-..-.---P.TD.-----...............................................SWSTFW..IE..GL..FREFCR-------llie.........................................................................................
A0A0C9UKP4_9HOMO/543-829               ..............................................................................................................FDYD......DPS...NPHYDSAQSLLSLL.RG.RSN.......VTE....VMNHVETMKNNF..ID.NG.ETE....QRAST.....................LIRSMVMQ..SLL...HIGSRSFSHFL.N.AME.R..Y.........LQL..LRTI............SV-......................................................AEGKA..D...L....L.DAAGDFWR.KNS...Q...LIIVVFDK.LMQYQ.IV.DPT.NVVVWA..FAp...................................................rqSKR...GLP.G.L.T.T.D.E..WQLVKA.AIDKSIGR..............VAISKRRLAALRKEEDDA..........RARvkagt.....dggvgM--Dvdae...................................................................mkeeaVEQS....PALA.TAL.KGYSTL.T.Q...E.Q.KNTLARVL.........S.............EFVSALKSS...................SHIL.N..D.DAWH.KR.S---Swe...........................................qpEWGPWE..TW..GW..YRHFLRLYSPHL-r............................................................................................
H0YTB3_TAEGU/483-763                   ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DGE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................stdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1W5CYM6_9LECA/544-795               ..............................................................................................................FKYD......SDR...TPYSAQGIEVLRLL.RA.KAP.......ETD....TQRQLTSIEETA..KS.LG.V--....TDPLV.....................PSTDAYVT..AIC...FIGSKSLSHLL.S.CVE.R..C.........KER..LLAI...........gPQS......................................................ESARR..Q...I....I.GSVMAYWQ.DQP...G...IGVNIIDK.LLNYT.IL.TPM.SVIEWA..LVe....................................................hPDR...GWT.L.A.H.A.H.V..YEMVAG.TVFKVTNR..............---VRQIV----LTRNQP..........---...............----............................................................................GLPG....PQVA.LLD.ETLARE.R.A...E.Q.AKLFATLE.........D.............ALVGVADAS...................LDGM.-..L.EGRE.MG.-EQET...............................................ALLQGW..GH..RW..LRVFRRKMAVEE-a............................................................................................
A0A1C7M6I6_GRIFR/468-765               ..............................................................................................................FEYD......EPL...NPYHDAAQTVLNLL.RG.RAK.......SED....VMAHLETLRNSL..SE.TV.EAD....VNIDS.....................LVRSIAVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNL............AAGgist.............................................gggsdTYART..D...I....L.SAVAAFWN.RSR...H...MVVIVFDK.LMQYQ.IV.DPT.DVVFWT..FTqc..................................................ktMSA...NKK.T.F.G.A.F.Q..WDILKG.ALDKANGR..............VMVARRKVAALRREADDN..........AARaias.......dtatM--Evd.......................................................................geaRPES....PALT.SAL.KAFATL.T.R...E.Q.KSALSRTL.........D.............GFVDCLAVE...................SASS.-..-.QVRE.VI.----Taeawdn..................................radwteaEWDAWE..TW..GW..YRHWSRVYSPYL-r............................................................................................
A0A0B4GP33_9HYPO/534-779               ..............................................................................................................FKYT......NPD...TPFAKEGQEISALL.RR.KAP.......DEE....IQPLIDSIQAQA..KE.QA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDV...........gTAH......................................................PAARS..Q...I....I.SSIMNYWA.AHP...G...VAITIIEK.LLNYS.IL.TPF.SIVDWT..LVass...............................................psngTQG...GEA.L.G.R.S.H.I..FELVAN.TVAKVSGR..............---VRQLLTSPDA-----..........---...............----............................................................................----....----.-DA.DTRDKE.V.S...S.M.RDLFAAIN.........D.............ALASWASGS...................KDQL.M..E.DGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
H0XA17_OTOGA/487-762                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
NCBP1_ARATH/479-814                    ................................................................................................kagpnfmysleegk----......-EK...TEEQQLSAELSRKV.KE.KQT.......ARD....MIVWIEETIYPV..HG.F-.---....----E.....................VTLTIVVQ..TLL...DIGSKSFTHLV.T.VLE.R..Y.........GQV..FSKL............CPD......................................................NDKQV..M...L....L.SQVSTYWK.NNV...Q...MTAVAIDR.MMGYR.LV.SNQ.AIVRWV..FS......................................................PEN...VDQ.F.H.V.S.D.Q.pWEILGN.ALNKTYNR..............ISDLRKDISNITKNVLVA.........eKASana........rvelE--Aaesklslvegepvlgen.........................................pakmkrlkstvektgeaeLSLR....ESLE.AKE.ALLNRA.L.S...E.T.EVLLLLLF.........Q.............SFLGVLKERlpdptk.......vrsvqdL---.-..-.--KS.--.----Igaeddkpsamdvds..................engnpkkscevgereQWCLST..L-..GY..LTAFTRQYAS---ei...........................................................................................
A0A182V1T5_ANOME/24-310                ...........................................................................................................elf----......ESS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaaspnaqk........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A1L1RQK9_CHICK/1-42                  ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---MLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
K4AKQ7_SETIT/483-829                   ......................................................................................................fkflsdes----......NEK...TDGHKLSKELVGMV.RG.KKN.......TRD....IILWVEE---QI..IP.TN.---....--GAE.....................FALDVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAIAIDR.MMGYR.MI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asan........aireL--Eeaksvleivegqpapaer........................................pgrlrrlqayadkakqeeVSME....ESLE.AKG.ALLARA.L.E...E.S.KELLKLLF.........K.............SFVDVLTERlptvsad....geipnlraG---.-..-.----.--.----Dqnvnfaardletatmeidne......ngadknsepngqntkdgynvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
F9XIC9_ZYMTI/534-785                   ..............................................................................................................FKFN......NDQ...TPYAKEGREVLALL.KK.KAA.......EEE....IQKVLDSVHAQA..SE.RG.V--....EDPLV.....................PSTDIYMT..SIL...SIGSKSLSHVL.S.TID.R..C.........KER..LLEI...........gGRS......................................................EAARR..Q...I....V.ASVLDFWC.DHP...G...TAVNIVDK.LLNYT.II.TPM.AVVQLA..VQd....................................................rIDR...GRA.L.A.S.S.Q.V..YEMVSI.TMFKVTNR..............---VRQVLRERNNI----..........---...............----............................................................................KLPF....EQRQ.QID.EALPRE.R.Q...G.M.RDLFAAIE.........D.............AVSSVAAGAnd...............emIERY.-..-.DGD-.--.-SEEQ...............................................QLIQLW..GS..RW..ARVWRRKAAVEE-a............................................................................................
A0A084FX57_9PEZI/537-776               ..............................................................................................................FKFN......NPD...TPFSAEGQEIATLL.KR.KSP.......DED....FQPIIERIHSTA..LD.NG.---....VDPLV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LVDV...........gAAS......................................................EGARA..Q...I....I.TSVMNYWQ.AHP...G...VAVSIIEK.LLNYS.IL.TPL.SVIHWA..LIgts...............................................haggKRT...GDV.L.A.K.W.H.I..FELVFN.TVAKVTGR..............VRDVARGNPD--------..........---...............----............................................................................----....----.--A.ETQSDE.V.K...A.M.RELFRALE.........D.............ALIGWSTGT...................--NG.E..A.TDGD.SQ.-----...............................................TYVRDW..AE..RW..LRVFRRKSAIEE-s............................................................................................
B2VVN1_PYRTR/556-810                   ..............................................................................................................FKYD.....nQVD...TPYAAEGQMLLTQL.RK.KAT.......SEE....IQATIDSIHEKA..LE.QG.--I....TEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLQQ....EQTE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............SMRGVAEGS...................ADTL.V..E.KSSNgEL.TD--Ee.............................................vQLIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
G3BB60_CANTC/620-878                   ..............................................................................................................FVFG......NDQ...LPYHHVCDKFHKFLlSN.SKS.......KRE....FAEMIEELKSDI..TS.D-.TI-....-NKSK.....................FIINLVLQ..TYC...SIGSRSIYSTI.S.ILT.R..D.........LVK..LKWL............TGNtlseedyvgnsedy..........................kfpelslqneheqtAELQN..Y...V....V.DAVFRIWI.YRP...Q...FIFLILEY.LVDVK.LL.DFE.VFVGRC..FD......................................................LEH...NLV.V.D.R.I.D.C..FEALAR.LLAASSKA..............HDL---------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aritvvtskiienlgqvldklevsddaivpidnytaetaakndlqwlyydyldlfkwvarkygtste..........................
W3X2I8_PESFW/541-785                   ..............................................................................................................FKFN......DDH...TPFSAEGKELASLL.KK.KSP.......DEE....VQPVIDRIHSGA..LE.HA.---....IDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.AIE.R..T.........KDR..LLDI...........gAAS......................................................EAARQ..Q...I....I.TSVMEYWS.AHP...G...IAISIVEK.LLNYS.II.TPA.AVIDWA..LVsg..................................................kaGSG...GDA.L.A.K.S.W.V..FELVFQ.TVIKVTGR..............---IHQLA----SAE---..........---...............----............................................................................----....----.AEN.GAAESE.T.T...A.M.RELFKAME.........D.............ALVSWAQGS..................kDQML.D..P.AEPM.DG.VENRE...............................................KTIQRW..GQ..RW..LRVFRRRSAIEE-a............................................................................................
B8APF3_ORYSI/471-817                   ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A1Q9DRU3_SYMMI/1197-1409             .........................................................................kaeedkeepdakrqktdakppvhedfgesppepwrle----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EVAELVLS..VML...QQGHKTPTHMA.K.ILD.G..H.........VEV..LMKLnp.......edeTAA......................................................DSFGK..A...L....A.KCVFEFWR.ANG...Q...RLELTIDS.LLNRK.VL.SPR.PVAEVA..LL......................................................S--...-KD.C.D.S.M.H.I..RNVLHT.AVRKGLDR..............LQSARTELAVAKKL----..........---...............----............................................................................-VQE....DALE.KRR.TELDNA.I.Q...Q.V.ASLFLCIF.........T.............GLVRNVEDA...................----.-..-.----.--.-----...............................................------..--..--..-------------rndaslckirlr.................................................................................
A0A074SNC0_HAMHA/836-1116              ......................................................................kkrerrefsesaedaidasskrglneesheegtkasgdec----......---...--------------.--.---.......---....------------..-E.AN.SDP....YEDDEeghv.............wtltDLSQVLVF..ALL...ARGLKTLTHSE.R.LVE.N..Y.........FPV..LQFLk.........kgA-Shkaflemrpatleaagddedard.......gddsdtemedeadedgltkterraQEVEE..A...F....L.KAIFDFWK.HSR...Q...KTVLTVRH.FQRFG.VV.SKE.GVVRFV..FD......................................................SLT...STD.R.D.D.S.R.V..MELFDL.LLQLSMQD..............-------F---ESKKETAl........qLSE...............GCSD...........................................................................aAERN....ERAK.AVS.AAVEAL.E.D...V.Q.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------mllhfivvgfmrellreeqaarrv.....................................................................
A0A0D2UPB5_CAPO3/632-939               ..............................................................................................................YPFE.....eTEA...TQDASVAKALVTSY.LN.KES.......KAN....VLNVLNMVEESS..NP.EL.TL-....---AQ.....................ARFRLFLF..SLL...QAGSKSLSHIS.T.LLE.R..Y.........IEA..FDDFtqmy....ggddSAA......................................................ESLRF..D...T....I.KILTEFWK.DNE...Q...MLIILIDK.LITLR.LL.TPS.TVVEWL..FL......................................................SEN...VVN.F.H.R.F.Y.Y..WEIVIN.SLSKLQFK..............SQQARQAYNKARLDLDDTmr......krN--...............--EErallneqlqeltgmgstlsd....................................satmvvsklqtrlrgimseeSQED....ERLQ.ALE.SHLDTV.Q.T...D.F.RAVFLQLF.........T.............RFQVVISDH...................LSNA.R..Q.NDTA.YN.T----...............................................PWFHHT..VA..RL..LDVGRKYHEE---isa..........................................................................................
A0A1B8D2S1_9PEZI/534-779               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYDQ..SRF...P--------TF.F.RIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMVTRA.QRP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTEE...GDE.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFEAME.........H.............ALFSWASGS...................KDQA.I..E.AGLG.ET.ETTDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A194QDU2_PAPXU/21-297                ..........................................................................................................pyvp----......NPS...LPGTEAAHRLVVCV.RN.KCT.......PEE....ALNVLRELPNPL..RD.GD.AA-....PHPHYn...................pLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...V....L.KNVWELWQ.RQP...Q...MVCVLVDK.MLKTQ.VV.ECS.AVATWL..FS......................................................KDM...APH.F.T.H.N.Y.L..WEILHL.TIDKMNKH..............VSKLSGELQEAREALARAdss....ssdS--...............---Edesgtk................................................................kkkdhdKPTE....EAVE.RME.ERLELA.H.T...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DARD.PN.T----...............................................HWYRST..VA..RL..RHVFLVHHEQVQK.............................................................................................
A0A2H3JXV5_WOLCO/535-840               ..............................................................................................................FEYD......DPA...KPHYESARSVLDLL.RG.RAK.......ADE....VVAHLDTLRNTI..SE.TA.DGD....TNVDS.....................VIRSIAVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPV..LRKI............ASGgta...............................................ggvnVDARM..D...V....L.NAVFAFWK.RSR...H...MVVIVFDK.LMQYQ.IA.DPT.DVVAWT..FAfgg................................................gadGSA...GKS.T.F.H.A.F.Q..WDVLKG.ALDKANGR..............VMIARRKVTALRKEADDNa.......arA-Kasd.........tatM--Evdseak................................................................tadvipSAES....PAVT.TAL.KAFTTL.T.R...E.Q.KAALARAM.........D.............GFVDCLVAEar..............pnpL---.-..-.----.-A.REVITekawhn..................................ranwgeaEWETWE..TW..GW..YRHFGRMYSPYL-r............................................................................................
G8JUZ8_ERECY/578-824                   ............................................................................................................ll--FK......NEA...FPFHDKVQLILDYF.HK.QQL.......EKN....VSELESLLEDIR..TT.CS.AQI....PDFDR.....................FTVTLLIQ..ALV...YSGNRSLSHAN.K.YIS.D..A.........KND..LVMIlg.......kiaLSD......................................................VVKEQ..W...I....I.EAVIRYWN.CNS...Q...NGFLIVDS.FKHSE.LV.TAK.SILAFS..FSd....................................................lNGQ...NLG.L.V.E.A.T.S..IESTFR.TLTQLALQ..............------------------..........---...............----............................................................................----....----.---.------.Q.T...S.D.ISVFEFVF.........E.............RLVTIANET...................ISQL.G..M.PDEE.IV.A--PLvdnesmld..............................ddelsrldlMWKYES..TM..GF..IKSILRKYSDEY-s............................................................................................
A0A0N4V760_ENTVE/502-756               ............................................................................................................yy--LG......EEE...NPSVELARSFESSI.RE.KKT.......PDD....VARLLGKNGES-..--.--.---....-----.....................--LAVFLS..VLL...YNARTTFSHSF.A.ALT.K..Y.........YQI..LKNV...........vGNS......................................................EELQM..V...V....L.VTVYDLWK.NHH...Q...MIVLLIKK.MLVMS.LL.DAH.TVVAWI..FS......................................................EDM...KKE.F.E.R.L.W.I..WELLCI.TLQHVTGH..............VERASQALESLQLRSASRk........kI-Kd.............pENEDve.......................................................................edmTAVD....DEIT.AKE.NELAEL.R.E...F.L.KNILLSVL.........H.............KFTILLTEH...................IVSC.E..A.TGTN.FN.T----...............................................DWYRLI..TG..RF..QGIFLL-------fwetl........................................................................................
R0HWP4_9BRAS/473-814                   ..........................................................................................eellpakagqnfmysleegk----......-EK...TEEQKLSAELSKKV.KE.KQT.......ARD....MMVWIDEMIHPV..HG.F-.---....----E.....................VTLSVVVQ..TLL...DIGSKSFTHLV.T.VLE.R..Y.........GQV..FAKL............CPD......................................................SDKQV..M...L....L.SQVSTYWK.DNV...Q...MTAVAIDR.MMGYR.LV.SNQ.AIVRWV..FS......................................................PEN...VDQ.F.HvS.D.Q.Q..WEILGN.ALNKTYNR..............ISDLRKEITNITKNVLVA.........eKASana........rvelE--Aaesklslvegepvlgdn.........................................pakmkrlkstvektgeaeLSLR....ESLE.AKE.ALLNRA.L.S...E.T.EVLLLLLF.........Q.............SFLGVLKERlpdstk.......vrsvqdL---.K..S.----.--.----Igaeddnssamevdt..................engnpkksceigereQWCLST..L-..GY..LTAFTRQYAN---ei...........................................................................................
V8NT05_OPHHA/422-695                   ..............................................................................................................YKYGd...enNKS...LPGYNVALCLSIAI.KN.KAS.......NDE....IFTILKDVPNLN..QE.ED.DDE....GFS-Yn...................pLKIEVFVQ..TLL...HLASKSFSHSF.S.ALG.K..F.........REV..LRTL............AES......................................................DEGKL..H...V....L.RVMYDVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VMMIQKELEEAKERLTKQ.........qK-Rrdd........srrnE--Re..........................................................................nWPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VI.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0D3BDL2_BRAOL/484-811               ...........................................................................................................yry---Sle..egKEK...TEEHQLSAELNRKV.KE.KQS.......ARD....MMSWIEETIYPV..HG.F-.---....----E.....................VTLTVVVQ..TLL...EIGSKSFTHMV.T.VLE.R..Y.........GQV..FGKL............CPD......................................................NDKQV..M...L....L.SQVSAYWK.NNA...Q...MTAVAMDR.MMGYR.LV.SNQ.AIVRWV..FS......................................................PEN...VDQ.F.HmS.D.Q.T..WEILGN.ALNKTYNR..............ISDLRKDISNITKNVLVA.........eKASana.........raeL--Eaaesklslvegepvlgen........................................pgkmkrlkstvektgeaeVSLR....ESLE.AKE.ALLNRA.L.S...E.T.EALLLLLF.........Q.............SFSAVLKERlpep..........akarsLEDL.-..-.KSED.EN.SSAMEvdtengnpk.............................krseigdreQWCLST..V-..GY..LTAFTRQYANE--i............................................................................................
A0A1S3TW25_VIGRR/1-252                 ............................................................................................................ml----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....I.AEVSSFWK.SNT...Q...MTAIAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................AEN...IEQ.F.H.T.SdR.P..WEILRN.AVSKTHNR..............ISDLRKEILTIKKNISSAe........eA-Ake...........akA--Exdaaeskltlvdgepvlgd......................................npvrlnrlkshaekttedvVTVK....ESLE.SKE.ALLVRA.I.E...E.N.EALFLLLY.........K.............SFSNVLTER...................LPEG.T..R.TLHE.LK.SVQVDvmavdaeepptmelddenq.........rsqnsqsngekkggayvvgEKEQWC..ITtlGY..VKAFSRQYAAE--i............................................................................................
A0A0C2FV02_9BILA/1-108                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..Y.........SNT..LKTV...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESL...RSE.N.D.R.Q.W.I..WEVLNT.ALERLSRH..............IHKVAHDVKILQKRVDRQ..........KA-...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------enee.........................................................................................
A0A162XBG2_DIDRA/751-1004              ..............................................................................................................FKYD......NQQ...TPYAAEGQALLHQL.RK.KAP.......AEE....VQATINKIHEQA..IE.HG.--I....TEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KER..LLEI............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..LEMVSN.TVAKVTNR..............---NRQIASARIQ----K..........---...............----............................................................................GLPT....EQIE.MVD.ATLAKD.R.D...N.A.RELFKYIE.........D.............SMRGVSEGS...................ADTL.M..E.KKAS.GA.LSEEE..............................................aQLIQAW..GK..RW..HQTFLRKAQVEE-s............................................................................................
A0A1Y1HIP1_KLENI/8-158                 ....................................................................................................gnaadverrl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..-DALDT.CLETIKHD..............IKQIKLNLQEVKEREDSSk.......gnE-De............vaKEADa.........................................................................irEVSL....KSLV.EMR.EELQNV.V.D...K.M.PALFVETF.........G.............KFKTEISET...................VRSQ.T..Q.ELTS.AN.K----...............................................------..--..--..-------------tvsssppektlkldgkerehvvtsplqqkitsflpvvkrssgg..................................................
A0A0L0HNA1_SPIPN/523-800               ..............................................................................................................FKFEse..etTGD...AQLYELTSQLRSSL.AT.KSG.......AEE....ISDLLQRIRDHA..TS.NA.PNA....MEGVVgasgg..........tgtpedLAREALVQ..CVM...QQGSKSFSHVL.N.VVE.R..Y.........LTV..LRDY............NGT......................................................EEARS..H...T....V.RIIVDFWK.DNT...Q...FLEIILDK.LMNYR.VV.TPK.SILSWA..LD.....................................................pSVL...DSH.Y.T.R.F.H.L..WSIVRT.TLAKVNFK..............IAQITAKLEAARRQSSVD..........N--...............---Dlm........................................................................lqDGDD....SVIQ.SLE.ENRQGA.L.R...E.Q.KEVFLHVF.........Q.............RFVDAIRNK...................CRSL.E..S.QGID.PT.R---T...............................................AWYRWV..MG..NM..RE-----------vargfptevk...................................................................................
A0A0C4E5K4_MAGP6/541-788               ..............................................................................................................FKFA......KDD...VPFAAQGREMVKLL.KS.KVP.......DEE....IQPLIEQIQNEA..VD.QG.---....RDPLV.....................SSTDVFMT..AVL...AVGSKSLSHVL.A.CIE.R..V.........KDR..LLDS...........gSAS......................................................AAART..Q...I....I.AAVMAYWS.AHP...G...VALSIVEK.LLNYA.IL.TPQ.VVVEWA..VGa....................................................eAGD...EAR.L.A.H.S.Y.L..YELVLN.TVIKVSGR..............---ARQMVAQQQTAKPTA..........---...............-DGDlimadasng..........................................................dgaghvpyvD---....----.---.---TPE.A.K...D.L.RELFQLIE.........S.............ALKARIRDA...................MEDT.-..-.----.--.-----...............................................------..--..--..-------------teddfaadvgfavnathli..........................................................................
A0A200QUS7_9MAGN/492-829               ......................................................................ykesselalsvelssmvkgrtiareiiswidekiipvhgp----......---...--------------.--.---.......---....------------..--.--.---....----Q.....................IALEVIIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CPD......................................................QDKQV..M...L....I.DEVSSYWK.NNT...Q...MTAITIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PAN...IEQ.F.H.T.SdR.P..WEILRN.AVNKTYNR..............ISDLRKEISTLEKSVLSAee.....aasKA-...............---Kaeletaetklalvdgepvlg....................................egpvrmkrlksyaeraneelVSVR....DSLE.AKE.ALLARA.L.E...E.N.EALFISLY.........K.............RFSDVLMERlpna..........spdgtMRSL.R..F.GQTD.TM.AVDSEepsemevdntngepk................ksqsngarssngynigE-----..--..--..-------------keqwclstlgyvkafsrqyatei......................................................................
M7NT24_PNEMU/460-716                   ..............................................................................................................FDYE......LPN...SKYYAEVGTLLETM.KV.NTE.......QSE....TDVALEIIEKTA..IE.NN.EN-....-DPPY.....................EALKALVQ..CVL...HLGAKSFSHAL.N.TIE.R..N.........LPG..LQAR...........cNAN......................................................EKTRR..Q...T....I.DIIIRFWK.DQP...T...IGTTLINK.FLNYS.VI.DAV.SIIEWI..IL......................................................DAD...IEY.V.G.R.S.F.T..WELMKI.ALNKVNST..............PVQIKDRINMETSHNEP-..........---...............----............................................................................----....GSLS.NYR.KVYDEV.Y.M...K.R.EAVFVTIF.........E.............KFPKLFDRA..................kVSQK.K..S.NGVE.KN.KTL-Dn............................................qiEWQLWW..AK..GL..FKEIARRYYYEI-s............................................................................................
K0KXE4_WICCF/568-840                   ............................................................................................................lf--FL......SDN...VSLKEDTEKLIEIL.HR.EAT.......NEE....YTSLIKSIKEKI..KD.YK.S--....--PDA.....................LLITFVFQ..VIA...FVGNRSISHAG.K.YVG.N..T.........FNF..LRTLl.........gkE-Ssvskekgssssegeiidskn.............ssgdaeeeegrlvevespnvvAQREL..W...A....V.DAIIKYWN.SAP...E...NGYLVLDV.LESYD.VI.SSE.SLIRYS..LNd....................................................dNKY...NLG.L.V.N.V.S.A..TESIFR.LLSSAAIS..............------------------..........---...............----............................................................................----....----.---.------.-.G...N.S.SNLLKVIY.........G.............ELTSILEVTtf...............riE---.-..Q.PGEI.EV.P---Dvndev....................................nekaelIWKYHT..TL..GF..LKAIIRKYSGE--fl...........................................................................................
A0A158Q6Q1_9BILA/507-768               ........................................................................................................nqeeke----......---...-----LVAEVERAF.RN.KSE.......SKE....VTEMLRGFNQKD..NG.L-.---....-----.....................ATLSTFFA..VML...NTAQKSFSHNF.A.ALA.R..Y.........HET..LKEL............SGT.....................................................dDESST..T...L....L.QTLYEVWK.HNR...H...MMVVLITK.MLRMT.LL.NAN.AVVSWL..LN......................................................SYF...SQE.L.H.R.F.W.L..WEALFI.VVNYACKY..............TNRCKIKLQEMQERRARI..........ER-...............SDGDtyqrfyy..............................................................dgdddleVIFD....EDIE.AKK.KELNEL.Q.E...M.L.KNLFLNIL.........H.............KLVVFLSEH...................LIKC.E..T.AGRN.YD.T----...............................................YWYRYM..MG..RF..KEMLLRYW-----relfe........................................................................................
A0A0R3UKK7_9CEST/651-959               ........................................................................................nvspprmneeatkrgdangdcl----......---...--------------.--.---.......---....------------..--.--.---....----Vpg................vtsRELELFMT..ALL...YRAHKTISHTC.S.LLN.R..Y.........SET..FKIL............AST......................................................VELQV..E...A....L.HILQAVWC.NQS...Q...MVVAISDY.MSRLG.ML.DPE.SIVGWA..FSpymsaf..........................................cgnlapSNNvyiRPR.M.L.E.L.H.V..WECLMR.TLVRVGQR..............IAQITPKLEAAKDRLGARr.......rkS-Asd...........srS--Sescsdsenddgdlrnkirrgrrhq...........................rnrrrsrsrsgggghssdssgryrrGASP....GKVA.RLE.EERGEA.V.R...S.Q.CAVITLLL.........H.............RHVRLIALV...................EEAL.E..R.GCEN.DT.NVDFN...............................................FMGYWL..KG..RL..IQTVLEHQD----qlf..........................................................................................
G7PRW1_MACFA/475-750                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0V0ZNM0_9BILA/512-675               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.F.T.L..I-----.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------clfiysvqksvec................................................................................
A0A0V0W3X3_9BILA/487-764               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FSekmrgnl.......................................msvqksveCEF...CNF.Y.I.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
T1PBD2_MUSDO/488-771                   ..............................................................................................................YKYAs...eeAAS...LAGTQVAHQLVVAI.RQ.KCT.......PEE....VINILKELPNSG..EN.AD.QEM....SETSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKTQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIRKMNKH..............VIKLTIELNDAKEKLSKA..........DSSs.............sDS-Edeaapkr.............................................................kkpvttvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0V1C9Y7_TRIBR/512-774               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
Q0UGB2_PHANO/647-900                   ..............................................................................................................FKYD......NQQ...TPYAAEGQTLLAQL.RK.KAS.......AED....MQATIDKIHEKA..LE.QG.--I....AEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPD....EQVP.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............STRGVEEGS..................aDVLI.E..K.QSSG.AL.TEEEV...............................................NLIRAW..GK..RW..HSVFIRKAAVEE-a............................................................................................
A0A0L0UTP9_9BASI/619-991               ..............................................................................................................FEYE......DPA...HRDHLAALDVVQLL.KH.KEP.......VSR....LLDYLTKMQERL..TN.EG.V-Q....ESVQD.....................VTREVAIQ..SLL...NVGSRSFSHFL.N.VLE.R..Y.........LEL..LKTL............TNS......................................................ASSRA..I...L....L.KTVTKFWK.KNG...Q...FELIIIDK.LLEYR.VI.DPI.DSLHHS..FE......................................................SYM..sSED.W.S.E.L.Q.F..WDGLKL.TIEKVNRR..............VKNSKSKLVKLNKDHEDLi.......drE-Raavgei..letgngpT--Hmedinmkeaneteeekkkdsaeeegpske.................vaeeekkekavvevegegaernkqlkeeleAVRR....EEIV.ATE.KELESN.L.A...E.Q.VVVLAEAI.........R.............RFSSARSEA...................EEKL.S..K.EQEI.VT.T---Ttaaavgegeggeekekea..........skgegdkvdpiktgsktitFWKAWW..LR..GW..CREFYRSFGTEI-s............................................................................................
A0A287D3Z9_ICTTR/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VVKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0K0DHJ6_ANGCA/491-660               ............................................................................................................km----......---...--------------.--.---.......---....------------..--.--.---....-----.....................------LQ..MLM...KTTAKSFSHTF.V.ALT.R..Y.........SLT..LKTV...........aDSS......................................................DEMQE..V...L....L.QTLFHCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................GSL...RSE.T.H.K.Q.W.K..WEVLNT.ALERLSRH..............IHKVAHDVQILQKRVKHQri......gaDDE..............mDDMDv..........................................................................kTREQ....EELE.QQK.EKLENL.K.D...F.Q.KSLFLDVL.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------hv...........................................................................................
M5GC50_DACPD/570-871                   ..............................................................................................................FEFG......NSE...NEHHQASNTIAKLM.QG.NPEqriprstPQE....VIDEVNRIREQL..AQ.GE.YTQ....EMADQ.....................TARAITFQ..TLL...NVGSRSFSHLL.N.AIE.R..Y.........LPL..LRNL............AGP......................................................NGAKQ..Q...L....L.DETQKFWR.QDE...Q...RILIVFDK.LMQYQ.IL.DPV.DIINWC..CAsdstvd..........................................skmnghSER...STR.W.F.S.T.F.R..WEALRS.AIDKANGR..............VTVAKKRAAALRKEDDEA..........RAKva..........sagD--Dyamadnp.............................................................dafeaptpVVDS....PALA.NAL.KALATL.T.K...E.Q.KSSLTAAL.........T.............GFCRILVYSp................dgLSWE.E..R.DQWD.--.---ED...............................................GWGSWE..TW..GW..FRHFCTFYCSY--lr...........................................................................................
A0A2I2ZGH0_GORGO/418-693               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1X7R021_9SACH/564-812               ............................................................................................................ll--YL......QDG...FPFNQTVLHILDCM.HI.RNNd....gtNGD....INELIHLVEQIG..KD.NL.KFF....KNFEI.....................FKIIILIQ..CIC...HSGRRSLSHAN.R.YIE.A..L.........GDT..IFEI............FQQve.................................................inkNYLQF..V...V....I.DSVIRYWN.SNV...S...TGFLLINS.FKQFD.FV.SDL.VIVDFL..FCd....................................................aNHE...LKI.I.T.N.Y.E.A..REYLLQ.TLEENMRW..............-------------SE---..........---...............---G............................................................................SNYE....LFIR.SYR.LTLKII.S.D...A.L.NEL--NIG.........D.............QTTITLPDF...................MEES.E..T.QRRN.SN.S----...............................................TWKYFE..GI..KL..IKCLLRKFH----cvyr.........................................................................................
NCBP1_CAEEL/489-768                    ...........................................................................................................yli---D......EED...TALVQRAETFTQMF.QE.RQP.......AEA....FLNELKSNDEND..EL.PY.---....---NI.....................NEFGLFVM..VML...KMASKTYSHNF.S.ALF.R..Y.........QTT..LKTV...........cDAS......................................................ELYQE..K...L....L.ETLYSCWK.TNQ...Q...MLMILTDK.LLKMQ.VI.DCS.AVVGWL..FD......................................................EKM...WQE.H.D.R.Q.W.L..FEVLNQ.ALEKLTRQ..............INVVEKDIKELTEKTENK.........iKEEd.............dEESDikmded...............................................................etkeekfKQDL....EDLE.NNK.EKLERM.V.T...F.Q.KGLFNDFL.........I.............AFIEEIKNAat...............snTSEM.D..G.SGDT.PG.T--QT...............................................PKFMWL..RG..RF..CHVLLAHAETL--lk...........................................................................................
A0A0D1XB98_9EURO/542-794               ..............................................................................................................FKYS......DDS...TPFAAQGREIAQLI.RR.KAA.......NEE....FTPILEKIEQEA..AE.SG.--I....SEPEL.....................QSTDALVT..SIC...WVGSKSLSHVL.A.VIE.R..C.........KER..LLAM...........cAGS......................................................AGSRK..Q...I....I.TSVMDYWK.DQT...G...VGVVILDK.LLNYQ.IL.TPS.SVVEWA..LId....................................................hVAR...GTM.L.A.N.A.W.C..YELVER.TTKKVAAR..............---VRSIVNAIRQP----..........---...............----............................................................................GLAD....DQKN.EIQ.QTLDQE.L.E...N.M.KSLYAIIE.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEDE...............................................ELLKTW..GG..KW..AKVFQRKYAVEQ-s............................................................................................
A0A2I3G0S7_NOMLE/399-674               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0D9REV2_CHLSB/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
L0PFW0_PNEJ8/1-115                     ............................................................................................................mg----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.F.I..WELMKI.VLDKINSR..............VIQTKRHLKNTDTFLN--..........---...............----............................................................................-DNS....EDLL.KYE.KTYKKV.F.S...D.Q.KDVLIAIF.........E.............MFPKLYDRIknl.............hgkSNGC.Q..E.NGFS.DN.Q---V...............................................SWQLQW..VK..GL..FEEFVRKCHHEI-s............................................................................................
A0A167KRK7_9BASI/576-878               ..............................................................................................................FEFG......SPE...NEHYDASRRLAKLM.QG.NAEqrvprssPAE....VIDEVNRIREQL..AE.GE.YTS....EMADQ.....................TARAVAFQ..TLL...DVGSRSFSHLL.N.AIE.R..Y.........LPL..LRDL............AKP......................................................DGAKA..Q...L....L.DETQRFWQ.QDE...Q...RILIVFDK.LMQYQ.IL.DPV.DIINWC..FAsavdgg.........................................nvemdghAGR...KSR.W.F.S.M.F.K..WEAMRS.ALDKANGR..............VTVAKKRAATLRKEDDEAr........aKAAg............agD--Dyamadnp.............................................................dafaeappVIDS....PALA.NAL.KALATL.T.K...D.Q.KSSLTAAL.........T.............GFCRTLLYSp.................eATSW.E..E.RGDW.S-.---DA...............................................AWSSWE..TW..GW..FRHFCTFYSSYL-r............................................................................................
A0A2I0M5B7_COLLI/462-742               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFNILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1I8BZT3_MELHA/478-814               ............................................................................................................yv--LD......DEG...HPAFSKAEQFKGLI.TK.RAK.......DDE....ILALLTENNVNE..DE.QI.EEK....KIYAE.....................DSFAVFFA..VLL...KLASKTLTHSF.A.AMT.R..Y.........HTT..LTTL...........tNNN......................................................EAMQS..I...I....L.RTLYDSWS.LNK...Q...MMTVLVDK.MIKMN.IL.EPA.IVQAWV..FS......................................................EEM...KIE.F.K.R.T.W.V..WDVLTA.AVIHLDRRrnkllrdlnyscgyLKRLEARN----SEREQQ..........---...............---Krngnleegehnereegetameenangmdnerprkis...teynlrsdamdsndvndeqlkqrreegvdlldldeliFQAK....DKID.LIK.TDLEQA.D.E...V.L.RSVFLNIC.........H.............KFTLILTEH...................LLNC.E..T.DRTE.VE.T----...............................................NFYNYV..SG..RF..KYIFLK-------anc..........................................................................................
A0A0B2UV61_TOXCA/5-175                 .............................................................................................................i----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...K...MMFVIVSK.MMKIT.LI.APC.VVVDWI..FS......................................................DEM...RLE.F.E.R.M.W.T..LELLNS.AVDCITSH..............LRYTQKKLENLHRETTDTk.......dsN-Kkhs.........sssS--Asesds.................................................................dndnesVLTD....QQMA.ALQ.SEIENL.R.E...L.L.KNLLLNIL.........H.............KFMMKLTEH...................IVLC.D..S.KDVD.VN.T----...............................................SWYVYV..NG..RF..NDFFMENWE----elfe.........................................................................................
R9ALM1_WALI9/528-818                   ..............................................................................................................FIYA......NEE...HPYNATTTSVMDSM.RN.KIT.......SDA....MIKNIVKIEEDL..KE.NP.SLP....QSGNSa..................kkVARDIATQ..CLL...NVGSRSFSHFL.N.VIE.K..Y.........IEV..IKYL............TAD......................................................KDSRI..D...L....L.RSVGRFWV.RNS...Q...MKKIIVDK.LLQYR.LI.EPT.DVVQWL..FNpndpef..........................................psevddTVY...QIG.W.S.D.L.N.F..GDLLKT.ALNKVNTR..............VNQQYQKLVETKKNDEEVas......iaKARnm...........eiD--Nede......................................................................ttkEEER....RDYS.QLQ.LTFDNL.N.R...E.Q.RECFVLLV.........Q.............AFVEALEGV...................DSIS.D..K.SIEE.YT.---DQ...............................................DWDKWL..SW..SW..YQAFLREYWPS--is...........................................................................................
H0GZD5_SACCK/578-825                   .............................................................................................................l-YFR......QEG...VPMENTVRKILDYT.HK.ANN.......SRD....VTELESILEELK..NE.HG.SII....TDFDR.....................FVIILLVQ..AVV...DSGSRSLSHAN.K.YIS.D..L.........KED..LKTI............FAKie.................................................ldvEAKEY..I...I....I.EAVLTFWN.ANP...Q...TGFLVADA.FKYAG.LI.TSK.TIFTFI..FNe....................................................tGFE...NNG.L.V.E.A.T.A..IEAVFR.NLSQQISE..............------------------..........---...............----............................................................................----....----.---.------.E.N...E.S.ENNFEFVF.........E.............RLCTIVNNT...................VDLL.N..V.TNDD.DI.-EIPEvnnemdvd..............................dveddkldlKWKCVT..AI..GF..IKSILRRYSYEY-r............................................................................................
A0A150GSQ0_GONPE/590-762               .............................................................rqegssvaaaakarqlrpeqtsalwsskvtdwlhahgrqlaeeqgplaa----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--PKVLAT..LLL...ALGVKSPSHLH.V.AVE.R..Y.........AEA..LRAAl..........aE-Adaeaaaqgalpa..............................gswegaaaalgaSPGQV..A...M....I.EVVRHYHA.REP...Q...RLLLVTDR.LLALH.VL.DGP.SLVAAL..FA......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------dgapppppgaggrrrrr............................................................................
A0A0M4E2J4_DROBS/486-700               ..............................................................................................................FKYI......DER...LPGAQLAKQLLDVI.RS.KCT.......VEV....VGGLLEAATELP..-E.--.---....----E.....................LKINVLMQ..TLL...HLGCKSFTHVF.C.LFT.K..F.........HAV..LKLL...........aAGN......................................................ELNQL..A...M....L.QAIFELWT.NNE...Q...LKTVLAER.LMKMR.LI.KPN.IVVRFV..FS......................................................SAL...KPE.L.S.K.L.Y.L..WELLNV.SIRYTKQH..............LQGSEQQLTE--------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------qleclllgivqhaavalakqqavaapaetdywshwvlgrlqgilfahvelv..........................................
NCBP1_ASHGO/582-827                    ............................................................................................................ll--FK......NEV...FPFHEKVQLILDYI.HK.QPL.......EKN....ISELESLLEDIK..SA.HG.DKI....PDFNR.....................FTVTLLIQ..ALV...YSGNRSLSHAN.K.YIS.D..A.........KSD..LVTI............LEKme.................................................vppEVKEQ..W...I....I.EAVIRYWN.CNS...Q...NGFLIVDS.FKHSE.LV.TAK.SILTFS..LTd....................................................lNGQ...NLG.L.V.D.A.T.S..IESTFR.TLTELALQ..............------------------..........---...............----............................................................................----....----.---.------.Q.A...S.D.ISVFEFVF.........E.............RLLEIINDT...................VSQL.G..T.NEEI.VA.PSVDNetmldvd.................................elarldlIWKYES..AV..GF..IKSILRKYSDEY-s............................................................................................
S6ENQ0_ZYGB2/585-754                   .............................................................................................................l-YFR......QES...FPAHEKVRQLLDYV.HK.QND.......VRD....VSELDAIIDSIR..QE.FG.SII....SNFHQ.....................FIIVLLVQ..VVV...QSGSRSLSHAN.K.YIG.D..L.........KDD..LTHV............FSKle.................................................mddVEKQY..I...I....V.EAILRFWN.SNS...Q...NGFLVADS.FKFAG.LV.SPL.SIFQFS..FKe....................................................qDGK...NYG.L.V.D.G.T.S..IESTFR.NLSQH---..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ldn..........................................................................................
A0A1S4BFB3_TOBAC/469-814               ................................................................................................fkyseedgtdpter----......---...----ALSVELKDMV.KG.RKS.......ARE....MISWVEENVFPA..HG.F-.---....----D.....................ITLRVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CTD......................................................DDQQF..K...L....I.SEVSSYWQ.NSA...Q...MTAISIDR.MMSYR.LI.SNL.AIVRWV..FS......................................................SSN...LDR.F.H.V.SdS.P..WEILRN.AVSKTYNR..............ISDLRKEISSLERSVVLAe........eA-Asra........ryqlD--Saesklsimdgepvlgen.........................................pvrikrlksyaekakeeeVSVR....ESLE.AKE.ALLARA.V.D...E.I.KVLILSLY.........K.............GFLTALAEP...................LNDA.F..R.DGTL.RP.SGQADemnidledssvmdldkddggrp...kksyshpngsreingynldgkqQWCLST..L-..GY..LKAFTRQYA----sei..........................................................................................
A0A183MIW9_9TREM/612-954               ....................................................................................deqvgvrsdsieklpfttaaqvsels----......---...--------------.--.---.......---....------------..--.--.---....PGVTN.....................LAIELFYS..AML...IAGHKTISHTF.A.FIK.K..Y.........AAV..IRTL............TST......................................................VETQV..E...A....L.HVIQAVWA.NNP...Q...MIVIITEH.MCRVG.LI.DPE.AVVRWA..YSpimttlt.......................................ddnvnlnsANA...RPK.I.L.D.F.Y.V..WECLSR.TLVRVGRR..............VTRITSRLELAKETMEIN.........rR-Sspys.......tpdrE--Dadqggdgdsfprtgvdsdsffkkpkdsis.................grmkvsdrrklmagcelvsssddeaygggkDNVG....GRVA.RLE.EARCEA.V.R...S.Q.CAVITLLL.........H.............RHARLTAEL...................ASEM.S..G.STQN.HS.FN--Tdspfflhept..........................qpkslsdealrNIMFWL..KG..RL..VQVVLEHCD----qli..........................................................................................
N1J947_BLUG1/530-769                   ..............................................................................................................FKFN......VDD...YPFAREGQEILSLL.RK.KSP.......EES....IQPIIEQIHAQA..TV.MN.--Y....PDPLV.....................ASTDAYMT..AIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LMAL...........gPVS......................................................PLARK..Q...I....I.DSVLDYWK.HQP...G...IGVNIVDK.LLNYT.IL.SPK.SVVDWA..LS......................................................Q-D...GKR.L.G.K.A.Y.I..FEMVSA.TIFKVTGR..............---LRQVI----QAKSVP..........---...............----............................................................................GLSP....EQFE.ILL.KTVESE.R.A...S.M.KELFDFME.........N.............SLLGWAKDT...................S---.-..-.-DNE.ED.-----...............................................TMIQQW..AM..RW..LRVFRRKLAVEE-a............................................................................................
A0A0L0S6J2_ALLMA/545-800               ...........................................................................................................eyp----......--S...PQHASFAEQIADQV.RA.RAP.......ADD....VWAYTEQFQRNM..GE.DA.S--....--P-V.....................ALRHTVMT..ALL...AHGQKTFSHTM.T.VLE.R..Y.........LAV..LKRL...........vAGD......................................................VAAKR..H...L....V.ASTYAFWR.HNH...Q...FFLIVLDK.LLHYR.VL.EPV.HAAQWL..VAmvqgeqeal....................................epmgsdallAEP...LDA.P.G.P.V.F.V..LEVLCL.TIKKALAR..............IDLLEDKLRRARAMD---..........---...............----............................................................................SENE....GDIT.TIE.ANLATA.I.P...E.K.HTLFVYIT.........E.............SLLDQAAQE...................P---.-..-.-QSH.ER.T----...............................................QWSSWT..LG..SL..LTLLRMYFA----dl...........................................................................................
M7WDI9_RHOT1/709-986                   ..............................................................................................................YAYE......DPE...HIHNAAATSFLRMV.RA.KAP.......ISE....ATEELDSFQKSL..ET.EH.NMT....AEAAE....................nVKRDMAVQ..TIL...NVGSRSFSHFL.N.ALE.R..Y.........LTL..LRNL............SSS......................................................PSARQ..H...L....L.NTVAAFWK.RHP...Q...FHLIVLDK.LLQYR.LV.DTR.DVIAWV..FApse................................................eqeGSK...TKT.W.S.D.P.D.L..WQMVKI.TLRSVTGQ..............IDSAKMRVEGLKREEEMKg........aE-Ndt...........gkQ--Dgedvlda..............................................................egdlpvrDAQN....PELD.SAN.SYLAEA.E.D...E.Q.ASVLVNVL.........G.............HFAKLLPAD...................VDEE.-..-.----.--.-----...............................................DWETWW..IK..GW..VREFCRS------sfshka.......................................................................................
B9HP11_POPTR/485-830                   .....................................................................................................fiysiedgr----......-EK...TEQHALSAELNNKV.KA.RQT.......ARE....IISWVEESVVPN..--.HG.W--....----D.....................VALKVVVH..TLL...EIGSKSFTHLI.T.VLE.R..Y.........GQV..FARI............CPD......................................................HDKQV..M...L....I.AEVSSYWK.NNA...Q...MTAIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PAN...IEQ.F.H.T.SdR.P..WEVLRN.AISKTYNR..............ISDLRNEISSLKKSVVSAe........eA-Atk...........akT--Eldaaesklslvdgepvlgd......................................nparlkrlkanaekakeeeVSVH....ESLE.AKE.ALLARA.L.D...E.N.EALFLSLY.........K.............NFSNVLMERlpdp..........srartLREL.K..S.IQAD.EM.TVDLDessvmevdnesgrpn................ksqsnggkesniynvgEKEQWC..LStlGY..VKAFARQYASE--i............................................................................................
A0A2I2UL89_FELCA/410-679               ............................................................................................................cl----......-DS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1E4RLN9_9ASCO/674-920               ..............................................................................................................YNFS......NPQ...LPLNEISNKVYDFIiSN.WKP.......NEE....FKDLISSILEEA..SN.VE.NIK....PEK--.....................FLINLIFQ..TYA...YIGSRSIYSIV.S.ILS.R..D.........VNK..LKFIsgv......dikE-Edyqipneykf..................................ekldlseeqfSERQN..W...V....I.ESIFRIWI.HQP...Q...VSFLILEY.LIEFG.IL.KPN.YLIEKS..LN......................................................LDS...NLI.I.E.N.V.S.C..MESVNR.ILSVSSKN..............------------------..........---...............----............................................................................----....----.---.----EE.T.E...E.F.KDSILLLF.........K.............LIVDNLNAI..................qI-QD.-..-.---E.GL.MKKID..............................................yQWLFYE..YR..GL..LKSYLRKFVDYN-s............................................................................................
R1EFH6_BOTPV/627-881                   ..............................................................................................................FKYE......SDQ...TPYAPQGRELLSLL.KK.KAS.......EDE....IQKVINSIHEQA..AE.HD.V--....ADVLT.....................PSTDAYVT..CIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLAI...........gPAS......................................................ETARK..Q...I....I.TSVTEYWK.DQP...G...IAVNIVDK.LLNYT.IL.SPM.CVVQWA..LSd....................................................rLGA...GGA.L.S.E.S.W.I..FEMVAG.TVGKVTNR..............---VRQIVAARLQK----..........---...............----............................................................................GLPE....EQVQ.LLD.DTLTKE.R.D...A.M.RQLFQVID.........D.............VTSGVAQGAad...............gfI---.E..A.DGSE.GM.DEEKG...............................................KLIKAW..GE..RW..SRVFRRKAAVEE-a............................................................................................
A0A146G0W8_9EURO/548-801               ..............................................................................................................FKYS......SDT...TPYANEGREIMQLV.RK.KAS.......DEE....IQPFINAIEEQA..RS.LG.V--....EDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................AQARR..Q...I....I.TSVMEYWV.DQP...G...VGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.V...D.M.QSLFKVIE.........D.............SIVSVAGGSnd...............eqMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
NCBP1_DICDI/524-756                    ....................................................................................................fkflnadnpe----......EES...KELIAESHKLLLSF.KT.KEP.......LEN....IISHVANIPSHI..--.--.---....-----.....................NIVELLTK..CIL...QIGSTSFSHLT.Y.AIE.R..Y.........ITL..FKTV............LKS......................................................QDDRQ..E...C....I.RSIFEFWK.LSH...Q...HIVIVVDK.FVTFK.II.YPI.DTVTWF..MK.....................................................pENI...DRF.I.T.E.P.F.T..WECLHN.SIQKTIII..............IQTLTLDLEENQSQ----..........---...............----............................................................................----....----.EKE.FKLNTS.I.S...E.Q.QLLLAELV.........K.............GLGSILSSE...................KYQL.G..A.S---.--.-----...............................................------..--..--..-------------skllisgqlksiirkyfnqmkpv......................................................................
F6ZI49_XENTR/488-764                   ..............................................................................................................FKYGd...esNSA...LPGYSVAVALTNAI.KN.KAS.......DKE....IFNILKDIPNPN..QD.DD.DDE...gISFNP.....................LKIEVFVQ..TLL...SLASKSFSHSF.S.ALA.K..F.........HDI..FKAL............SES......................................................DEGKL..H...I....L.RVVYDIWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SRD.F.P.R.F.Y.I..WEILHS.TIRKMNKH..............VQKIQKELEDMKLRLAKQ.........hKHRds...........ddN--Deds.....................................................................grkdGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VN.T----...............................................AWYKNC..RE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0R3T645_HYMNN/573-887               ...............................................................................................sescvndtdgeknee----......---...--------------.--.---.......---....------------..--.--.---....MDKDEplaqcl.........ipgvssLELELFMA..ALL...LRAHKTISHTY.S.LLS.R..Y.........VDV..FRAL............AST......................................................VDLQI..E...A....L.HILQVVWY.DQS...Q...MVVAISNY.MSREG.ML.DPE.SIVLWA..FSpsmsaftn.....................................eldfnppssVHI...RPQ.L.L.Q.S.H.V..WECLMH.TLIRVSQR..............VVQVSSGLEDAKDGMGSGr........rR-Srsrs......rsggsS--Sedehgdidlrkkinrsrrhhh..................................rdrnqfrsrshdssddgvrrsNVSP....DRLA.HME.EVRGEA.L.R...S.Q.LSVITLLL.........H.............RNMRLINDV...................SNEM.E..K.MEAL.GE.SQTIIrn...........................................leSVAFWI..KG..RL..MQSVLE-------tlyit........................................................................................
J4W7Z6_BEAB2/534-789                   ..............................................................................................................FKYK......NPD...TPFSAEGQEIGALL.RR.KAT.......DEE....IQPTIDAIQAQA..KE.RA.---....LDPVV.....................TSTDVFVT..AMC...WVGSKSLSHVL.A.CID.R..S.........KVR..LLDA...........gAAS......................................................PAARS..Q...I....I.SSVMAYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.SVADWA..ILads...............................................ashkGSP...GAA.L.A.Q.P.H.I..YEAIFN.TVSKVTAR..............---VRQLVTAAAPN----..........---...............----............................................................................NSEA....AAID.DEE.ETRAKE.V.A...D.M.TELFRTIN.........D.............ALEAWAGGS...................KDEL.M..Q.QDGA.SE.--TDD...............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
A0A087UQ45_9ARAC/341-614               ..............................................................................................................YKYAq...egSEV...LPGTVAAQQLTAAF.KE.KCT.......AEE....ALLLIKDLPNPL..QE.DD.VE-....PTHNP.....................LKIDVFVQ..TLL...NFADKSFSHAF.A.AIA.K..Y.........HTV..FKVL............STS......................................................EEAQI..C...I....L.RSMFELWH.SHQ...H...MMVGLVTK.FLKAK.IV.ECS.AVANWL..FS......................................................KEM...STE.F.P.K.S.Y.I..WEILHL.TIRKMIRY..............VTNIQKQVNDAKKKLQKDes......meD--...............--DDdded...................................................................dsnhvRPSE....EMIE.EME.EKLDTA.Q.S...E.L.KNLFLIIF.........Q.............RFIMLLTEH...................IARC.E..A.DGID.FN.N----...............................................YWFKST..LG..RL..QEVFFQHHEQVFK.............................................................................................
A0A0V0W479_9BILA/471-748               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FSekmrgnl.......................................msvqksveCEF...CNF.Y.I.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A2A4JLT7_HELVI/1-66                  ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.-ME.ERLEAA.H.M...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DARD.PN.T----...............................................HWYTST..VA..RL..SQVFLIHHEQVQK.............................................................................................
A0A1D6RVT1_WHEAT/531-645               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAI----.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aixx.........................................................................................
A0A091I4X6_CALAN/444-724               ..............................................................................................................YKYGd...esNRS...LPGYSVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1J9NZL3_9EURO/359-617               ..............................................................................................................FKYA......VAT...TPYATEAQEIMDLI.RK.KAP.......DAE....IEPHILAIQHAA..AS.QP.D-T....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPKS......................................................PAARR..Q...I....I.TSVLAYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQA----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.K.G...D.V.QVMFEVIE.........G.............ALEGVISGS...................NGSA.S..T.SGME.DG.G-EGKge..........................................gekEIIREW..GR..RW..LRVFKRLRAVEE-a............................................................................................
A0A1E5RQ73_HANUV/624-874               ............................................................................................................fi--LS......NEK...LPFHEAVEKIIAFF.KG.SGSae...nnESN....LNFLIEVLGNLE..AE.HG.SLI....ANFDR.....................FIITVMIQ..AVL...HVGSRSISHLQ.N.TLS.H..H.........HDN..LINLfg........avDEN......................................................SNINE..W...I....I.AAIHKYWG.QNV...K...NVFLIFEI.FYKNKlIL.NKS.AIIDFL..FK.....................................................ePSM...DAI.L.Y.D.T.V.Y..YDFLVN.LLHTASVQ..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------endinlvlitfnyltdimndctkklnvsgdvplpnvqelennatdsdglatletynklrfavnlaktllrkfhrvfid...............
A0A1E1L6D8_9HELO/537-785               ..............................................................................................................FKYN......LPD...TPFAQEGQEIMALL.RK.KSP.......EDA....IQPILDRIHTQA..LE.MK.--L....GDELV.....................CSTDAYVT..AIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLAL...........gPAS......................................................PAARK..Q...I....I.DSVMEYWK.DQP...G...IGVNIVDK.LLNYT.IL.SPS.SVVSWA..LS......................................................K-D...GTR.L.G.Q.A.H.V..YEMISS.TIGKVTNR..............---VRQVV----RAKKVP..........---...............----............................................................................GLLP....EQQA.LMD.ETVERE.R.K...A.M.KDLFDVME.........D.............ELVAWASGS...................KDQM.V..Q.GGDQ.GG.P--ED...............................................QMIKQW..GE..RW..LRVFRRKIAVEE-a............................................................................................
Q6BLJ6_DEBHA/674-939                   ..............................................................................................................YNFS......NSG...LPLHEGSSKVYDLIiAN.WKP.......NSE....FYDLYKEISTNL..DD.YA.SIN....SDK--.....................FLINLFFQ..TYA...YIGSRSIYSVV.S.LLS.R..D.........IIK..LKFLsgv......eikD-Enyqasefqf...................................pvaelaeqhfDNKQN..W...I....I.DSIFRIWV.HQP...Q...VVFLILEY.LIEFE.VL.KPK.YLIGKT..LN......................................................LAS...NLI.I.E.N.V.S.C..MESVNR.ILINFSKS..............------------------..........---...............----............................................................................----....----.---.-----S.N.D...E.F.KVLTLKLF.........E.............LIVNNLNEI...................TKTL.E..T.NNSD.EV.TILKDfsdeesed..............................ielmnkvdnQWLFYE..YK..GL..LKSYLRKFSIH--ns...........................................................................................
A0A0H5C952_CYBJA/584-823               ..........................................................................................................lyvc----......-DK...LPLKPYVEKLIEVI.HT.NQQ.......PQN....LQQAIEELKTVT..EP.FT.NG-....---EE.....................LLITIVFQ..AIA...FVGSKSTSHVA.K.CID.S..T.........RDQ..LKNLl.........spS-Sdemd.............................................deqkaLEKQV..W...A....V.GAVLSYWN.QDP...H...CGYLAVDV.LENFG.VV.SPL.AVLKHS..LDd....................................................sRDV...NIG.L.V.N.V.A.T..IESIFR.SLTRVVFS..............-------G-----S----..........---...............----............................................................................----....----.---.--STKE.L.I...Y.V.FETLLKTI.........S.............KTCQVLTQSeai.............pipDVEA.-..-.----.--.----Dvte........................................evelSWKYHT..TL..GF..VRAVLRKFSDEY-t............................................................................................
A0A1Y1UNP5_9TREE/606-897               ..............................................................................................................WQYE......QPE...NPMHSEASTLLEMY.RQ.KAS.......PQD....VRDHLGSITSAS..PE.S-.---....-----.....................-IRIMAAE..TLL...HLGSRSFSHFL.N.ATE.R..Y.........LDT..LRYL............TPD......................................................QSARR..T...L....L.EAVASFWR.RSS...Q...MRLITVDK.YLQYG.IL.EGL.DVVEWV..FSreagg............................................gggesGEG...GDG.W.T.D.G.E.K..WEILRM.CLEKHVGR..............VMAIKRRVRMVDKEDEAAr........aK-Raa...........ekL--Drgegvgen............................................................edvepeakLERS....KEAR.DAQ.TSLDIQ.S.D...R.L.EKVLLAVM.........R.............HFVSDLLPW...................TSSS.E..G.--GQ.GL.KGVLMlleg.......................................gesgWWGVRS..RW..GW..YREFVRRYETH--ll...........................................................................................
A0A1S3BQ48_CUCME/485-828               .............................................................................................................f-KFSae..ddGEK...SEQHALSAELYNMV.KG.RAP.......ARE....LISWLDESVIPK..--.HG.---....---LD.....................VSLVVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..ISRI............CHD......................................................QDKQV..L...L....I.SEVGSYWK.NNT...Q...MTAIAIDR.MMGYR.LI.SNL.SIVKWI..FS.....................................................pENL...QQY.H.T.S.D.R.P..WEILRN.ALCKTYNR..............ISDLRKEISSLKKDVVAA..........EEAv............arTQEElgaaesklslvdgepvlge......................................npvrlkrlksyagrakeqeI--Si..rDSLE.AKE.ALLARA.L.E...E.N.EILFLSLY.........K.............SFSSILTERlpa............saqtL---.-..-.--QD.LK.STNPAdtnamdveepsamemdnves......rpekshlngrtehaytvceneQWCL-T..TL..GY..VKAFSRQYAS---ei...........................................................................................
A0A0D0B601_9HOMO/543-850               ..............................................................................................................FEYE......DPA...HPHYDTAQSILSLL.RG.RSK.......ANE....VLSHIESLKTTL..ES.S-.GTH....LHVDN.....................TIRSISIH..CLL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRGL............AGT.....................................................dAESKQ..D...I....L.SAVASFWR.LNR...Q...MVNIVFDK.LMQYQ.IV.DPT.DVVGWT..FEnvgg..............................................dvhlSGM...RPM.S.L.S.A.F.E..WDLLRG.ALDKANGR..............VMVARRKVAALRKEHDDSva......rvKASvgad......vgsieM--Dadvkp.................................................................fkqddsASEN....PQLT.VAL.KAFASL.T.R...E.Q.KGALARTI.........E.............GFVSCLAPS...................PSAG.R..Q.NPHA.E-.-TVITeqawet..................................rvawtadEWNTWE..TW..GW..YRHFCRTYSPYL-r............................................................................................
M4AV18_XIPMA/485-766                   ..............................................................................................................FKYGd...esGTS...LPGYPVSITVSNAI.KN.RAS.......NEE....ILAILKEVPNPN..QE.DD.DDE...gESFNP.....................LKIDVFLQ..TLL...HLAAKSFSHSF.S.ALG.K..F.........HEI..LKNL............TES......................................................DDGKL..H...I....L.KVIYEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.F.T..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLEKQq........hK-Rrds.........gddE--Dmekns..................................................................eedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVD.IS.T----...............................................PWYKNC..IE..RL..QQVFLMHHGTI--qq...........................................................................................
U6G7J2_9EIME/828-985                   ............................................................................................aldrcskdmegapwctdd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-IIRLFVF..CLL...SLGSKTQTHLH.R.LLS.N..Y.........AET..FRLY............TTQnehtp...........................................eeqqphIDVHP..A...V....L.QAIQKYWT.TSQ...Q...RTALTLHA.FLKTG.IL.RRD.RVLQLL..CSa....................................................dQGD...RDS.W.S.Y.L.E.F..IETV--.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lrgavdecetareaaveegapmptgtea.................................................................
A0A067LWN8_9HOMO/535-823               ..............................................................................................................FEYD......DPA...HPLYEPAQSLLTLI.RG.RSK.......ADE....VVQHAETLRSTI..SD.TP.NLT....PD--S.....................AVRSIAVQ..CLL...HVGARSFSHFL.N.AIE.R..Y.........LAL..LRSL............SNT......................................................ADDKA..D...I....L.DAAGRFWI.KNS...Q...MVGIVFDK.FMQYQ.IV.EPG.DVIAWA..FR......................................................TAT...GHR.L.-.G.T.N.E..WDIVKV.ALDKSIGR..............VLLTKRKVALLRKEEEDVsa......raKAQaa...........aeE--Dsqmdvea..............................................................ekkddavVSDS....PALQ.TSL.KALATL.T.R...E.Q.RMTFSRAL.........D.............EFVAVLTKSasps..........igvigAEAW.-..-.EGRA.DW.N--EE...............................................QWQFWE..MW..GW..YRHFCRAYAVH--lg...........................................................................................
A0A1A6A871_9TREE/589-885               ....................................................................................................wayekpgeyq----......---...---LDLAYELLQLF.RS.KAT.......TAD....IRLHLDNLPGSE..EG.IS.S--....-----.....................NIRKMVFE..TLF...QLGSRSFSHFL.N.ATE.R..Y.........IDT..LRYL............TSD......................................................QASRK..I...L....L.SAIWDYWK.YSH...Q...QKLITVDK.YLQYG.IL.EGL.DVVEYL..FEees................................................sgeEEG...GDG.W.T.D.E.W.K..WEILKM.TIEKHSGR..............VQAIKNRMKIIEREDESAr.......arR-Aaeile.....kggdvG--Egegdd.................................................................edldvrPEGS....KAFN.DAQ.TSLDIQ.S.T...R.L.EKILMSTM.........K.............HFVNSLVPS...................ETEA.G..I.EAST.NQ.G---Lkgvltl..................................lqsgeqaLWSVRA..RW..GW..YREFVRLYSAQ--lv...........................................................................................
H2AU78_KAZAF/579-812                   ..............................................................................................................FFYL......QDD...FPYQNFTERIIEYF.HL.SSK.......ERH....MGKLFDIVNTLK..EN.YK.TEI....SNFDH.....................FIISLLIQ..CLC...FSGRRSLSHAN.K.YID.D..F.........ADD..LKAI............FKTli.................................................ldrSIIEF..T...I....V.QAILRFWN.TSS...Q...TGFLITNT.VKFKG.LV.SSK.AILEFI..LTe....................................................aENR...NFA.L.T.D.Y.T.A..VECIFK.NLDDEQYS..............------------------..........---...............----............................................................................----....----.---.------.Y.S...T.K.FETYQYIF.........R.............ELCKNLNKT...................LEVL.K..Y.SSEM.SD.KTKTHd.............................................lDWKRLT..TL..NL..LKSLLRRYAN---gyh..........................................................................................
A0A1D6K2X8_MAIZE/74-420                ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
I2K0B9_DEKBR/369-655                   ..............................................................................................................YLFN......NED...HIFHEICHSIYTNM.QE.GES.......LQS....FNDLIAELTSQI..KE.AD.ESE....QPK-Cgi.................arYIVVLVTQ..SVC...VIGSRSLSVIDgG.ALE.L..C.........GDK..IRKXlgl.....elkdK-Dtdaedidn.....................................dqfxdvsdtQQRQK..W...V....I.EAVLRLWN.REP...R...IGYLILEK.MRNKE.LV.TSS.QIVESL..FTa....................................................hGTK...IPA.L.T.E.L.Y.A..DELLDR.LLLQRNLG..............------EGEDDEAEXDHN..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------dqkwtxfaksclktlntlisdykdeaeekgtidiksseklacedatvtkkstdllwaidgllqlvesklkkxesrkekleifk..........
A0A0C3PRH3_PHLGI/531-835               ..............................................................................................................YEYD......DPA...RPHYDAAQLVLGLL.RG.RAK.......AED....VMSHLESLKNTL..EE.ND.SD-....INVDS.....................IIRSIAVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNLssgs...istlgTSS......................................................LEARM..D...I....L.TAVSEFWR.SGR...H...MIIIVFDK.LMQYQ.IV.DPT.DVVSWA..FThgv................................................eriAGS...THP.S.I.N.A.L.Q..WDIIRS.ALDKANGR..............VVITRKRVSALRKEADEKa........aL-Amvs........ngaaM--Evdtea..................................................................kpdvpEVES....PALT.TAL.KAFATL.T.R...E.Q.KAALSRTL.........D.............GFVDCLASA...................----.-..T.NPNP.AA.KMVISengwhn..................................ranwnevEWVTWV..TW..GW..YRHFCRLYSPYL-r............................................................................................
K2QJ30_MACPH/499-753                   ..............................................................................................................FKYE......SDQ...TPYAPEGRELLQLL.KK.KAS.......EDE....IQTVINKIHEQA..AE.HQ.V--....TDVLV.....................PSTDAYVT..CIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLAI...........gPAS......................................................ENARK..Q...I....I.SSVADYWK.DQP...G...IAVNIVDK.LLNYT.IL.SPM.CVVQWA..LSd....................................................rLGA...GGS.L.S.E.S.W.I..FEMVAG.TVGKVTNR..............---VRQIVAARLQK----..........---...............----............................................................................GLPE....EQVQ.LLD.DTLTKE.R.D...A.M.RQLFQVID.........D.............VTSGVSQGAad...............gfIEAD.G..G.KDMD.EE.---TG...............................................KLIKAW..GE..RW..ARVFRRKAAVEE-a............................................................................................
A0A0C2N1X6_THEKT/491-730               .......................................................................................................fdyagkp----......---...--EKVVITTFATCI.RE.KKS.......NDQ....IIESLEQLAGEN..PS.L-.---....-----.....................SLLTAIIH..FVF...KTGSKTLTHTG.L.MFE.K..Y.........LAI..INHF...........iKKS......................................................DDSAE..K...I....I.ESVYSFWQ.NNP...I...RLKHALSL.FYQND.LL.KEI.DVISWF..MN......................................................L-Q...KSN.A.E.S.L.F.P..WEVILE.YFSLINCC..............----KKKSAKRKKGDAN-..........---...............-KGE............................................................................KAAS....ISID.VGDnDAKKRS.K.E...Q.R.KEILFKMT.........S.............HMAEFIHRH...................VSEC.G..E.TPTD.--.T----...............................................SWFTYI..LQ..RF..QQLLFQNH-----dff..........................................................................................
N1QI61_SPHMS/567-818                   ..............................................................................................................FKYA......EDR...TPFAKEGREVLALL.KK.KAS.......EEE....VQKVLDSVHEQA..AA.MG.--F....TDPLV.....................ASTDIYMT..SIL...SVGSKSLSHVL.S.TID.R..C.........KDR..LLNI...........aQGS......................................................EAARR..Q...V....V.GSVVDFWS.DHP...G...TAVNIVDK.LLNYT.II.TPM.SVISWA..LVd....................................................rMDR...GRA.L.A.S.S.Q.I..YEMVSI.TMFKVTNR..............---VRQVLRDRNNL----..........---...............----............................................................................KLDF....ASRK.QID.EALPNE.R.Q...A.M.RDLFAAIE.........D.............AVVAVSEGA...................QDEM.I..E.--RY.DG.DSAEQ...............................................QLIQLW..GS..RW..ARVWRRKAAVEE-a............................................................................................
A0A2I3GLG5_NOMLE/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
W6A2M7_ICTPU/484-766                   .............................................................................................................qYKYAd...esGSS...LPGYVVATSVGNAI.KN.RAS.......NEE....ILTVLKEVPNPN..QD.ED.DDE....GDGFN....................pLKIDVFLQ..TLL...HLAAKSCSHSF.S.ALA.K..F.........HEV..LKTL............TES......................................................DEGKL..H...I....L.RVVYEAWK.NHP...Q...MISVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PDM...AHD.F.T.K.L.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLEKQq.......hkK-Qkds.........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.ASVD.IN.T----...............................................CWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A0V0W3U1_9BILA/485-762               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FSekmrgnl.......................................msvqksveCEF...CNF.Y.I.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A0L6UA42_9BASI/648-1012              ........................................................................................................eprahr----......---...--DHLAALDVVQLL.KH.KEP.......VSR....LLDYLTKMQERL..VN.E-.GIL....ESAQD.....................VTREVAVQ..ALL...HVGSRSFSHFL.N.ILE.R..L.........VTC..IYHGakrqyleliknlTNS......................................................PNARA..S...L....L.QTVSKFWR.KNG...Q...FELIVIDK.LLEYR.VV.DPI.DSLRHS..FD......................................................TYK...SLQ.W.G.E.L.Q.F..WDGLKL.TVEKVTRR..............VKASRTKLATLKKDEEDQr........dR-Qraag.......veflF--Skerkyifldrnkaymqtkidsilwfpild..................mkegidaeegkkdgeevqgastrqkeeleTIRR....DEIA.TAE.KELEAH.L.A...E.Q.VVVLAEAV.........G.............RFSRARLEAee..............mlnE---.-..-.--EE.GA.AAAATgggseeqepanga....................keeqpqkapskgtaFWKAWW..LR..GW..CRELYRLV-----sytsr........................................................................................
G4TF65_SERID/529-819                   ..............................................................................................................FEYE......SSD...NSHHAIADGLLSKL.QN.RPV.......MSE....ISVYIDTMRTEL..IS.SG.LSD....SRAAS.....................RTRSIAVQ..CLL...VVGSRSFSHFL.N.AIE.K..Y.........IKV..LQGL............SNT......................................................PDAKF..E...I....L.EIVSSFWR.RNR...Q...MIMIIFDK.LMQYQ.IV.DPS.DVVSWA..FEgg..................................................glGDK...GDG.L.-.G.T.F.Q..WELMRI.ALDKSNGR..............VAIAQRRVVQQRKLDEET.........rAARmati.......agngM--Dvddmpa...............................................................kvdgkskFDDS....EELR.KQI.RAHSIL.V.A...D.Q.KAVLSRTM.........E.............GFVTVLSDTd................svLT--.E..E.SWNN.RA.SWSKK...............................................EWETFE..SW..GW..FRHFTRNYAPYL-r............................................................................................
A0A179H7K3_9HYPO/534-779               ..............................................................................................................FKYN......NPE...TPFSAEGKEIGAML.RR.KAP.......DEE....FQPVIDSIQTQA..SE.QA.---....LDPIV.....................ASTEVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDA...........gSSS......................................................PAARA..Q...I....V.SAVMNYWH.AHP...G...VALSIIEK.LLNYA.IL.TPL.SVVDWA..LAgnt...............................................pingAEG...GES.L.G.R.P.H.I..FELVST.TVAKVSGR..............---VRQLL----VSP---..........---...............----............................................................................----....---D.VDE.ETRERE.V.K...A.M.QDLFRAAN.........D.............ALASWAGGS...................KDEL.M..E.EGDG.SS.--SKE...............................................ATIRRW..GQ..RW..LRVYQRLAAIE--ds...........................................................................................
A0A0E0D0E4_9ORYZ/463-809               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVCQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisv.......dgdvpnL---.-..-.----.--.-RAGDpnvnsaardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A1S3ST51_SALSA/485-765               ..............................................................................................................YKYQd...eaNSA...LPGYAVAITVGNAI.KN.RAS.......NEE....ILTVLKDVPNPN..QE.DD.DDE...gEGFNP.....................LKIEVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEI..LKVL............TDC......................................................DEGKL..H...I....L.RVVYEVWR.NHP...Q...MISVLVDK.LIRTQ.IV.DCA.AVANWL..FS......................................................PNM...AHE.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLERQq.......hkK-Kds..........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.GSVD.FS.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A093X5E1_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQT.M..E.GGNG.DT.--SDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
E5ABN2_LEPMJ/742-995                   ..............................................................................................................FKYD......DPQ...TPYSAEGQKLLQQL.KK.KAP.......AEE....VQSTIDKIHEQA..LE.QG.V--....AEVLV.....................PSTDAFVT..AIC...RMGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVIQWV..LGs....................................................hMGA...GEA.L.T.E.S.W.V..YEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPQ....EQIE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............SMRGVAEGS..................aDVLL.E..K.QTSG.AL.TEEEV...............................................ELIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A0L8I1R9_OCTBM/487-758               ..............................................................................................................YKYEr...egSGS...LPGTVVAHQLKEAL.KN.KCS.......TDE....ALEILKDLPNPL..QD.EE.NE-....PTHNP.....................LKIDVFVS..TIL...YLGSKSFSHSF.S.AIA.K..F.........HYI..FKTL............VEN......................................................EEGQI..C...L....L.KTVYDLWR.THQ...Q...MLVVLIDK.LLKTQ.II.ECS.AVANWL..FS......................................................DEM...SHA.F.T.S.F.F.V..WEIMHS.TIKKMMKH..............VTKLQKEVEDARDKHESAq........qK-Addl.........dpdKDDE............................................................................TPNA....EMIE.RMV.EKLEAA.Q.S...Q.Q.KNLFLILF.........Q.............RFIILLTEH...................FARC.E..A.EGID.WN.T----...............................................SRYKWV..IE..RL..HEVFLTHHELV--ft...........................................................................................
W9X406_9EURO/538-790                   ..............................................................................................................FKYN......NDS...TPFAAEGKEVAQMV.RR.KAT.......SEE....FAPILEKIEQEV..AA.SG.--L....PDPSL.....................ASTDVFVT..SMC...WTGSKSLSHAL.A.CIE.R..C.........KER..LLAI...........sASS......................................................PACRK..Q...I....I.TSVVDYWR.DQR...G...VGVVLVDK.LLNYQ.IL.TPD.SVVEWA..LId....................................................hVSR...GTL.L.A.T.T.W.C..YELISN.TTRKVAGR..............---VRSIVGAIRSP----..........---...............----............................................................................GLSE....EQRL.ELQ.QTLNRE.L.E...G.M.KSLFAIIE.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEEE...............................................ELLKSW..GG..RW..ARVFQRRYAVEE-s............................................................................................
A0A1U8A4C5_NELNU/485-828               ..............................................................................................................FKYSe...dgGEG...TKEHELSVELNSMV.KG.KSV.......ARQ....IISWVEETIIPV..--.HG.---....---FK.....................VALEVIIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CPD......................................................QDKQM..M...L....I.DEVSFFWK.NNA...Q...MTAITIDR.MMGYR.LI.SNL.AIVEWV..FS......................................................PAN...IEQ.F.H.S.S.DrP..WEILRN.AINKTYNR..............ISDLREEISSLKKSVVSSe........eA-Aa.............kAQEEleaaeskltvvngepvlge......................................nparlkrlksfaekakeqeVSVR....DSLE.AKE.ALLARA.L.D...E.N.QVLFVSLY.........K.............NFLNVLMERlp..............nafDEEM.K..G.GLRP.TQ.T---Damavdpdetstmdvdken..........gnpksqangeragsgynigEKEQWC..LStlGY..MRAFSRQYATE--i............................................................................................
A0A091G5E2_9AVES/474-754               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DGE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0D1Z7K5_9EURO/540-792               ..............................................................................................................FKFD......DET...TPFAAQGREIAQLI.RK.KAA.......NDE....FAPIFDAIEQLA..VE.SG.M--....ANAQL.....................ASTDAFVT..SIC...WVGSKSMSHVL.A.CID.R..S.........KER..LLHF...........gSLG......................................................SEARK..Q...I....I.TSVMTYWQ.YQE...G...VGIIILDK.LLNYQ.IL.TPE.SIIEWA..LId....................................................kVNR...GTS.L.A.K.A.C.T..YELVNK.TVQKVCSR..............---VRSIVQAIRQH----..........---...............----............................................................................GLSE....DQRQ.ELQ.QTLNTE.M.E...N.T.KQLFNTIQ.........D.............AVSSIRDGH...................QDEM.I..E.-SSD.AL.RAEDE...............................................ELLKAW..GR..KW..VRAFERKSAVEE-s............................................................................................
A0A1I8G0E4_9PLAT/461-771               .................................................................................................ykydieedfspev----......---...---VQSAQRLIDAI.RE.RCT.......PER....AIEVLNTLPVPA..GG.AE.NGG....PNERHl...................lLKVDVFFS..TLL...FLGSKSFSHSF.A.ALA.K..F.........HSV..CKALv..........pLDN......................................................QAAKL..R...V....L.ASLYECWR.WHE...Q...MLIVLLDK.LVKVQ.LV.DCQ.AVFDWL..FGdclg.............................................dsgegLLP...KQE.L.S.R.C.Y.S..WDAAES.TLSKMCKQ..............LARLNEDWAKARQRYDSY.........hE-Kmrs.........gtaGDEDaaaaqklptdq......................................................sgpaamlvdedTPTR....DELD.AKL.DRLEKA.R.Q...E.L.RLLVAC--.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------llrcavwgaegggipsdeacsgsgdeeanerhlrrlvyerslacltmhysdv.........................................
H3DUI8_PRIPA/68-343                    .................................................................................................dqvaenheefera----......---...-------RHFQALF.QE.KLA.......ADA....MIEELRV-EEQT..--.--.GEG....PEFDS.....................RAFSVFFA..VLL...KLASKSFSHNF.A.ALT.R..Y.........HKT..LKHV...........vANS......................................................PTMQQ..T...L....L.STLYGCWR.NNT...Q...MMLILIDK.LLKMQ.IL.DCS.VVVAWI..FD.....................................................gEDA...QQE.H.S.R.Q.W.L..WEMLNN.SLGKLGKH..............VAKCKKDLETLKEAKQRK.........eKARk.............eK--Eaeaqgegeg.........................................................kddekmeegdDEAA....AAEM.DGE.AEVEAL.A.D...A.Q.KRIFLDVL.........M.............KFASALTTR...................LQEQ.-..G.DGAE.KS.-----...............................................LWYTFV..QG..RM..RHVFLAH------epvir........................................................................................
T1GNS6_MEGSC/18-236                    ..............................................................................................................YKYSs...enASS...LPGTQVALQLILAI.RQ.KCT.......PEE....ELPNPNESMETD..NA.EE.---....-SFNP.....................LKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HTV..FRAL............ADT......................................................EEAQI..C...V....L.HNVFELWK.HHQ...Q...MMVVIIDK.LLKLQ.IV.DCS.VVATWI..FS......................................................KEM...TSE.F.T.K.M.Y.L..WEILHL.TIKKMNNI..............----DDEDEQSNKNKNDNvd......kpT--...............--EEgpk.....................................................................qassK---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ppnilseandgtnndedtkdkskcyelf.................................................................
A0A1Q5TEA8_9EURO/539-792               ..............................................................................................................FKYS......SEA...TPYSKEGQELMQLI.RK.KAT.......DDE....LQPIIAAIEEQA..QG.LG.V--....EDPKV.....................PSTDALVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KDR..LLAV...........gAAS......................................................EKARL..Q...I....I.TSVMEYWA.DQT...G...IAINIIDK.LLNYT.II.SPM.SVLEWA..LId....................................................hIEA...GAI.L.S.K.P.H.I..YEMIAA.TVGKVTNR..............---MRQIVAARTQK----..........---...............----............................................................................GLYE....PQLS.VLE.DTLIRE.R.V...E.M.KNLFKFIE.........D.............AVVSVATGSnd...............elMERG.D..G.SGDM.PE.D----...............................................AILRQW..GR..RW..LRVFRRKAAVE--da...........................................................................................
A0A1S3JU09_LINUN/488-761               ..............................................................................................................YKYEk...egAGS...LPGTITAYKLLSSI.KS.KCT.......PEE....AAMILKDLPNPL..SD.EE.GD-....PAYNP.....................LKIDVFVS..TLL...FLGSKSFSHSF.A.AIA.K..F.........HYV..FKTL............AET......................................................EDAQI..C...I....L.RSVHEVWG.THQ...Q...MMCVLIDK.MLKTQ.II.ECS.AVANWL..FS......................................................SVM...TPH.F.T.S.F.F.V..WEILHS.TIRKMNKH..............VAKLQKEVEEAKDKLEAAe........rR-Ardgm.......didsKDDD............................................................................VPTE....EMIE.RME.EKLESA.Q.S...E.Q.KNLFLIIF.........Q.............RFIMILTEH...................LARC.E..A.EGQD.YN.T----...............................................PWYKWV..IE..RL..QQIFLLHHEQVYK.............................................................................................
F0ZKI8_DICPU/494-724                   ...................................................................................................fkflssenpee----......-EN...KELVSQSHKLLLSF.KT.KEP.......LEN....LIQTFSAIPSSI..--.--.---....-----.....................NCVELLTK..CIL...QIGSTSFSHLT.Y.AIE.R..Y.........LTL..FKTV............LKS......................................................QDDRQ..E...C....L.RSIFEFWK.YSQ...Q...HIVIVVDK.FITFK.II.YPI.DTVTWF..MK.....................................................pENI...SRF.I.T.E.S.F.T..WEILHN.SIQKTIIV..............IETLSLDLEENQSE----..........---...............----............................................................................----....----.EKE.FKLNTS.I.S...E.Q.QLLLSELI.........K.............GIGSILSND...................KNSL.N..-.----.--.-----...............................................DSSKLL..IA..GQ..LKS----------itrkyftqik...................................................................................
E3KEG4_PUCGT/487-821                   ..............................................................................................................FEYE......DPA...HRDHLAALDVVQLL.KH.KEP.......VSR....LLDYLTKMQERL..IT.EG.-IQ....EPVQD.....................VTREVAIQ..ALL...NVGSRSFSHFL.N.ILE.R..Y.........LEL..LRNL............TNS......................................................ANARA..S...L....L.QTVSKFWR.KNG...Q...FELIVIDK.LLEYR.VI.DPI.DSLRHS..FE......................................................TYK...TSQ.W.G.E.L.Q.F..WDGMKL.TIEKVTKR..............VKASRTKLAKLKKDEEDQr........dR-Qraag.......geilE--Tgngtanmgdinmkegiegeeg.................................kkdeepteeaqgestqlkeeleTMRR....DEIA.TAE.RELEAN.L.T...E.Q.VVVLAEAI.........S.............RFSSARSEA...................EEKL.K..T.EQES.VG.GEE-Evepsngeekd..........................qarkvsskdiaFWKAWW..LR..GW..CREFYRLFGTE--i............................................................................................
C4V887_NOSCE/295-389                   ...................................................................................iyevgsinsikkedldfnknkkdfyrd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..-FC...LLGSPSVSHFL.S.YLE.I..Y.........KNE..MKM-............--D......................................................EEQQK..I...F....L.EIFCEIFS.NRT...S...FKKIVIDK.MVKFN.FI.KSE.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lllk.........................................................................................
A0A015LJ81_9GLOM/314-574               ..............................................................................................................FKYE......DST...HPLHDLAETLLGKI.RK.RAS.......NED....VQAYFKEIVTAL..PP.KE.---....--QDQ.....................TIRDIFVQ..CVL...MQGCKSFSHVL.N.VIE.R..Y.........LPI..LQSL............NES......................................................PEDKL..H...T....V.KIVAEFWK.RNT...Q...FLGILLDK.LLNYR.VI.DAS.SIITWL..FT......................................................KEM...ETE.V.S.K.S.Y.M..WEIMKN.TINKVISR..............VKQVQYKLDTLINPRTDI.........iDIT...............SDVD...........................................................................kKVNS....EELR.SLE.NTLSNV.T.R...E.Q.KEVLLALV.........N.............LFVGMLDER...................LKEY.I..E.QDIQ.DP.M---S...............................................QYWFWW..AY..GF..FKEIGRCYQPQ--ms...........................................................................................
A0A0D1ZYX0_9PEZI/908-1170              ..............................................................................................................FKFD......KDD...TPFASEGREVFALM.KR.KAS.......EEQ....IEPYIEAVREQA..AN.FG.---....LDPMI.....................ASIDVYMT..ALC...HSGAKSVSHIT.A.AID.R..S.........RAT..LQNS...........rQRH......................................................PGVGR..Q...I....V.QSVVAYWK.DQP...G...NAVNIVDK.LLNYT.IV.TPD.SVIEWA..LGp...................................................esLGD...GAV.L.A.E.S.W.R..YEIVAK.TVGKVTGR..............VQQIVQAYISLEVQGSD-..........---...............---Dtt.......................................................................anvEDIR....GQIG.PMN.QLLVSE.R.N...A.M.RQLFATII.........D.............AVSGVATGA...................AEGL.-..V.DSAT.S-.-EEYA...............................................ELIKVW..AQ..KW..ARVFRRKLAVVE-t............................................................................................
A0A0B1NXU2_UNCNE/535-780               ..............................................................................................................FKYS......QED...TPFAAEGREILSLL.RK.KST.......EDA....IQPVIDRIHARA..IE.MN.--I....PDPLV.....................VSTDAYMT..AIC...YIGSKSLSHVL.S.CIE.R..C.........KGR..LMAL...........gPVS......................................................PAARK..Q...I....I.ESVMEYWK.DQP...G...IGVNLVDK.LLNYT.IL.SPE.SVVEWA..LA......................................................R-D...GTR.L.A.K.A.Y.I..FEMVSS.TISKVTGR..............---VRQVYRAKS------..........---...............--VS............................................................................GLSP....EQTK.ILI.NTVESE.R.A...S.M.KNLFQLLE.........K.............YLLGWINLY...................N--G.A..Q.NGTK.--.-NVED...............................................VLTNEW..AN..RW..LRVFKRKLAVE--da...........................................................................................
F8PPT7_SERL3/540-853                   ..............................................................................................................FEYD......EPT...HPHHDAAQSVLNLL.RG.RSK.......ADE....VMSHLDSLRDTL..-E.IS.DTH....MNIDT.....................LIRFIAVQ..SLL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRGLangg...ivgagSGS......................................................SEAKQ..D...I....L.SAAAAFWK.RNR...Q...MVNIVFDK.LMQYQ.IV.DPT.DVVAWT..FTnvag..............................................dshlSGM...RPL.S.L.S.A.F.E..WDLLKG.ALDKANGR..............VMISRRKVAALRKEEDDTia......raKASgga........dvasM--Evdada.................................................................kpdetpAVES....PALV.TAL.KAFTSL.T.R...E.Q.KAALSRTL.........E.............GFVSCLAPS...................VSDM.H..Q.NPHA.GK.--VITqdawdg..................................ranwnadEWNAWE..TW..GW..YRHYCRVYSPYL-r............................................................................................
A0A1Y2G2Z9_9BASI/602-868               ..............................................................................................................YAYE......NPD...HKHAAAAASLLRLV.RA.KGP.......IPE....VETELAEFASAL..QK.EH.SLT....EEEAE....................pIKRDMAIQ..TIL...SVGSRSFSHFL.N.VLE.R..Y.........LPL..LRTL............SPS......................................................PATRI..E...L....L.SILATFWR.RNS...Q...FHLIVLDK.LLQYR.LV.DSA.DVIAWV..FSpvan..............................................veedGKK...KKG.W.S.D.I.D.T..FTALNA.TIQTVQGR..............VTGAKGRLDGITREEEAK..........AAE...............KEHEidld....................................................................ripvDDEN....REIA.LAK.EQLETV.E.G...E.L.AVTIIEVI.........R.............QFSILLPVG...................VD--.-..-.----.-K.----D...............................................DWETWW..VE..GW..FREFCRS------iv...........................................................................................
A0A067CB45_SAPPC/616-817               .......................................................................................tkrikarddaavieawcnektss----......---...--------------.--.---.......---....------------..--.--.---....LDK-A.....................IVLEMVVS..ALL...EAGSATFTHFR.S.LLE.K..Y.........QEL..LATL............TAS......................................................TEDAL..A...A....I.NAVGAVWE.QSP...Q...HVILILSL.MMRHK.VL.SST.AISTWM..FS......................................................SDA...VQQ.Y.S.W.H.Y.V..WEILDN.SIVYGIER..............VEANPED-----------..........---...............----............................................................................----....----.---.---AAA.L.D...D.L.QSMLRAVL.........E.............GFMKVVADH...................KFSC.D..K.EGTS.FK.D----...............................................NWYTST..LA..RM..KAVGRR-------frva.........................................................................................
G0WB81_NAUDC/580-755                   .............................................................................................................l-YFL......QEN...VPFETQVRDILKYM.HK.PNN.......QRD....MDELQGILDEIR..TR.YQ.SMI....REMDE.....................FIVVLLTQ..CVT...YSGNRSLSHSN.K.YIN.D..L.........QQD..LHIAls.......dlnLST......................................................CTKEF..I...M....I.ESILRFWN.NNS...Q...TGFLVVDA.FRYSG.LV.SSK.AVIDFV..LKs....................................................yNGK...IYG.L.T.D.D.T.A..IECIFR.TLTRG---..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ritrvnnfl....................................................................................
A0A1A8W4L0_PLAMA/879-1089              .........................................................nrysililffkaliffdssnvsslkkvfknhaiifsnyknsgiyqseddkyny----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................---DI..E...L....V.NIVYTH-F.NNS...V...LLNVIVNI.LVENE.II.DEF.SVIYFI..FN......................................................KLD...ESN.L.D.E.Y.Y.V..FRLIYE.VIDSQITK..............-----KEYNDLEKNRLKR..........---...............----............................................................................KQTK....NENE.VLI.KELEDK.K.N...E.L.VQKIFHLT.........N.............KTIVMLGKK...................MMKL.K..N.EHNS.YM.S----...............................................------..--..--..-------------kellkeslvflrtymdyididqflq....................................................................
A0A176VS48_MARPO/489-844               ..............................................................................................................YKYDd...pqAVS...AEEHRIATELIMMT.RG.KRR.......ARD....IQVYIEE--KIL..PD.YG.Q--....----K.....................MAIEVAVQ..TFL...YIGSKSFTHTV.G.ILE.K..Y.........GTV..LSKL...........aANN......................................................HSWQT..V...I....I.ESVAQFWK.NSA...Q...MTSIVIDR.MMGYR.IV.SNL.AIVAWV..FS.....................................................aDNV...NRF.H.T.S.H.H.V..WEVLEN.AINKTNNR..............TADLRKDVASVEKSVDAAta......alA-Kav...........akV--Eaavalletatddetraga........................................ksklewatsaqkkakdeeSSSQ....ESLE.VKE.ALLLRA.L.H...E.Q.EALFMAVY.........Q.............NFATVLTQRlsv............plpsVEVV.K..T.DTEA.EH.VE--DpmavdqettvgaedgdnveidgerrnqkysvktngvstaeelevqeqLTWRKC..TL..GY..LRAITRHYATE--v............................................................................................
W7IGH9_9PEZI/535-781                   ..............................................................................................................FKFE......ADD...IAFPEEGKQLLNLI.RQ.KAP.......NEE....VDTLMNAITEAA..SN.KG.--L....PDATK.....................YARDMYVT..CIC...HIGAKSLSHVL.S.CIE.R..C.........KDK..LTQL...........gQES......................................................NQAQR..Q...I....V.GTVMHYWA.EQP...G...IGANVIDK.LLNYS.IL.TPL.SVVEWV..LL......................................................DAG...REV.L.P.R.G.H.A..WEMVNT.TVRKVVSR..............----TRNLAAARGAP---..........---...............----............................................................................DLPE....EQMT.IME.QGHEVA.K.A...E.Q.AELFKVVM.........E.............GLAGYADGS...................VPAP.E..G.TGEE.DA.-----...............................................AWLKVW..SG..SW..LRALKRQSDIEE-a............................................................................................
A0A0R3SJB0_HYMDI/513-700               ......................................rrkaflkileafnqrlcpddlldvvrrtaaqrgddieesdshvhrrsrslsdtegspehsaefrgneeegek----......---...--------------.--.---.......---....----IEEMDND-..--.--.---....----Eplaqcl.........ipgvtsLELELFLT..ALL...LRAHKTISHAG.S.LLT.R..Y.........SDV..FRVL............AST......................................................VDLQI..E...A....L.HILQAIWY.DQS...Q...MVVAISNY.MSREG.ML.DPE.SIVLWA..FS......................................................PSM...S--.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------afadepdl.....................................................................................
J9J348_9SPIT/488-774                   .........................................................................................................cteqq----......---...--DSPDAQIILDLL.NQ.KET.......PEN....LKAALAGENSKI..EA.SG.E--....-----.....................QMKEIFLE..CII...SKTKKSLEHLK.R.VFE.H..Y.........YQH..IMQPff........lgD-T.....................................................iAESQV..T...L....I.RTICNIWI.NNP...K...KNLQIIEK.LYSLG.II.VPK.YALVYS..FQal.................................................ndlSVK...EQQ.S.N.E.N.I.H..SQIISL.LVKSVSHR..............PSQLFTLYNQKDNPISQR.........eKDR...............---Qalegegnaanahp..................................................ahfdlslskrlviK---....-NDA.DFE.NQHKLA.C.Q...E.R.DEVIKMTT.........Q.............SYLKLINEN...................QNGL.-..-.----.--.-----...............................................------..--..--..-------------kelqsqfarllrgyihsfsgpaiieavtqmeiqneiak.......................................................
A0A139AC44_GONPR/473-777               .........................................................................................................kgdve----......--D...ERLKELATELVNAL.RS.KKP.......GTA....IKGIFDAIREHI..RA.KL.GHE....ANEVAhwdgdtqh....pswdadadsVVRDVFAQ..AVM...VVGCKSLSHLA.M.IVE.R..S.........RAV..WNDL............FTS......................................................DLARA..Q...L....M.TSLASFFR.FRP...Q...LLEIWCGR.LINYR.VL.SVE.SILAWS..LSp....................................................dHLN...RTE.G.A.D.P.T.P..WYVLET.TLRKVTLR..............RSQADERVARARDQVAFN.........qK-Rr............dvGDGDfvydengnkf.......................................................dgltgpitsgeTAAQ....REVQ.EAE.EEVERM.T.R...E.Q.KQAFLSVL.........Q.............RFVRIITAK...................ISET.S..M.EDVD.IE.---RT...............................................PWWRW-..VY..GF..MRQIGREFGPEI-r............................................................................................
A0A1W2TLB9_ROSNE/531-770               ..............................................................................................................FKFN......HEH...TPFSAEGKELAALL.KR.KAP.......EDE....IQPVIDRIHSTA..LD.QS.-I-....-DPWI.....................TSTDVFMT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDA...........gAAS......................................................EAARA..Q...I....I.TAVMSYWS.AHP...G...VAITIIEK.LLNYS.IV.TPG.AVIDWA..LVgd..................................................raGPH...GQA.L.G.K.A.W.V..FELVFH.TVVKVTSR..............---LRQVVKG--------..........---...............----............................................................................----....----.GVT.EGVQEE.I.A...A.M.RELFKAMN.........D.............ALVSWSDGT...................KDQLmD..P.TGPD.GG.E----...............................................ALVKRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
E9F5L4_METRA/538-783                   ..............................................................................................................FKYT......NPD...TPFAKEGQEISALL.RR.KAP.......DEE....MQPLIDSIQAQA..KE.QA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDV...........gTAH......................................................PAARS..Q...I....I.SSIMNYWA.AHP...G...VAITIIEK.LLNYS.IL.TPL.SIVDWT..LVass...............................................psngTQG...GEA.L.G.R.S.H.I..FELVAN.TVAKVSGR..............---VRQLLTSPDA-----..........---...............----............................................................................----....----.-DA.DTRDKE.V.S...S.M.RDLFAAIN.........D.............ALASWASGS...................KDQL.M..E.DGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
A0A225AFC9_9EURO/546-800               ..............................................................................................................FKYT......LET...TPYSKQGSELMQLI.RK.KAT.......DEE....IEPVIAEIEKQA..KE.HG.V--....EDSMV.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................APGRR..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LLd....................................................rIDA...GKI.L.S.Q.A.H.V..YEMVSA.TVNKVTNR..............---IRQIVAARTQR----..........---...............----............................................................................GLYE....PQLG.VVD.EALNRE.K.A...D.M.QTLFTLIE.........D.............SITPVAAGS..................nDELM.E..R.SEDD.PS.TREEN...............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
A0A0D2J479_9EURO/535-787               ..............................................................................................................FKYN......DDS...TPFAAEGKEIAQLI.RR.KAA.......NED....FTPILEKIEQDA..TV.SG.--L....LDPQL.....................ASTDAFVS..SIC...WVGSKSLSHVL.A.CIE.R..C.........KER..LLAI...........sSTS......................................................SACRK..Q...I....I.TSVMDYWQ.DQR...G...VGVIIIDK.LLNYQ.IL.TPS.SIVEWA..LId....................................................hVTR...GTL.L.A.N.A.W.C..YELITN.TTRKVAGR..............---VKSIVHAIRQP----..........---...............----............................................................................GLEE....QQKV.ELE.QTLAHE.L.E...N.V.KSLFAMIE.........D.............AVVSIRDGHqd...............gmIERS.-..-.---D.VL.RAEEE...............................................VLLKSW..GA..KW..ARVFQRKYAVEE-s............................................................................................
A0A1E3QFL2_LIPST/522-773               ..............................................................................................................FKFA......LPD...EPYSEQSRLVLQNI.RD.RRG.......PDE....FTEVFDEIKKKS..EE.QN.-DK....ADAHD.....................MVCEIFVT..AIV...HLGARSLSHVE.S.WIE.R..T.........LPV..LRVVc..........pEKG......................................................GERHR..R...V....V.KIIFKYWK.DKT...G...TAVQVVKK.MMNHK.VI.APL.SVVEWI..LL......................................................DLE...VGS.F.S.E.G.Y.S..WELLGF.AIDKAKLL..............IKEAEAVPKTVE------..........---...............-DED............................................................................GDTK....LLAD.EKL.KEIDDN.I.E...T.L.KNTLNHIF.........V.............TIVKELARP...................-VQG.D..A.KNEE.TV.-----...............................................RWQRWW..KE..GF..LRAVLRNYHADY-k............................................................................................
B4LSE0_DROVI/496-710                   ..............................................................................................................FKYI......NEL...LPGAKLAKHLLEAI.RS.KCA.......PEL....LGGLVESTTELE..--.--.---....---DA.....................LKINVLMQ..TFL...HLGCKSFTHIF.S.IFS.K..F.........QAV..LKML............ACN......................................................DANQM..S...M....L.SALFELWA.SNE...Q...VKLVVADK.LMKMQ.IV.GAH.VIVAWV..FD......................................................PTL...KQE.L.V.K.M.Y.M..WELLNL.TVKYTKFH..............----RRDS----------..........---...............----............................................................................----....----.---.--EQDQ.D.S...R.L.EALLLNIV.........Q.............SCVQVLTKH...................QPAS.-..-.----.-Q.ALEID...............................................YWFDWV..QG..RL..QQLLF--------nymddvr......................................................................................
N1RS65_FUSC4/531-775                   ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AAPE-----..........---...............----............................................................................----....----.-TD.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
F0VR04_NEOCL/894-1134                  ..............................................................................................fpyeddddghvwsltd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-LAQVLVF..ALL...ARGLKTLTHSE.R.LVE.N..Y.........FPV..FRFL............KEGatqkalremqpaalkargdtreecgeesdvemddeeededpadeegltkaerraQEVEE..A...F....L.KAVFDFWK.HSR...Q...KTVLTVRH.FERFG.VV.SKE.GVIRFV..FE......................................................SLS...PGD.R.D.D.S.R.V..MEL-FD.LLAQLSIQ..............DFDVKKET------ALQL..........KDAc.............gEDAEk..........................................................................iAEAA....QAAT.AA-.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aealegvhtllhfiligfmrellreeqdar...............................................................
A0A1E4SN74_9ASCO/649-908               ..............................................................................................................FNYS......NPE...LPLHQISSKVYDFVsAH.WKT.......NSE....FSDLYKEILTGV..QT.LP.NIN....AER--.....................FIINLFFQ..TYA...YIGSRSIYSVV.S.VLS.R..D.........INK..LKYL............SGSeitygddeak.................................fesleltpeqvENRQV..W...I....I.EAIFRIWS.HQP...Q...VVFLVLEY.LIEFE.IL.KPE.FLIPKT..LS......................................................LST...NLL.I.E.N.V.S.C..MESINR.ILNNFHTS..............------------------..........---...............----............................................................................----....----.---.-----N.P.E...Q.F.KKLFLIVV.........N.............SIVRNLNLI...................SQSL.N..V.PNNE.TI.TIQKEfdeedld.................................lqkninnQWLYYE..YK..GL..LKSYIRKYL----ksda.........................................................................................
A0A1S3ST44_SALSA/485-766               ..............................................................................................................YKYQd...eaNSA...LPGYAVAITVGNAI.KN.RAS.......NEE....ILTVLKDVPNPN..QE.DD.DDE...gEGFNP.....................LKIEVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEI..LKVL............TDC......................................................DEGKL..H...I....L.RVVYEVWR.NHP...Q...MISVLVDK.LIRTQ.IV.DCA.AVANWL..FS......................................................PNM...AHE.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLERQq.......hkK-Qkds.........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.GSVD.FS.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A084RQR2_STACH/535-780               ..............................................................................................................FKFN......DPN...TPFATEGQEIGALL.RK.KAP.......DEE....FQPIIDRIHAEA..TQ.RA.---....LDPYV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLDV...........gSTS......................................................EAART..Q...I....I.SAVMAYWH.AHP...G...VALSITEK.LLNYS.IL.TPI.SVIDWA..LAgnt...............................................aasgTNG...GDS.L.G.Q.P.H.V..FELVAN.TIAKVTGR..............---VRQLLLSAD------..........---...............----............................................................................----....----.ADA.ETRDKE.V.K...A.M.RDLFRATN.........D.............ALASWAGGS...................KDEL.M..E.QGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRQAAIEE-a............................................................................................
W5J8I3_ANODA/6-291                     ...........................................................................................................rct----......--S...LPGTATAHKLVVAI.RK.KCN.......ASE....VLTELNDLPNPR..EG.SE.ADM....TESTFn...................pLKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKDKLART.........aE-Ss............ssE--Seeegaggtsnt.....................................................qkrrknadgtaeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRE.YN.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVQK.............................................................................................
G3H7F1_CRIGR/276-551                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.NDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................NEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1L9MSQ8_ASPTU/548-801               ..............................................................................................................FKYS......SDS...TPYANEGREIMQLV.RK.KAS.......DEE....IQPFINAIEEQA..RS.LG.V--....EDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................AQARR..Q...I....I.TSVMEYWV.DQP...G...VGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.V...D.M.QSLFKVIE.........D.............SIVSVAGGSnd...............eqMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
M0SWM8_MUSAM/81-421                    ..............................................................................................................FKYN......SEE...DHGYTLSKEFREMV.RG.RKT.......AGE....ITSWVEE--NII..QI.HG.S--....----K.....................FAIEVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CTD......................................................QNMQV..L...L....I.DEVSSHWK.NNT...Q...MTAIAIDR.MMGYR.II.SNL.AIVSWV..FS......................................................LSN...IEQ.F.H.V.SdR.P..WEILRN.AINKTYNR..............IADLRKEIQTLKKSVLLAed.....vavK-Alk...........efE--Aaetrlevvdgqpvqaek.........................................pgrlkrlkgyaekakddeIAAR....EALE.AKD.ALLARA.L.E...E.N.KSLFVSLY.........K.............SFANVLTERl................ppV---.-..-.----.--.-----...............................................------..--..--..-------------sadgafpklrdeedidsmaidleepstmemdhdnrrkddrngekvthrysikeqdqwclctlgyvkafsrqyatev.................
A0A066WJ86_9BASI/636-951               ..............................................................................................................FTYE......DPN...QTWHVKATELVNSF.RA.KAS.......ADV....VLANLESFKREI..IA.PD.DVT...mTDTDAptvat..........eaqaeiMIRDVAVQ..AVL...SVGSRSFSHFL.N.VVE.R..Y.........HAL..LRNL............STS......................................................PEMRI..H...I....L.GAVARFWR.RSP...Q...WILIVADK.LLQYR.IL.EPS.DIVKYV..FDpaaskl.........................................pvdglgqNEE...ARD.W.S.S.F.V.W..WDLLRN.TIEKINGR..............VNQLQARVEALEAEEAARqe.....maeA-Eaaaa......pskkaN--Eeeeapaivfpt......................................................svavpvpedpaKEKK....DTLQ.DRR.VALEAV.M.T...E.Q.RKVLSALI.........N.............GFAEAMPAN...................----.P..T.DAVD.EP.-----...............................................DWNQYW..LT..GW..SKELLRRFHTQ--fg...........................................................................................
NCBP1_ORYSJ/483-829                    ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0V1MPI7_9BILA/490-752               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aGDS......................................................KEAQL..H...V....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIDWI..FS......................................................EKM...KGS.L.M.R.Q.Y.V..WQIVFS.MSTRLARN..............IKKIQEDLEKKQTEEGTM..........-SS...............TSSD............................................................................GERN....SEIS.AIQ.MKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KMIILLSEH...................LLQS.D..A.EDRD.SH.I----...............................................SWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
G0SE05_CHATD/536-786                   ..............................................................................................................FKFA......NDE...TPFAPEGREIASLL.KR.KAA.......DEE....IETYIQRIQSQA..VD.RD.---....MDALV.....................ASTDVFVT..CVL...HIGNKSLSHVL.A.AIE.R..T.........KDR..LADA...........gAAS......................................................DAARA..Q...I....I.TATMAYWS.AHP...G...VAITIIEK.LLNYS.IL.TPA.AVLEWV..LRgr..................................................vaETR...GRV.L.G.T.A.Y.M..YELVAN.TVNKVTSR..............VRGLAFKVPTT-------..........---...............----............................................................................---P....EEEE.EDA.KTRETE.V.A...R.M.RALFTEIE.........E.............ALAPWASSS...................A-RE.E..Q.MEED.GK.NEEDE...............................................RMVRRW..AD..RW..LRVFRRRAAIEE-t............................................................................................
G2XE50_VERDV/537-781                   ..............................................................................................................FKFS......DET...TPFSAEGRELAALL.KR.KVP.......DED....FQPVLDRIHAAA..TE.HS.---....LDALV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..V.........KDR..LLDI...........gAAS......................................................EAARA..Q...I....I.TAVMAYWR.AQP...G...VAISIIEK.LLNYS.IL.TPL.SVIEWS..LVyn..................................................hsERE...GDA.L.A.E.A.H.V..FELVSN.TVTKVTGR..............---VRQIMTAPELD----..........---...............----............................................................................----....---A.DAE.ASKELD.K.K...A.M.RDLFSSLK.........D.............ALSSWKAGI..................kDEML.D..E.PDSE.E-.---RK...............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
A0A0V1KN04_9BILA/510-787               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FSekmrgnl.......................................msvqksveCEF...CNF.Y.I.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
E1Z775_CHLVA/534-793                   .........................................................................................................dtegh----......---...-----AAAQMLALV.RG.KAT.......PEE....LDAWMAQQGLEA..QL.GG.--P....L----.....................GVLRCMAR..CLL...VAGAKSYTHMV.I.ALE.R..Y.........YGP..LKNAv..........dTAG......................................................LEGEA..A...L....V.GVANSVWR.ASP...Q...RAAMAVDR.LMTLR.LV.SAE.AIVGWV..FGse..................................................gvTAL...GDE.S.L.S.G.A.A..WEILYN.AINKTIAR..............VQDAREDLTATEAAVAQL..........QARvda........lmtaG--Emaad...................................................................aasqlDEAV....QSLE.EKR.AYVAET.R.E...Q.Q.ECAFLQVM.........R.............CFVSVLSLG...................----.-..-.----.--.-----...............................................------..--..--..-------------hgsamgnamdtgadeatrcktlcwqr...................................................................
A0A1L9VDH3_ASPGL/532-785               ..............................................................................................................FKYS......VDT...TPYANEGRELMQLI.RK.KAG.......DEE....VQPIIASIEEQA..KE.HG.V--....EDPML.....................PSTDAFVT..SIC...FVGAKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................SRARN..Q...I....V.TSVMEYWA.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................nLTA...GNI.L.A.R.T.E.I..YEMVAA.TIGKVTNR..............---LRQIV----AARIQP..........---...............----............................................................................GLYE....PQLG.VID.DTLHRE.K.A...D.M.QALFKVTE.........D.............SLVSIANGSnd...............eqMERG.D..G.SGGL.PE.D----...............................................EILRQW..GH..RW..LRVFRRKAAVEE-a............................................................................................
X6R941_HUMAN/1-124                     ............................................................................................................xl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQ-------vcge.........................................................................................
A0A0E0GMC1_ORYNI/530-876               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRKYATE--i............................................................................................
M2ML26_BAUCO/552-803                   ..............................................................................................................YKYN......SDV...TPYAEAGREVLHLL.KK.KAP.......ETD....IQAALNAVHEQA..RG.HG.V--....TDPLV.....................PSTDIYMT..AIL...SIGSKSLSHVL.S.TID.R..C.........KER..LLAV...........gSQS......................................................EMARR..Q...I....I.SSVVEFWA.EHP...G...TAVNIVDK.LLNYT.IV.TPM.SVIQWA..LQd....................................................hIDR...GRA.L.A.N.S.Q.I..YELISI.TMFKVTNR..............---VRQVV----RERNNM..........---...............----............................................................................ALPF....EQRQ.QID.EALPRE.R.Q...G.M.RDLFAAIE.........D.............AVAGIAAGA...................QDEM.I..E.RYDN.G-.-SSEE...............................................NAIKTW..GQ..RW..ARVWRRKAAVEE-a............................................................................................
A0A1X7UJX9_AMPQE/516-780               ..............................................................................................................YLYA......EDG...VQGFEVAKQLVESM.KA.KVP.......LER....LKEVLDGTDIGN..NS.EE.Q--....--LLE.....................LKVSILTH..CIL...HIGDKTISHCF.T.ALH.K..F.........RSL..LLEL............LET......................................................ENAKL..Y...C....L.SAVGEFFE.ENT...Q...LHCLVIDR.LVRQE.LI.DNG.SIIKWC..FT......................................................SSN...HPD.F.T.S.R.L.F..WDILRS.SFSRVNKS..............LLQCEKELEEIKEKLQKTt........gLDEl............vdGTED...........................................................................kQELE....WKIQ.ELE.EKVEER.S.T...E.Q.KEVFLSTC.........R.............YLIESLCSH...................LSTC.D..E.EGTD.YE.T----...............................................TWYTCI..TD..--..-------------ntrqlliqyhtvyrq..............................................................................
A0A1D6K2X7_MAIZE/124-470               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
M1VV04_CLAP2/553-807                   ..............................................................................................................FKYR......DPD...TPFSKEGQELAALL.KR.KAP.......DED....FQSVIDSIQAQA..TE.QA.---....LDPIV.....................TSTDVFMT..AVC...WAGSKSLSHVL.A.CID.R..T.........KTR..LSDA...........aSSS......................................................PAARA..Q...V....I.SSVMNYWS.AHP...G...IALSIIEK.LLNYS.IL.TPL.SIVDWT..LGast...............................................pingTQG...GAA.L.G.Q.A.H.M..YELITN.TVTKVSGR..............---VRLLLTSSASASA--..........---...............----............................................................................---S....ADGS.DEE.QTREKE.I.G...G.M.RDLFRAIN.........D.............ALASWASGS...................KDQL.M..E.EGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..QRVFQRLAAIEE-t............................................................................................
E6ZW71_SPORE/641-959                   ..............................................................................................................FTYA......DES...HAYGAHAARLINSI.KA.KAS.......AEV....ILADFETFKASI..VD.SA.STL....PTDGSdgmvcd.........qqqadvVVRDLTIQ..CVL...QVGSRSFSHFL.N.IVE.R..Y.........HAL..LRQL............SRS......................................................ARMRA..A...I....L.AGAVRFWT.RSQ...Q...WIHIVVDK.LLQYR.IV.EPA.DVVEFI..FSpptdep..........................................atirsgAEA...QEG.W.V.G.F.N.T..WTLLRL.TLEKVNGR..............VDQLRKRLEEIERHEADEre......rkD-Aaaaa.......glplEDDDespaaaqqeamplf...............................................ptsatlpirptepsaQQQH....LSSA.DAL.ANLDAI.K.S...E.Q.RKVLITAL.........R.............GFKTHLAAL...................E---.-..-.---H.DQ.H----...............................................AWTHWW..TM..GW..YRQLVRCFNVQL-m............................................................................................
A0A0E0D0E2_9ORYZ/483-829               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVCQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisv.......dgdvpnL---.-..-.----.--.-RAGDpnvnsaardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
C9S8W0_VERA1/460-704                   ..............................................................................................................FKFS......DET...TPFSAEGRELAALL.KR.KVP.......DEE....FQPVLDRIHAAA..TE.HS.---....LDALV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..V.........KDR..LLDI...........gAAS......................................................EAARA..Q...I....I.TAVMAYWR.AQP...G...VAISIIEK.LLNYS.IL.TPL.SVIEWS..LVyn..................................................hsERE...GDA.L.A.E.A.H.V..FELVSN.TVTKVTGR..............---VRQIMTAPELD----..........---...............----............................................................................----....---A.DAE.ASKELD.K.K...A.M.RDLFTSLK.........D.............ALSSWKAGI..................kDEML.D..E.PNSE.ER.----K...............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
A0A0B2UWP0_TOXCA/547-823               ..............................................................................................................YNFE......NED...APTAALAVRVSELI.RS.KTT.......ADE....LIETLTGSEVEG..LS.D-.---....----E.....................LVLSAFVA..VLL...NLSQKTISHSF.A.ALT.R..Y.........FKT..LKQL............AGG......................................................EDSQM..T...V....L.RTLYMVWK.HNQ...Q...MMSVIANK.MVTMT.II.DAT.AVVAWI..FS......................................................DEM...KLE.F.E.R.M.W.T..WELLCD.TVEHVVGH..............LRRCRLKLNKLQKSRTKK.........dKEKqev........srrdT--Emdvdkdis............................................................edeskgedGPNE....DDVS.LLA.NEVEDL.R.E...Y.L.QNLLLDVL.........H.............KFTVKLTEH...................IVIC.D..S.KGED.IN.T----...............................................SWYKYF..TA..RF..RGFFLKHWKE---lfe..........................................................................................
A0A251PR15_PRUPE/373-718               ......................................................................................................fkfsveet----......SEG...NGQHALSVDLRTMV.KG.RAS.......ARE....MIVWIEESVFPV..HG.ME.---....-----.....................GTLNVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CGD......................................................QDKQV..M...L....I.TEIDSYWR.NNS...Q...MSAVAIDR.MMGYR.LL.SNL.AIVRWV..FS......................................................PAN...IEQ.F.H.L.SdR.P..WEILRN.TVSKTYNR..............VCDLRKEILSLKKSIVSAe........eA-Aatak......aelvaA--Esklslmdgepvlgenp...........................................vrlkrlksyaekakeeeLSVR....ESLE.AKE.ALLARA.L.D...E.F.EALFLSLY.........K.............NFLNVLTERlpsastc....vtlqglksI---.-..-.----.--.----Hadsmavdveessamevdden.......grpkksqlnggrmssvynvgE-----..--..--..-------------keqwclstlgylkafsrqyasei......................................................................
A0A0M8MQP6_9BASI/617-925               ..............................................................................................................YLYG......DPS...HAHHALAMQFFNSL.KA.KAS.......VQV....VQADLQSFQQRI..LA.PP.SDV....PSLDEthvet..........paeaeqVVRDMAVQ..TLL...NAGSRSFSHLL.N.VIE.R..Y.........HEL..LRAL............SQT......................................................PEARV..S...I....L.ASTAAFWT.RSP...Q...WVLIVCDK.LLQYR.IV.EPV.DVVTFV..FStpeateaddeag..............................safalatpsavwGST...SRD.W.S.S.F.H.W..WAMLRL.TVDKVLGR..............VGQLARRVEELKRASSTEt........tA-Sadpt.......shsvS--Ssd.......................................................................appRAAA....SSVD.EAQ.VHLDAI.Q.L...E.Q.RKVLVTIL.........T.............QMVALLHAR..................gLPTL.D..A.HASA.D-.-----...............................................AWQTWW..LH..EW..YRAFLGVYAPVL-a............................................................................................
A0A151IDL5_9HYME/498-774               ..............................................................................................................YKYSs...egASS...LPGTCAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPR..EN.EE.TNN....YNP--.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELTDAREKLRRA.........eS-Rsg..........sssD--Eednnk..................................................................eknreRPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..VG..RL..QQVFLSHQEQVQK.............................................................................................
A0A0F8X6W2_9EURO/534-787               ..............................................................................................................FKYA......LET...TPYANEGKEIMQLI.RK.KAT.......DEE....IQPFITAIEEQA..KE.HG.VE-....-DLLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................PAARR..Q...I....I.TSVMEYWV.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLDA...GTI.L.A.K.A.P.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLTRE.K.A...D.M.HALFRIIE.........D.............SVVTVAGGSnd...............qlMERG.D..G.SGDL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAAVEE-s............................................................................................
W6QLA4_PENRF/531-784                   ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTES......................................................PHARC..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sVAA...GTI.L.A.K.P.H.I..FEMISA.TVGKVTNR..............---MRQIV----AARVQP..........---...............----............................................................................GLYE....PQLS.VID.ETLASE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGS...................NDEL.M..E.RGDG.SG.TLPED...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A0V1KLZ0_9BILA/510-765               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHE---.---...-...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A2I2U867_FELCA/516-791               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
G1X9L4_ARTOA/544-790                   ..............................................................................................................FKFE......SDD...IAFPEEGKQLLNLI.RQ.KAP.......NEE....VDTLMNAITDAA..NN.KG.--L....PDPSK.....................YARDMYMT..CIC...HIGAKSLSHVL.S.CIE.R..C.........KEK..LTQL...........gQES......................................................SQAQR..Q...I....V.GTVMRYWA.DQP...G...IGANVIDK.LLNYS.IL.TPL.SVIEWV..VL......................................................DAG...GEV.L.P.R.G.H.A..WEMVNT.TTRKVVLR..............----TRNLASARGE----..........---...............----............................................................................DLPE....EQIA.TAE.QQHEVA.K.A...E.Q.AELFKVVM.........E.............GLGRYEDGG...................VVVG.K..E.GTSG.ED.V----...............................................ELLKWW..AA..SW..LRALKRQRDIEE-a............................................................................................
E9E5T2_METAQ/604-848                   ...........................................................................................................anr----......NTD...TPFAKEGQEISALL.RR.KAT.......DEE....IQPLIDSIQAQA..KE.QA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDV...........gSAH......................................................PAARS..Q...I....I.SSIMNYWA.AHP...G...VAITIIEK.LLNYS.IL.TPL.SIVDWT..LVass...............................................psngTQG...GEA.L.G.R.S.H.M..FELVAN.TVAKVSGR..............---VRQLLTSPDA-----..........---...............----............................................................................----....----.-DA.DTRDKE.V.S...S.M.RDLFAAIN.........D.............ALASWASGT...................KDQL.M..E.DGDG.SP.E--RE...............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
A0A084QBE8_STAC4/545-790               ..............................................................................................................FKFS......DPN...TPFATEGQEIGALL.RK.KAP.......DEE....FQPIIDRIHAEA..TQ.RA.---....LDPYV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLDV...........gSTS......................................................EAART..Q...I....I.SAVMAYWH.AHP...G...VALSITEK.LLNYS.IL.TPI.SVIDWA..LAgnt...............................................aasgTNG...GDS.L.G.Q.P.H.V..FELVAN.TIAKVTGR..............---VRQLLLSAD------..........---...............----............................................................................----....----.ADA.ETRDKE.V.K...A.M.RDLFRATN.........D.............ALASWAGGS...................KDEL.M..E.QGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRQAAIEE-a............................................................................................
A0A1U7RSW8_ALLSI/480-760               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...THD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIQKELEETKARLARQ.........hKRRd.............sD--Dddyddd...............................................................rssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VV.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1R3GP05_COCAP/484-829               ..............................................................................................................FKYGve..dgREK...TELHALSAELSSKV.KG.RQT.......SRE....IVPWIEESIYPV..--.HG.---....P---E.....................VTLSVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CPD......................................................QDKQV..M...L....I.AEVGSYWR.NNA...Q...MTAIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IEQ.F.H.I.SdR.P..WEVLRN.AVSKTYNR..............ITDLRKEILSLKKGVISAee.....ataKAKa............elE--Aaesklslvegepvlgen.........................................parlkrlktqaekanegeVSIR....DSLE.AKE.ALLARA.S.E...E.I.EVLFLSLY.........K.............NFSNVLKERl................pdA---.-..-.----.--.-----...............................................------..--..--..-------------sragtlqalksingdsmavdleessamevddengrpkksqsnggkasniynvreneqwclstlgyvkafsrqyasei................
A0A194XJ01_9HELO/529-776               ..............................................................................................................FKYT......NPD...TPFSAEGQEILALL.RK.KSP.......EDE....IQPVIDRIHAQA..VE.MH.--I....PDPLV.....................LSTDAYMT..AIC...YLGCKSMSHIL.N.FIE.R..C.........RER..LLAL...........gPVS......................................................PAARK..Q...I....V.DSVMNYWR.DQP...G...VGVSIVDK.LLNYT.IL.SPN.TVVEWA..LA......................................................K-E...GPR.L.G.E.P.H.V..YEMVSA.TMNKVTRN..............---VRRVVQAHHVL----..........---...............----............................................................................-GPS....PEKE.MLR.ETAERE.R.A...S.M.KELFALME.........D.............SLTGWASGS...................KDQT.I..Q.SGD-.-G.TSGDE...............................................KMVRQW..GE..RW..LRVFRRKFAVEE-a............................................................................................
A0A162PQY1_PHYB8/540-812               ..............................................................................................................FEFK......DPS...HPLHLQAKLVIDSL.RA.KKS.......VEE....VREILNNFKAEQ..AK.LG.LDE....TAQLG.....................AVRQLFVQ..CLL...LVGSKSFSHVL.N.VVE.R..Y.........LEV..MRYV............NST......................................................PEGRL..H...T....V.QIVSSFWK.NNT...Q...FLGILLDK.LLNYR.VI.DPT.SVISWT..FE......................................................PEQ...LEN.A.G.R.A.Y.P..WEILKN.TLNKVVSR..............VVQVRLKLESYQELHAEN..........EAKrqs.........tglT--Emaq......................................................................aeaQQEL....DTLR.IVD.NSLTTV.T.R...E.Q.KEVFMVIY.........Q.............KFANTLQEL...................LITC.T..A.RAQD.PN.T----...............................................HWTYWW..VF..GW..YTEMLRLYQKEC-s............................................................................................
A0A183BVH2_GLOPA/465-568               ...........................................................................................................yil---D......DAQ...HPAFSKAEQFRALI.SN.KVE.......NEE....ILAALRMSTDDI..DE.GA.EQR....SEFSGey.................svDAVAIFFA..VLL...KLSSRTFTHTF.S.AFT.S..T.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------iaitpfvptreegpkqqli..........................................................................
A0A165JR76_9BASI/573-875               ..............................................................................................................FEFG......NPA...NEHHDASMTLAKLM.QG.NPEqriprssPQE....VIDEVNRIREQL..AE.GE.YTA....EMADE.....................TARAIAFQ..TLL...DVGSRSFSHLL.N.AIE.R..Y.........LPL..LRNL............AKA......................................................EGAKA..Q...L....L.DETQRFWQ.QDE...Q...RILIVFDK.LMQYQ.IL.DPV.DIINWC..FGsvsdte.........................................gvtmdghAGR...KSR.W.F.S.T.F.K..WEALRS.AMDKANGR..............VTVAKKRAATLRKEDDEAr........aKAA..............sT-GDdyamadnp............................................................dafpeaapVIDS....PALA.NAL.KALATL.T.K...D.Q.KSSLTAAL.........T.............GFCRTLVYS...................PEGT.S..W.EARR.D-.-WTDT...............................................AWASWE..TW..GW..FRHFCTFYSSYL-r............................................................................................
A0A068RLR1_9FUNG/535-804               ..............................................................................................................FAYQ......SAE...HPQHEAAKEVISTL.RA.KKS.......TDD....VQALLDRIKEQH..ST.DA.---....QEQER.....................FMQELFTQ..CML...FVGSKSFSHVL.N.VVE.R..Y.........LEV..LRCV............NSS......................................................PEARL..R...T....V.QIAAAFWK.DNT...Q...FLGIILDK.LLNYR.VI.DPA.SIITWV..FE......................................................TQQ...ADS.A.Y.R.F.Y.A..WEILQN.TMSKVVAR..............VGQVRVKLEDAEKTHKEN..........EAKra...........qeE--Snema....................................................................qaeaQQEL....DTLR.IIE.NSLNTV.C.R...E.Q.KEVFMAAY.........Q.............RSVQTLQDA...................LAPF.P..P.HERD.TQ.L----...............................................TWNYRW..IF..GW..YRESMRKYYKE--sg...........................................................................................
A0A0C2SVC1_AMAMU/529-840               ..............................................................................................................FEYD......DPS...NPYHESAQTVLNLI.RG.RAK.......AED....VIANLETLKTTL..-E.NA.DEP....INVNS.....................VVRSITVG..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LPL..LRSI...........sS-Aslsts............................................ggggsPEAKA..D...I....L.TGVASFWQ.TNR...Q...MIGIVFDK.LMQYQ.IV.DPT.DVVAWV..FSqets.............................................igeprVLG...GPS.S.I.G.T.H.E..WDLLKG.ALDKANGR..............VVIAKRKVVALRKEDDDTrg......raKATa............naM--Evdadk.................................................................peeespTVDN....PQLN.TAL.KALSTL.T.Q...E.Q.KGVLARTL.........E.............GFVAYLAPS...................PTNH.R..A.NPA-.-T.RTVITvqgwse..................................ranwgsdEWAAWE..TW..GW..YRHFCRAYSPYL-r............................................................................................
A0A1D5XWX2_WHEAT/534-880               ......................................................................................................fryhtdes----......KES...TEGHRISKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---TK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak........aikeL--Eeaksileivegqpvsser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTER...................LPPV.S..A.DGDV.PN.LRAGDpnvtfpasdpeaatmeidde......ngadnnsqvngenmkagytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0D9Z790_9ORYZ/516-862               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0Q3PEA5_AMAAE/294-574               ..............................................................................................................YKYAd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFGILKDVPNPN..QE.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEDTKARLARQ.........hKRRd............sdD--Ddddddr................................................................stdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
J3KLQ5_COCIM/532-785                   ..............................................................................................................FKYA......QET...TPYSKEGQEILQLI.RK.KAS.......DEE....IAPVIASIEEQA..KA.HG.--I....ADPSI.....................PSTDAFVT..SIC...CVGSKSLSHLL.S.SIE.R..C.........KER..LLAI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIVDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLAA...GSI.L.A.K.P.H.I..FEMISA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................TLVE....PQLS.VIQ.DALTRE.S.A...D.M.RAMFRLID.........D.............SIVPVASGTnd...............vmM---.-..E.RDDD.SA.-LAPE..............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A182Q9S1_9DIPT/521-726               ..........................................................................................................nplk----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..IDAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKDKLARTv........eS-Sss...........esE--Eeeggepnpqk........................................................rrkntetsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A182YHU0_ANOST/12-294                ...........................................................................................................dpa----......--S...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.MDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLART.........vESSs.............sESEDeaspnptkh..........................................................rkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVQK.............................................................................................
A0A094A8W6_9PEZI/534-785               ..............................................................................................................FKYN......DDD...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CID.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLDH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQA.M..E.AGIG.ET.T--DE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A1Y1W9M0_9FUNG/536-790               ...................................................................................................fkftvqamder----......---...--TRAVSVAVGVCL.KN.KGT.......ADQ....ALAILDEHYTQW..TD.VD.DA-....-ARRS.....................LAREMLVE..HVL...LLGSKTFSHML.S.AIE.R..F.........LPA..LQKF............GDT......................................................AEAKL..Q...I....A.KVTEDFWL.RNH...Q...FFAITIDK.LFNYR.VI.DPS.TIVELV..FD......................................................ASH...VGK.W.H.R.F.H.Y..WEILQN.TVNKVNIR..............IAQLQDRLEAARQPAAGD..........---...............---Dgla......................................................................gdgMVDT....EAVG.QIE.ASLAQM.V.Q...E.Q.RDVVVLAI.........Q.............RFVQLLGSE...................QG--.-..-.----.TA.S----...............................................AVDRAW..LM..GR..FKEFVRSYRYQ--va...........................................................................................
W6MLD3_9ASCO/663-881                   ..............................................................................................................FLFN......HAE...HAHQSLCYSIYENL.QG.SGS.......VED....FDALIAQLKEEI..AN.DE.-TV....ENAER.....................YVITLLGQ..SVC...IIGSRSLTVID.G.ALD.I..F.........AAK..LHRAlg.......qtvD-Semdgeneta....................................sepvseedqQIRRG..W...L....V.ESVLRLWN.HEP...R...IAYLILEK.MYQHG.FL.VKN.DIVDSL..FS......................................................--N...LII.V.R.Q.T.H.A..VELMDR.LMDEETYK..............V--FTEKL-SLKAE----..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aandkwekhmlqqllkctirkfpayq...................................................................
G3PX26_GASAC/498-780                   ..............................................................................................................YKYEd...esASS...LPGYPASITVGNAI.KN.RAT.......NEE....ILAILKEVPNPN..QE.DD.DDE...gESFNP.....................LKIDVFLQ..TLL...HLAAKSFSHSF.S.ALG.K..F.........HEI..LKAL............TER......................................................DEGKL..H...I....L.KVVYEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VQKIQQELEEAKDKLEKQq.......hkR-Qqkd........sgdeE--Dmdkn...................................................................sedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVE.IS.T----...............................................PWYKNC..IE..RL..QQVFLMHHVTI--qq...........................................................................................
A0A183E094_9BILA/122-198               ..........................................................................................................sysv---D......EEE...RSVKELVAQIENAF.RN.KAT.......PEE....LTEILQEFSRQE..GS.GA.---....----L.....................TALSTFFA..VLL...NSAKKTFSHNF.A.AMT.K..Y.........H--..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------v............................................................................................
A0A0C2G297_9BILA/1-190                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..Y.........SNT..LKTV...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESL...RSE.N.D.R.Q.W.I..WEVLNT.ALERLSRH..............IHKVAHDVKILQKRVDRQ..........KAEn.............eE-MEdg.......................................................................dakTREQ....EELE.QQQ.EKLENL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEF...................IVHC.E..T.EGTD.FR.T----...............................................PYFAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
A0A0F9Y2U7_TRIHA/533-778               ..............................................................................................................FKFN......NSD...TPFSSEGQEIGALL.KR.KAP.......DEE....FQPIIDRIEAEA..GE.RA.---....LDPVV.....................ASTDVFMT..AIC...WVGSKSLSHVL.A.CID.R..S.........KER..LLKA...........aNSS......................................................PAAQN..Q...V....L.AAVMAYWH.AHP...G...IALSIVEK.LLNYS.IL.TPA.SVVRWA..LTdgs...............................................lvdgANA...GEA.L.A.Q.P.H.I..FELVLN.TVTKVSFR..............---VRQILASPDA-----..........---...............----............................................................................----....----.-DE.EGRKSE.I.K...A.M.QDLFGLLN.........D.............LLVSWAGGN...................KDEL.M..E.MGDG.S-.-SEPE...............................................ALIRRW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
C4R1D3_KOMPG/635-804                   ..............................................................................................................FLFI......NEE...HPFMNDCIDVYDNLhQS.DVS.......VEQ....FSQIIADLKTKL..QQ.HS.AFS....INSDK.....................YIIMLLIQ..ATC...VTGGRSLSIFN.R.ALG.V..S.........KDK..IRAVfd.......tliDDK......................................................SLLNS..W...I....I.DSVLILWN.HEP...R...IGYLLIEK.LCHEK.FI.TAS.SIVDSV..FS.....................................................yESS...LPM.I.S.Q.F.Y.T..IELVNR.LFE-----..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------shgee........................................................................................
A0A0M9VU67_9HYPO/533-781               ..............................................................................................................FKFS......NPD...TPFSSAGQEIGALL.RR.KAA.......DEE....FQPVVDSVHAQA..SE.RG.---....LDPLL.....................ASTDVLVT..AVC...WVGSKSLSHAL.A.CID.R..T.........KAR..LLDA...........gSSS......................................................PTVQG..Q...I....V.TSVMTYWH.AHP...G...IALSIIDK.LVTYA.VV.TPA.AVVDWA..LNara...............................................pingTRG...GDS.L.A.Q.P.H.V..FELVSN.IVARVAGR..............---ARHAA----------..........---...............----............................................................................----....LSPD.ADD.ETRQKE.A.A...G.V.RDLLRAIN.........D.............NLDTWAAAG..................tGDDE.A..M.DGQD.EG.SMGRD...............................................ALVRRW..AQ..RW..LRVFQRATTVEE-a............................................................................................
A0A1B1E2I1_9APIC/862-1044              ...............................................................................slkknfknhavifsnyknsgvftsdeerlqf----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................---EI..E...L....L.SIVYAYFN.-NS...I...LLNAVVAI.LLENE.IV.QEL.SVMHFI..FA......................................................KLE...DSS.L.D.E.Y.Y.V..LRLIYE.SIDNLIIR..............-----KECMDVEKSKLKR..........---...............----............................................................................KQTK....NENE.MLM.KELEDK.K.N...E.LiQKVFLLTN.........-.............KTIFMLSEK...................MIKL.K..N.ENNA.YL.-----...............................................------..--..--..-------------skellkeslvflrtyadyvd.........................................................................
E4XB39_OIKDI/505-584                   .......................................................................................................xxxxxxx----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.---XNA.K.I...E.Q.KNLFLVIF.........Q.............RFIGVISEHvak............hglaVEED.E..M.MDS-.--.----Qeiav......................................qgknaIWLQCT..CE..RL..KEVFLRNES----avl..........................................................................................
A0A287NZ18_HORVV/511-857               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MSAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................SAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak........aikeL--Eeakstleivegqpvpser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKE.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTER...................LPPV.S..A.DGDV.PN.LRAGDpnvtfpvsdpeaatmeidne......ngadnnsqvdcgntkagynigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
V4AG41_LOTGI/488-760                   ..............................................................................................................YKYEq...egAGS...LPGTMKAHALMSAI.KS.KCT.......PEE....AAQILKELPSDM..SD.DN.DL-....-SFNP.....................LKIDVFVS..TLL...YLGSKSFSHSF.A.ALA.K..F.........HPL..LKSL............AET......................................................EESQI..Y...L....L.KTLYSVWK.SHQ...Q...MLVVLVDK.LLRTQ.IV.ECS.AVANWL..FS......................................................DSM...KQD.F.I.S.G.Y.L..WEIMHS.TIKKMSKQ..............VDKLQKEVDEGRDRLDAQr........rR-Aadgl.......dmdgYDED............................................................................IPTT....EMID.RME.EKLESA.I.S...Q.Q.KSLFLIIF.........Q.............RFIILLTEH...................LARC.E..S.EGID.YN.T----...............................................AWYKWV..IE..RL..QQVFLQHHTLVY-k............................................................................................
A0A183AS36_9TREM/148-288               ..................................................................................apvqeeeeipdderlahinperrpvtdl----......---...--------------.--.---.......---....------------..--.--.--S....HGVTS.....................LSVELFFS..ALF...IAGHKTISHTF.A.YIR.K..Y.........AGV..IRTI............AST......................................................VETQV..E...A....L.HVLQAVWA.NHP...Q...MIVIITEH.MCRCG.LL.DPE.AIVRWA..YS......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------pimtslteipvgfnpsaarpril......................................................................
A0A1C1X5M8_9PEZI/575-842               ..............................................................................................................FKFE......KDD...TPFAQEGRELAQLL.KR.KAS.......DED....IQPVIERIHSLA..ID.QG.---....LDPLV.....................ASTDVFTT..AVL...SIGSKSLSHVL.A.AIE.R..T.........KER..LMDA...........gATS......................................................EPARA..Q...I....I.TAVMDFWS.AHP...G...VAITIIEK.LLNYS.II.SPS.AVVQWA..LVrh..................................................agETR...GEA.L.A.R.S.H.I..YELVFN.TINKVTKR..............---MREVVASANTSAAAA..........--A..............gTEGD............................................................................GEDT....KMTS.ELE.DAKKRE.G.Q...A.A.RELFRTTQ.........D.............AVVAWASGAkd...............elMEDA.G..G.-LSD.SE.REERD...............................................RLVRRW..GD..RW..LRVVTRRAAIEE-t............................................................................................
A0C585_PARTE/471-686                   ..........................................................................................................eqls----......---...-----VAEKINSYL.QQ.KLN.......GIE....MLEQLKLITNPG..P-.--.---....----E.....................VVIQTFLE..SLL...QSISKSITHLN.V.LSK.R..Y.........LSF..LLQPn..........iIKP......................................................EKLGE..I...L....L.QTIFRMWN.HSI...F...HLKVYLKE.FLNLE.VI.SNL.QIINWV..GEi....................................................iKQK...SEA.F.K.I.Y.N.V..LIAIND.VFRKQTKL..............-DQVQDCTYENVKE----..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------intiltkmieqeqdiiiqssletiqlqiliafkstngaqsekllkevkstyikq.......................................
H0VLR0_CAVPO/459-734                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
E9HSG0_DAPPU/486-779                   ..............................................................................................................FKYQi...egGNG...FPGAAQVQTLTELL.RK.KPT.......PEE....VLELVQQLPNPL..KD.DD.GDM....EPSHN....................pLAIEVFVQ..TLL...HLGSKSFTHTF.A.GLA.K..Y.........HSV..FKNI............CEN......................................................EEAQI..C...M....L.RQVYELWQ.HHP...Q...FLGVVVDK.MLKTQ.IV.ECC.AVANWI..FS......................................................RDM...ALE.F.T.R.S.Y.I..WEVLHL.TIRKMNKH..............VVRLEKEVADARAKLRAAp.......sdS-E..............sSDEDpsreggekrrrt....................................................ssnkeatkddgeQPTE....EMVE.RME.ERLEAA.Q.S...D.Q.KNLFLIVF.........Q.............RFIMILSEH...................VVRC.D..T.DGKD.FN.T----...............................................FWYQWT..VG..RL..QQVFMAHHEQVEK.............................................................................................
A0A2K5JE12_COLAP/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1Y3B454_EURMA/459-730               ..............................................................................................etlqyclrlsyhakvl----......---...--------------.--.---.......--E....MTDILNEITDDD..DD.DD.EEN....GQHSFpmns............sallkLKIEIFVT..SLL...NVSSKSMTHTF.S.FIA.K..Y.........REV..LKKL............GQT......................................................EEAQI..W...I....L.DTIFEVWS.SHQ...Q...LMVILIDK.LMKSE.VL.PHS.TVAIWV..FS......................................................KAN...SNE.F.M.N.F.Y.M..WEILHS.TIKRTIRN..............IKKCTKELEETRTKLNTS..........NEDg............taK-MDdgtvi..................................................................tdeekTVNY....EMIE.KLE.EKLDSL.Q.S...E.Q.KNLFLIIL.........Q.............RFIMILTEH...................IQSC.E..A.DGKS.FR.N----...............................................YWYFWT..MS..RL..QEVLF--------lynqfifk.....................................................................................
A0A090CDX4_PODAN/550-796               ..............................................................................................................FKFA......NDD...TPFAAEGREIAALL.KR.KAP.......DEE....IDAVIQRIQSQA..ID.RD.---....LDALV.....................ASTDVFVT..CVL...YVGSKSLSHVL.A.AIE.R..T.........KDR..LADA...........gAAS......................................................DASRT..Q...I....I.EAVMTYWS.VHP...G...VALSIVEK.LLNYS.IL.TPL.TVINWA..LNvq..................................................agKTR...GEA.L.A.W.A.H.M..YELVFN.TVIKVTGR..............---VRQLVVKASQPDEM-..........---...............----............................................................................----....----.VDD.ETRDNE.V.R...N.M.RELFRAIE.........D.............SLGAWAGGT..................kDEML.E..S.NARG.EE.D----...............................................GLVRRW..GT..RW..LRVFKRRQAIEE-a............................................................................................
A0A0D7ACD2_9AGAR/526-861               ....................................................................................................efggdahspp----......---...APIVAAAQRVLDLL.RG.RAP.......AAD....AIAAVARAEEDL..AN.AD.VED...yADT-Keeev............tekdaFGRDIVVRdfSLL...HVGSRSFSHLL.N.AIE.R..Y.........LPL..LRSLa.........gqS-Sskdvgrdad....................................kkegdsrgsPAAKR..D...I....L.NATAAFWR.ENS...Q...LVVIVFDK.LMQYQ.VV.DPS.DVVSWV..FYashdt...........................................etattaTVA...SPG.L.T.-.G.F.A..WEVLRA.ALDKANGR..............VALARRRVAQLQKEDDERra......raR-Akdag.......eamaR--Deek.....................................................................eakhEAED....AQLA.AAL.RASAIL.T.L...E.Q.KTALARAL.........E.............GFVSFLCPE...................AT--.-..T.ATNT.AA.AVLGDdawenr...................................gswgnaEWRARE..TW..SW..YKHFCCLYAPYL-r............................................................................................
A0A182Q9S1_9DIPT/468-531               .............................................................................................................v-YYE......QAS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDALA-..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------et...........................................................................................
V2XHE6_MONRO/531-843                   ..............................................................................................................FEYD......DPA...KPHHDAAQSILNLF.RG.RAQ.......AGD....VIAHLDTLKNNL..EN.ES.SDSg.qlVNVDT.....................AMRSIAIQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LSL..LRFI............ANGgvsea............................................pgggiPEAKS..D...I....L.NAVAAFWK.NDK...L...MVNIVFDK.LMQYQ.IV.DPA.DVVKWT..FTnvs...............................................etedELK...TPL.T.L.T.A.F.E..WSLLKG.ALDKANGR..............VTIARRKLAALRKEDDET..........KARana.........gttGDMDvddvk.................................................................pvtetsGAEN....PALA.SAI.KALSIL.T.R...E.Q.KNTLSRTL.........E.............GFTNCLAPP...................LSSV.S..P.EAQA.IL.----Tekswhn..................................ranwgrdEWNFWE..TW..AW..YRHFCRTYSPYL-r............................................................................................
A0A0S6XJP0_9FUNG/556-806               ..............................................................................................................FKYA......NAS...TPYAQQGEALLTLL.RN.KSA......aDEA....VQEVSLEISSLA..TA.QG.S--....-DGAV.....................VSADAFVT..CIC...HIGSKSLSHIL.S.SIE.K..N.........RNH..LLAI...........gNAS......................................................EPARR..Q...I....I.SSVMDYWA.HHP...G...QAVNIVDK.LLNYT.IV.TPQ.SVVDWA..LSd....................................................kLDR...GRA.L.A.R.P.A.V..WEMVWA.TMSKVARR..............VG-------EIGLARAD-..........---...............----............................................................................PEMQ....ANAE.MIN.ETLVRE.R.G...V.M.QDLMRQIE.........D.............VAAGVAGGI...................QDAM.I..E.DIDD.DS.T--ER...............................................SLLQAW..GT..KW..LRVWRRKAAVEE-t............................................................................................
A0A1Y1Z7A9_9FUNG/529-775               ..............................................................................................................FKYQt....pGTD...EDLNNLVSTLVQKL.RA.KAS.......SDD....IQEILNAYVPAN..AS.EL.DE-....KAVTS.....................LKFDIVMQ..CVL...MVGSKSFSHSL.N.VIE.R..Y.........LAI..LQKY............AAS......................................................AEDKI..T...T....I.EIVASCWK.HNT...Q...FLGILLDK.LLNYR.IV.DPT.SIIAWV..FG......................................................D-L...SKT.A.D.R.A.Y.K..LEILQN.TLNKVISR..............VDLVQVKVDSAKKDE---..........---...............----............................................................................-ATP....EHIR.SLE.STLSVV.Y.R...E.Q.KEVFLAVF.........E.............KFVTVLTEK...................IVEC.E..S.SGIE.PA.S----...............................................NWLYKW..IA..GL..F------------iavgrlt......................................................................................
A0A182HEA1_AEDAL/1-208                 .............................................................................................................m----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..-KSL............AET......................................................EEAQI..C...I....L.HNVFELWV.NHQ...Q...MMVVIIDK.LLKTQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSKELSDAKERLDRN.........aE-Ss............ssE--Seeetaaagadaaat................................................pqrrrkkpigdnsdKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVK-k............................................................................................
A0A182FS60_ANOAL/1-282                 ..............................................................................................................----......--S...LPGTATAHKLVVAI.RK.KCN.......ASE....VLTELNDLPNPR..EG.SE.ADM....TESTFn...................pLKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKDKLART.........aE-Ss............ssE--Seeegggtsstp......................................................krrknadgtaeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRE.YN.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A061H137_9BASI/660-1034              ..............................................................................................................FTYA......DES...HPYHAQASRLINSI.RA.KAA.......APV....IMADFESFKASI..RP.DP.SSF....SLPDAgnddggidaqgkveseqqaeaVVRDIAIQ..AVL...FVGSRSFSHFL.N.IVE.R..Y.........HAL..LRQL............SSS......................................................PRMRI..A...I....L.CGATRFWA.RSA...Q...WVGIVIDK.LLQYR.IV.EPA.DVVDFV..FSpptdepapvllgsgd........................gvphsfsrvpavvgaGSS...QRD.W.S.S.F.N.W..WLIIRL.TLKKVNGR..............VDQLQKRLEDIEREEALEq.......erK-Eaal.........aagMDEDdstpaspqqvpaapslplfptsasl..........................pprpdlssanavtattvasttardeEKRK....ATSE.EAR.ISLEAI.Q.V...E.Q.RKVFISVL.........G.............GFNRLLKQSga...............lqMDLA.-..-.---S.TQ.EWDDA...............................................KWQSWW..IR..GW..FLELCRLFNKQ--il...........................................................................................
V9FGR1_PHYPR/604-856                   ...................................................................pdsaspasdfyqsvttklkghppasalrswlneelprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAVEVVWT..CIL...EAGVATFTHMR.L.LLE.K..Y.........GKR..NELFgge.....dqsaEET......................................................EADEL..V...V....V.KTVASVWL.KSP...Q...HIGLILNS.MLRQG.LL.RPL.TIVTWV..FT......................................................ADA...VQQ.Y.S.W.P.Y.V..WEILND.TLKFVQDA..............IGAKTKQLEQASTPR---..........-SS...............DDRD............................................................................NEEM....PDVA.ALE.DSRKRL.Q.D...E.L.RQLLVLLF.........R.............GFDRVITEH...................KAEC.D..S.EGSD.PR.D----...............................................NWFRSA..LA..QM..QAVGHR-------yrvp.........................................................................................
J9EBN4_WUCBA/332-503                   .........................................................................................................qeeke----......---...-----LVAEIERAF.RN.KAE.......PKE....ITEMLREFDKEG..NS.L-.---....-----.....................ATLSTFFS..VML...NAAQKSFSHNF.A.ALT.R..Y.........HET..LKEL...........sGID......................................................DESST..A...L....L.RTLYDVWK.HNR...Q...MMVVLITK.MLRMT.LL.NAN.AVVSWL..LS......................................................SYV...GQE.L.H.R.F.W.L..WEALFI.IVKHVCGH..............MNRCKIKLQQMQEKRARM..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------erssgn.......................................................................................
W9CCH7_9HELO/603-851                   ..............................................................................................................FKFN......DPN...TPFSAEGQEILGLI.RR.KVS.......EDE....IQPVIDKIHALA..VE.QA.--L....PDPLV.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KDR..LLAI...........dPAS......................................................PVARR..Q...I....I.TSVMEYWK.DQP...G...IGVNIIDK.LLNYT.IL.SPQ.SVVQWA..LG......................................................S-E...GKK.L.S.Q.S.F.V..YEMVGA.TVGKVTGR..............IRQLQL-------STRVP..........---...............----............................................................................GLLA....EQKD.LIN.QTVEVE.R.M...N.M.RELATEMD.........E.............LLSSWATGTk.................dQEME.E..G.DGTS.G-.---GE...............................................ELVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
A0A1D2VCP4_9ASCO/768-1023              ........................................................................................ikdlietkvknyesineeeqvi----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................--RSV..W...A....L.EAVFRCWN.ELP...L...SCFVLIDF.LRKFK.LI.SYK.SIIKFL..FKd....................................................sN--...--K.A.E.E.E.Y.R..CNLIMN.FLASDKLY..............--YMLNHIKKLKIEESNPlfkf.vflefL--...............---Nllkntievlgikekieype.....................................epdipppiqnikpaiveeeiEQEE....GEEI.EQE.EGEKIE.Q.E...E.E.EETKQEKE.........D.............KDIEIKNDK...................NSQG.D..K.--RM.EG.EKLSEniivdkdeevf........................fdekfsseeydlRWKYHT..IM..GL..FKTIIRNYSNN--lv...........................................................................................
A0A093T3B9_PHACA/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A183E8Y0_9BILA/2-111                 ..........................................................................................ecdendteetkdmepvikes----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............---Elavlqdc..............................................................lknllldVLHK....PEDN.DKR.NLLELA.F.S...S.E.THLFLGIF.........Q.............KFTVTLTEH...................IVNS.E..S.AEKD.FH.N----...............................................YWYVYV..TG..RF..KNTFLKYW-----rdlfe........................................................................................
A0A178ZB25_9EURO/542-794               ..............................................................................................................FKYN......DES...TPFAAEGKEIAQMI.RR.KAT.......SEE....FDSILEKIEQEA..AA.SG.--L....SDPSL.....................ASTDVFVT..SIC...WVGSKSLSHAL.A.CIE.R..C.........KER..LLAI...........sASS......................................................SACRK..Q...I....I.TSVVDYWR.DQR...G...VGVILVDK.LLNYQ.IL.TPE.SVVEWA..LId....................................................hVSR...GTL.L.A.T.T.W.C..YELVSN.TTRKVAGR..............---VRSIVAAVRSP----..........---...............----............................................................................GIPE....GQRL.ELQ.QTLTRE.L.E...G.M.KSLFAMIE.........D.............AVLSIRDGN...................QDEM.-..M.ESSD.AL.RAEEE...............................................ELLKAW..GG..RW..ARVFQRKYAVEE-s............................................................................................
W6YSZ7_COCMI/564-817                   ..............................................................................................................FKYD......NPD...TPYAVEGQTLLNQL.RK.KAT.......AEE....VQVTIDSIHEKA..VA.QG.V--....GEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................ETARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPQ....EQIE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............STRGVAEGS..................aDTML.E..K.SSSG.AL.TEEEV...............................................ELIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A2K5KP79_CERAT/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
U6GML4_EIMAC/790-1033                  ...............................................aaaepaaateaaaepaeaaaaaaardesieednegegrqgavaalhaleqcstdtegapwspd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................DIIKLFVF..CLL...SLGSKTQTHLH.R.ALS.N..Y.........AQA..FTFY............AAQseqtpeeqq...................................qqqqqqlvqqVDIHP..A...V....L.QAIQKYWT.TSQ...Q...RTALTLHA.FLKVG.IL.KRG.RVLQLL..CSa....................................................dPEE...RDS.W.S.Y.L.E.Y..IETVFRgAVDECETA..............REAAAESGAAMPRGT---..........---...............EAEE...........................................................................vGEKE....EKDS.RVE.NLLTVI.E.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------qvqrhyfwrsf..................................................................................
W9XJL5_9EURO/548-800                   ..............................................................................................................FKYN......DES...TPFSAEGQQLAQMI.RR.KAS.......NEE....FTPVFEKIEQDA..AA.SG.--L....TDPAL.....................ASTDAFVT..SIC...WIGSKSLSHAL.A.CIE.R..C.........KER..LMAI...........sSAS......................................................SACRK..Q...I....I.TSVMDYWK.DQT...G...VGVVILDK.LLNYQ.IL.TPA.TVLEWA..LId....................................................hVAR...GTL.L.A.K.T.W.C..YELVSL.TTRKVAGR..............---VRSIVGAIRQP----..........---...............----............................................................................GLAD....DRKD.ELQ.QALAHE.M.E...T.M.KNLFSIIE.........D.............AVGSIRDGN...................QDEM.-..M.ESSD.AL.RAEEE...............................................DLLKAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
A1CM21_ASPCL/541-794                   ..............................................................................................................FKYS......SDT...TPYATEGREIMQLI.RK.KAG.......DEE....IRPLIDAIEEQA..KA.LG.VD-....-EPML.....................PSTDALVT..SIC...YVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.II.TPL.SVVEWA..LVe....................................................kMEA...GVI.L.S.K.T.H.I..FEMVSA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLGRE.K.A...D.M.QALFRVIE.........D.............SIVSVAGGSnd...............elMERG.D..G.SGNL.PE.D----...............................................EIIRQW..SR..RW..LRVFRRKAGVEE-s............................................................................................
V8NB45_OPHHA/410-682                   ..............................................................................................................YKYGe...esNQS...LPGYNVALCLNIAI.KN.KVS.......NDD....IFTILKDVPNPN..QD.ND.DEG....FSFNP.....................LKIDVFVQ..ALL...HLASKSFSHSF.S.ALG.K..F.........REI..LKTL............AES......................................................DEGKL..H...I....L.RVMYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VMMIQKELEEAKERLAKQ.........rKRRd............dvR--Sne.......................................................................rgnWPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LARS.E..A.GGID.VI.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0F8BJB3_CERFI/535-804               ..............................................................................................................FKFN......DPE...TLFSAEGIDMAALL.RR.KAD.......DEA....FQPIFDKIQTAA..LD.MG.---....TDPLV.....................ASVDVLMT..SVC...WVGSKSLSHGI.A.CIE.R..V.........KAK..LTEF...........aSAS......................................................EAARC..Q...L....I.TSIAQYWT.YHP...G...TVVALIDR.LLNIA.VL.TPT.AVVEWA..LTgags..............................................lvcdGPT...STV.L.S.R.A.L.V..FEIVVN.TVNRVILR..............---LHQPLEASELKPTPEtld....nlfK-Aiy...........dgV--Dkiqadptadeegvaape..........................................twkarwmrvfkrkeivqK---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------alaaekklakeikekeeeelareaqadieataaaeqd........................................................
A6R994_AJECN/500-752                   ..............................................................................................................FKYA......LES...TPYAAEAQEIMQLI.RK.KAP.......DAE....IEPHILAIQNAA..AN.Q-.TDT....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLSYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIEG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVVARVQR----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...E.V.QVMFEVIE.........G.............ALEGVISGS..................gMEDV.G..G.VLVG.EG.E---K...............................................VIIREW..AQ..RW..LRVFKRLRAVEE-m............................................................................................
L5KQH9_PTEAL/808-1083                  ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFMQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEMLHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.EGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0D2PP43_9AGAR/538-857               ..............................................................................................................FEYD......DPA...NLHHDAAQAVLNLF.RG.RAK.......AED....VIAHLDSLKSTL..ET.SE.EGH....VNVDS.....................TIRSIVVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LVL..LRNL............ASGgsssv............................................ggtgnPEAKI..D...V....L.TAAASFWK.DNR...Q...MVAIVFDK.LMQYQ.IV.DPT.DVVGWT..FMngvg.............................................vgqlaELG...GPM.N.L.S.A.F.E..WDLLKG.ALDKANGR..............VTIARRKVATLRKEDDDA..........QARvka........rddtM--Evdaepkdie..........................................................aepkddaapVVEN....VALS.TAL.KAFSSL.T.R...E.Q.KAALSRTL.........E.............GFVACLAPS...................D--T.D..A.HANP.HA.RTVITeaawen..................................ranwgrdEWNAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
A0A2I3RA69_PANTR/485-760               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1U8N6C8_GOSHI/485-831               .............................................................................................................f-KYSga.ddqEKT...EQEQALSSELSNKV.KG.RQT.......ARE....IILWIEETVYTI..HG.Q-.---....----E.....................ITLSVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..MAKL............CAD......................................................QDKQV..M...L....I.SEVGSYWK.NNA...Q...MTAITIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IEQ.F.H.I.SdR.P..WEVLRN.AVSKTYNR..............ITDLRKEISSLKKSVVSAe........eA-Ask...........akA--Dleaaeskltlvegepvlge......................................nptklkhlksvagktkeetVSMH....DSLE.AKE.ALFARA.L.D...E.N.EVLFLSLY.........K.............NFSNVLMERlpda..........srdgtL---.-..-.----.--.-----...............................................------..--..--..-------------qslksvngdsmavdieepstmevddenerpkksqsnggkttngynvrekeqwclstlgyvkafsrqyasei......................
A0A0V0W4J6_9BILA/495-772               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FSekmrgnl.......................................msvqksveCEF...CNF.Y.I.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A1Y1ITB5_KLENI/213-427               ..........................................................................................................eaag----......---...-----LAQQLTALV.RD.KKS.......SKE....VSAWLDGAVLPG..AG.LG.---....-----.....................GALALVAP..TLL...AIGAKTLTHMV.T.MLE.R..Y.........QPL..LARL............APD......................................................HSAQA..H...L....V.ALAADFWA.AFP...Q...MACICIDR.LMAFR.LV.SNL.AIADWA..FS......................................................PPL...LPTlH.T.S.D.L.A..WEVVGR.ALAQTGHR..............AADLAASLADAHSTAAAAq........eE--...............---Aarlasav.............................................................gleaegaaQ---....----.RAQ.EAAAAA.E.E...A.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------tqvkaalharavqeqev............................................................................
A0A0N4T883_BRUPA/218-330               ..............................................................................................................YDLN......DDE...HPDRDFAIVLEKAF.RE.KIS.......ADG....MIDLLRNQSENQ..MD.IN.---....-----.....................FRLSIFFK..VLL...YLARKTFSHNF.V.ALT.R..Y.........YST..LKEL...........iGGR......................................................EDVQL..T...I....L.RTLYETWK.LHG...Q...VYFLV---.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------kfav.........................................................................................
F0UQX4_AJEC8/556-808                   ..............................................................................................................FKYA......LES...TPYAAEAQEIMQLI.RK.KAP.......DAE....IEPHILAIQHAA..AN.Q-.TDT....ADSLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLSYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIEG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVVARVQR----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...E.V.QVMFEVIE.........G.............ALEGVISGS..................gMEDV.D..G.GWVG.EG.E---K...............................................VIIREW..AR..RW..LRVFKRLRAVEE-m............................................................................................
A7AR12_BABBO/737-959                   ................................................................................tnlfaedkmpdvemvddkdgqptvktwsrd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................ELILIFWE..SVL...LFGNKSLTHLL.R.LIE.F..H.........GEV..LKNFi..........sE-Eqng................................................afeDSISF..K...I....M.VLTRETLK.TDT...K...KFELVIDN.LIREG.IL.PPA.DVCRYV..FR......................................................GYP...STE.F.F.S.N.H.A..FCLMQN.AFAFVRGN..............IESVKARMANEAIH----..........---...............----............................................................................----....--NE.TLQ.TTLQSR.R.H...I.M.CNLTKLVM.........E.............LTNN-----...................----.-..-.----.--.-----...............................................------..--..--..-------------ilmqgvdrqqecvlssivrrllltrecdaemlla...........................................................
A0A100IH77_ASPNG/557-810               ..............................................................................................................FKYS......SDS...TPYANEGREIMQLV.RK.KAS.......DEE....IQPFINAIEEQA..RS.LG.V--....EDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................AQARR..Q...I....I.TSVMEYWV.DQP...G...VGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.V...D.M.QSLFKVIE.........D.............SIVSVAGGSnd...............eqMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
A0A1Z5TEM8_HORWE/556-806               ..............................................................................................................FKYA......EDS...MPFAKEGREVLGLL.KK.KAP.......ESE....IQPVLDVVHSEA..VN.HG.---....VEPLI.....................ATADVYTT..AIC...SIGSKSLSHAL.S.TID.R..C.........RER..LLAL...........gPQS......................................................EAARR..Q...I....I.SSVFEFWS.EHP...G...TAVNIVDK.LLNYT.IV.TPM.SVILWA..LQd....................................................rMDR...GRA.L.A.K.S.E.T..YELISI.TMNKVTTR..............---VRQIL----RERDNF..........---...............----............................................................................ALDF....SQRQ.AID.EALPRE.R.E...S.M.RNLFAAIE.........D.............AVAGVAEGA...................QDEM.-..-.IERF.DG.EELEQ...............................................TMIQGW..GQ..RW..AKVWRRKAIVE--eg...........................................................................................
H6BYI9_EXODN/537-789                   ..............................................................................................................FKYN......DES...TPFSAEGKEIAQMI.RR.KAG.......NEE....FTTIFEKIEQDA..AS.SG.--L....TEPAL.....................ASADAFVT..SIC...WVGSKSLSHVL.A.CIE.R..C.........KER..LMAI...........sTSS......................................................PTCRK..Q...I....I.TSVMDYWK.DQT...G...VGIAILDK.LLNYQ.IL.TPA.SVLEWA..LId....................................................hVAR...GTL.L.A.K.T.W.C..YELVNN.TTRKVAGR..............---VRSIVGAIRQP----..........---...............----............................................................................GLGE....EQKA.ELQ.QALSRE.L.E...T.M.KTLFGIIE.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEDE...............................................ALIRAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
A0A165I6S9_9APHY/533-832               ..............................................................................................................FDYD......DPA...RPYHEAAQSVLNLL.RG.RAK.......AED....VIGHLDSLRNTI..SE.TA.EGD....VVVES.....................VVRKIAVE..CLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNLa.........pgGAN......................................................TEARM..D...I....L.NAVYSFWN.RSR...N...MVVIVFDK.LMQYQ.IV.DPT.DVVSWA..FIhs..................................................gsGTE...GNP.S.F.D.A.F.Q..WDVLKG.ALDKANGR..............VTIARRKVTALRKEEDDNa.......arA-Kasd.........satM--Eadaegk................................................................qanvipAAES....PALT.TAL.KAFTTL.T.R...E.Q.KAALARTL.........D.............GFVGYLAAEdkp.............nprA---.-..-.----.--.QEVITekawhn..................................ranwdetDWETWE..TW..CW..FRHFCRTYSPYL-r............................................................................................
A0A1A8W0Y8_9APIC/884-1102              .............................................................................................fkndflpnsecwnsysi----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--LVLFFK..TLI...FFDSSNVSSLK.K.VFK.Y..H.........AVI..FRNY............KNSgfl...............................................ksedDKYQFdvE...M....V.NIVYSHF-.NNS...V...LLNVVINI.LVENE.II.DEV.AVIHFI..FH......................................................KLE...DSN.L.D.E.Y.Y.V..LRLLYE.SIDNLITR..............-----KECTDLEKSKLKR..........---...............----............................................................................QQTK....NENE.ELI.KKLEDK.K.N...E.L.IQKIFNLT.........N.............KIVFMLGNK...................MMQL.K..N.ENKS.YM.S----...............................................KELLKE..TL..VF..LRTYL--------eyidid.......................................................................................
A0A2H3H679_FUSOX/531-776               ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AA-------..........---...............----............................................................................----....--PE.TDE.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
NCBP1_AEDAE/488-783                    ..............................................................................................................YKYTm...egAAS...LPGTATAHKLVVAI.RQ.KCT.......PED....VLNELKDLPNPR..ET.SE.NDM....VESTFn...................pLKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HLV..FKTL............AET......................................................EEAQI..C...I....L.HNVFELWV.NHQ...Q...MMVVIIDK.LLKTQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSKELSDAKERLDRN..........AESs............ssE--Seeetapagtdavt.................................................pqrrrkkpigdnadKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVK-k............................................................................................
G1PRS5_MYOLU/474-749                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......SDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.I.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELDEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.GKGESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A182RSG4_ANOFN/1-236                 ........................................................................................................memaee----......---...--------------.--.---.......---....------------..--.--.---....-PFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HTV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWA.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLART.........vESSs.............sESEDeaspnpqkh..........................................................rkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRE.YD.T----...............................................DWYRWT..VG..RL..QQVFMM-------ml...........................................................................................
A0A1V6N7F5_9EURO/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gAES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sIAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLT.VID.ETLARE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGSnd...............eqMERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A093RI00_PYGAD/462-742               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2G3BCC5_CAPCH/485-827               ..............................................................................................fkysaeegtdpteral----......---...------SLELKDMV.KG.RKT.......ARE....IISWVEENVFPT..HG.F-.---....----D.....................ITLGVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........AQV..IAKM............CTD......................................................DDQQV..K...L....I.TEVSSFWQ.NNV...Q...MTAIAIDR.MMSYR.LI.SNL.AIVRWV..FS.....................................................pLNL...DRF.H.V.S.D.S.P..WEILRN.AVSKTYNR..............ISDLRKEISSLERSVVLAe.......gaA-Srar.........qelE--Saesklsivdgepvlge...........................................npvrikrltsyaekakeE--EvsirESLE.AKE.ALLARA.V.D...E.I.EALFLSLY.........K.............SFVTALAEP...................LHDA.S..R.DGTL.RP.SGDADdmtidledssvmeldkdde.........rpkkshpngsrerngynldEKQQWCltTL..GY..LKAFTRQYASE--i............................................................................................
G4UD99_NEUT9/533-786                   ..............................................................................................................FKFA......DDK...TPFAAEGKEIAALL.RR.KAP.......EEE....IEPVIERIHSLA..LD.NN.---....LDPLV.....................ASTDVFVT..SVL...HVGSKSLSHVL.A.AIE.R..T.........KER..LTDA...........gATS......................................................EAART..Q...I....I.SSVMEYWS.AHP...G...VAIAIIEK.LLNYS.IL.TPQ.AVINWA..ITty..................................................agATR...GEA.L.A.K.G.F.V..YEMVFN.TVVKVTSR..............---LRQVLQK--------..........---...............----............................................................................-ATL....PEAM.IDD.ETIEAE.I.N...G.M.RSLFRAIE.........D.............ALFAWASGSkd...............emLEAS.D..G.LGEG.DG.TSETE...............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
A4RZY8_OSTLU/213-445                   ......................................................................................................galkemla----......---...--------------.--.--S.......KKE....GHEVLGWIQSQA..AS.A-.---....-SPDV.....................LLRALAVA..TLE...R-GQKCITHHD.V.LLK.R..Y.........ALP..IRDL............VEK......................................................AGGEV..-...L....V.DAAAGVWR.GHP...Q...MGPIAIER.LLALD.LV.TPA.AVVNWL..LQraa................................................afgEDD...TYE.I.A.N.-.V.V..CEFVCA.SKEQAIGK..............REALLRKLREAEAEAAAA.........gQAAt............elT--Eqgrvfea..............................................................qqaqaaeASAV....EE--.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------isiheaalasadapvdrcaaitreiclnlcgglvkaasggas...................................................
A0A2H3T545_FUSOX/531-776               ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AA-------..........---...............----............................................................................----....--PE.TDE.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
A0A2G9H3Y7_9LAMI/485-826               ...............................................................................................ftynaedgdqtergl----......---...------SSELNGMV.KE.RST.......TRE....IISWIEDHVLPA..--.HG.---....---LD.....................VTLRVVVQ..TLL...SIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CPD......................................................QDKQV..M...L....I.SEVSSFWK.NNA...Q...MTAITIDR.MMGYR.LI.ANV.AIVRWV..FS......................................................SSN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTFNR..............IVDLRKELSSLKKSVVLAae.....tasKAQ...............--ADledaqskltltlvdgepvla....................................ensakmrrlksnaekakgeeVSTR....ESLE.AKE.ALLARA.V.D...E.I.EALILFLY.........K.............SFSNVLAEP...................LRDT.D..G.SLRQ.SG.EADEMavdhedtstmeldkeggr...........sqqshsngdrtvngynvgEKEQWC..LStlGY..VKAFTRQYASE--i............................................................................................
Q4UGZ6_THEAN/708-949                   .......................................................................................................vlnsqvt----......---...------------SM.ET.TNL.......QED....MNTNLTNTKSAS.lMS.DE.NAE....VWKRD.....................DLIMLFWD..TLL...IFGSKSMTHLY.R.LLD.F..H.........SDV..LKMFetv......elpFE-......................................................ESLPY..K...V....MwQTVMT-FE.RDH...K...RLELSFDF.FIRNN.VF.TCP.VILQFL..FT......................................................LPD...N-V.L.L.S.N.F.F..FYAVNS.VFSEVNSR..............LVNFRENYKVALRELAGTv.......amEAK..............kQELDaveldyf..............................................................nffdhfvH---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lvsdrlsssepklakvmeeilvrklvkysfqeklnlklynsv...................................................
A0A135TKZ0_9PEZI/539-785               ..............................................................................................................FKFS......DES...TPFSAEGREIAALL.RR.KVP.......DEE....FQPIIERIHSLA..IE.RS.---....LDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EAAKS..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.SVIEWA..LSggs...............................................hvqgQSS...GDS.L.A.Q.P.H.V..FELVFG.TVSKVTGR..............---VRQLLTKEA------..........---...............----............................................................................----....---E.ADE.DLKERD.T.K...A.M.RDLFKAME.........D.............ALVSWASGS...................KDEM.M..E.EMD-.-G.AGQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A091CMF8_FUKDA/413-542               .............................................................................................................a----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.L.A.K.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0N5CYW2_THECL/527-792               ..............................................................................................................YDLN......DEE...HPDHDFAATLEKAF.RD.KIP.......AEE....MNDLLRDATVNN..MD.IS.---....-----.....................SKMSIFLK..VLL...FLARKTFSHNF.A.ALT.R..Y.........YLT..LKEF...........iGNR......................................................EDVQL..N...I....L.RSLYETWK.FHK...Q...MITVLVTK.LLKMS.IV.DAS.SVVAWV..FS......................................................DEI...KPE.F.E.R.L.W.V..WEVLSR.ALEHVSGH..............VRRSKAALVNMKLRRKWKg.......qnR-Ded...........fvM--Etde.....................................................................qsmvHLNA....TEVP.VKE.NEIEVL.D.E...C.L.KNLLLDVL.........H.............KFTVTLTEH...................IINC.E..N.NGTN.FE.T----...............................................SWYLYV..TG..RF..KNVFLKHWND---lf...........................................................................................
W9XQM4_9EURO/539-791                   ..............................................................................................................FKYN......DES...TPFAAEGKEIAQLI.RR.KAG.......NEE....FTPIFEKIEQDA..TA.SG.--L....SDPAH.....................ASTDAYVT..SIC...WVGSKSLSHVL.A.CIE.R..C.........QER..LLAL...........sSTS......................................................PTCRK..Q...I....I.TSVMDYWK.DQT...G...VGVVILDK.LLNYQ.IL.TPA.SILEWV..LId....................................................nVAR...GTL.L.A.K.T.W.S..YELVSH.TTSKVAGR..............---VRSIVGAIRQP----..........---...............----............................................................................GLPG....EQQG.ELQ.QALARE.L.E...T.M.KNLFSIIQ.........D.............AAVSIRDGN...................QDEM.-..M.ESSD.AL.RAQEE...............................................DLLKAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
I4YFG6_WALMC/517-808                   ..............................................................................................................FIYA......NEE...NPFNGIAMNMMDAL.KN.RAT.......SDQ....LTAQFDKIEDEI..KV.NA.SLP....LNDVSa..................kkVSRDIISQ..CLL...NVGSRSFSHFL.N.VIE.K..Y.........MEI..LKKF............YQE......................................................KEDRI..D...L....L.RSVDRFWI.KNS...Q...MKKIIVDK.LLQYR.LL.DPT.DVINWL..FKpndetf..........................................pneiddRNP...AIA.W.S.D.I.N.F..GELLKT.TLNKVNSR..............VYQQGLKLAENKKKDEEEas......iaKAK..............sMQVDdega....................................................................mtvkNEEN....KDNS.HSQ.ITYDNL.K.K...E.Q.RECFVILI.........K.............SFVEALEGV...................DSIA.D..L.SIEE.YS.N---S...............................................DWDKWL..SW..SW..YQAFLREYWPS--is...........................................................................................
A0A067QQW6_9HOMO/541-846               ..............................................................................................................YEYD......DPL...RPYHDSAQSVLNLL.RG.RAK.......PED....VIALLDTIKNTL..SE.TS.DGD....VNIDS.....................VIRSIAVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRSL...........aAPG......................................................DEARL..D...I....L.TACSIFWK.RNR...Q...MIAIVFDK.LMQYQ.IV.NPT.DVVGWT..FNygvg..............................................nergSSS...GPL.S.L.N.A.H.D..WDLLKG.ALDKANGR..............VVVARRRVTALRKEEDDT..........RARvras......dgadvT--Smevdad................................................................anqddpTVDS....PALT.SAL.KAFASL.T.R...E.Q.KAALSRTL.........T.............GFIDCLAPL...................ASDR.H..A.NPAS.RD.-VVQEkkwhnr...................................anwgqdEWNAWE..TW..GW..YRHFCRAYAPYL-r............................................................................................
A0A2I3MJE3_PAPAN/399-674               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2I2YF43_GORGO/484-759               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1V6YZX3_PENNA/531-784               ..............................................................................................................FKYS......SEM...APYSKQGQELMQLI.RK.KAS.......DEE....IQSVITAIEDQA..KS.QG.VE-....-EPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTES......................................................QRARC..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.I..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLS.VIH.ETLVRE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGSnd...............qqMERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A1E5VRZ3_9POAL/392-747               ......................................................................................................fkflsdes----......SEN...TDGHKLSKELVGMI.RG.KKH.......LRD....IILWVEE---QI..IP.TN.---....--GAE.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...LTAIAIDR.MMGYR.LI.SNL.AIVKWV..FSpanv.............................................eqfhvSDR...PWE.V.H.S.F.V.L..AFILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQGAk.......kvSANai...........keL--Eeaqsvleivegqpapaek........................................pgrlrrlqayadkakheeVTME....ESLE.AKG.ALLARA.L.E...E.S.KDLLKLLF.........K.............RFVDVLTERlppvsadg...eipnlragD---.-..-.----.--.----Qnvnfaggdhesatmeidnen.......gadknsepngqntkngynigELEQWClcTL..GY..LKSFSRQYATE--vs...........................................................................................
H0GL41_SACCK/578-825                   .............................................................................................................l-YFR......QEG...VPMENTVRKILDYT.HK.ANN.......SRE....VTELESILGELK..NE.YG.SII....SDFNR.....................FVIILLVQ..AVT...DSGSRSLSHAN.K.YIN.D..L.........KED..LKTI............FAKie.................................................ldiETKEY..I...I....I.EAVLTFWN.ANP...Q...TGFLVADA.FKYAG.LL.TSR.TIFTFI..FNe....................................................tGLK...NNG.L.I.E.A.T.A..IEAVFR.NLSQQISE..............------------------..........---...............----............................................................................----....----.---.------.E.N...E.S.GNNFEFVF.........E.............RLCTIANST...................IDLL.D..V.NADE.DI.E-IPKvngemdid..............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
A0A2B7WGA8_9EURO/541-793               ..............................................................................................................FKYA......VET...TPYAPEAREIMNLI.RK.KAP.......DTE....IAPHIAAIEQQA..SA.HG.V--....ADPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLAI...........gPQS......................................................PAARR..Q...I....I.TSVLEYWI.HQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hLDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVCTR..............---IRQIV----AARVQP..........---...............----............................................................................GLVE....PQLS.VIE.ETLQRE.R.A...D.V.AAMFEVIE.........D.............ALVSVAGGTgd...............gvMEFS.E..E.RVRE.EG.-----...............................................GVIREW..GN..RW..ARVFRRMRAVEE-a............................................................................................
A0A0L1HPT4_9PLEO/1067-1320             ..............................................................................................................FKYD......NQD...TPYAAEGQTLLNQL.RK.KAT.......PEE....VQVTIDSIHEKA..LA.QG.V--....AEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................EIARR..Q...I....V.ASVIEYWR.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPQ....EQIE.MVE.ATLAKD.R.E...N.A.RELFKYIE.........D.............SMHGVAEGSa................dtLVEK.S..T.SGAL.--.TEE-E..............................................vQLIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A0C3C356_9HOMO/541-856               ..............................................................................................................FEYE......EPT...SPHHDAAQSVLNLL.RG.RSK.......ADE....VIAHLDSLKNTI..ES.SD.G-S....VNVDA.....................IVRSIAVQ..SLL...NIGARSFSHLL.N.AIE.R..Y.........LPL..LRSL............ASGgiagt............................................saggsAEAKG..D...I....L.TAAAAFWK.RNK...Q...MVNIVFDK.LMQYQ.IV.DPT.DVVAWT..FTnaag..............................................dghlSGT...GPL.S.L.S.A.F.E..WDLLKG.ALDKANGR..............VMIARRKVAALRKEEDDNr........aKAKarg........gvdvSSMEvdgdak................................................................peddspAVES....PALV.TAL.KAFASL.T.R...E.Q.KAALSRTL.........D.............GFVSCLAPS...................PS--.D..L.NPNP.HA.SIVITekawhn..................................ranwsgdEWNTWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
A0A179V4R3_BLAGS/559-818               ..............................................................................................................FKYA......LET...TPFATEAQEIMQLI.RK.KAP.......ETE....IEPHILAIQHAA..AS.QP.D-I....ADPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLAI...........gPKS......................................................PAARR..Q...I....I.TSVLSYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVVEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQA----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...D.V.QVMFEVIE.........G.............ALEGVINGS...................NESG.S..G.SGSG.ME.-DVGEgvv.........................................eekGLIREW..AR..RW..LRVFKRLRAVEE-a............................................................................................
A0A151NE25_ALLMI/484-764               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...THD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIQKELEETKARLARQ.........hKRRd.............sD--Dddyddd...............................................................rssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VV.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0C3B106_9HOMO/529-820               ..............................................................................................................FEYE......SSS...NSYYTAAETLQKKM.KE.KTAp.....sLAE....TSVYVDTIRTDL..IS.SG.LSD....SHAAS.....................RTRSITMQ..CLL...VLGSRSFSHFL.N.AIE.R..Y.........ISI..LHTL............SNT......................................................TDAKF..E...M....L.EIVSTFWR.RNR...Q...MILIVFDK.LMQYQ.VV.DPS.DVVSWA..FEgg..................................................glGEK...GDG.L.S.-.T.F.Q..WELMRI.ALDKSNGR..............VSIAQRRVINQRKIDEEAma......raKAKea...........gnE--Gmdvddi...............................................................aavpdgpVEES....ADMQ.KQT.RAHQIL.V.T...E.Q.KAVLSRSV.........D.............KFVTVLGLTd................eyLSED.A..W.NNRS.SW.----Tr.............................................aQWDAIE..TW..GW..FRHFTRNYAPHL-r............................................................................................
A0A0V1PAT1_9BILA/657-777               ..........................................................................................................yfyi----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
E6R1F1_CRYGW/587-885                   .............................................................................................................w-AYG......KDD...HPLHAEAAALLSQI.RQ.KLP.......STE....IIKYITEMPNAS..SG.P-.GEP....LYP--.....................AVRQMAFE..TIS...HLGSRSFSHFL.N.ATE.R..Y.........SDV..LRFL............TPD......................................................FASRR..I...L....L.DAVKSYWR.RSS...E...MRLVTLDK.YLQYG.IL.EGI.DIVEWI..FAdd.................................................eaeGEE...GDG.W.T.D.G.D.K..WEVLSM.CLEKHLGR..............VKAISRRLKVIEREDEAA.........rA-Rkag........eqleR--Gedvnved..............................................................dtnedprPETS....KEAR.DAQ.TSLDIQ.S.T...R.L.EKVLLATF.........K.............HFIFALLPW...................TAEK.E..E.VIST.SN.----Eglkgvlt................................lldsdeegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
A0A182T382_9DIPT/1-281                 ..............................................................................................................----......--S...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.MDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLART.........vESSs.............sESEDeaspnpqkq.........................................................rkkaegsgqeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A1X2I935_9FUNG/533-805               ..............................................................................................................FSYG......SAE...HPLNASAKKVVEAL.RT.KKS.......VEE....VHEVLNSIKQEL..AS.LG.YDE....AAHTS.....................TIQDLFVQ..CLL...LVGCKSFSHVL.N.VVE.R..Y.........LEV..MRHL............NGT......................................................HEDKL..R...T....V.QTVASFWQ.NNT...Q...FLCILLDK.LLNYR.IV.DPT.SVIAWV..FE......................................................PEQ...LDN.V.G.R.S.Y.V..WEILKN.TLNKVVSR..............ASQIKSRLESFRQQHADNe........iKRSaqp.........ateM--Sqa........................................................................esQQEL....DTIQ.IAE.NSLTTV.A.R...E.Q.KEVFMVMY.........Q.............RFTQVLQSL...................LVSL.S..A.QGRN.PD.Q----...............................................DWTYWW..VH..GW..LKEVLRLYHDEC-a............................................................................................
W5PNL6_SHEEP/487-762                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQTI--hq...........................................................................................
A0A183WZJ3_TRIRE/1-167                 .............lpsariflrlidsirsrldpqtilkiaqsarnirkqrslselnddgdaeekeggyessdsnsnssssepirsdeerrgkspiddillldpefddlde----......---...--------------.--.---.......---....------------..--.--.---....-----.....................NEPELFYS..ALL...IAGYKTISHTF.A.FIR.K..Y.........AAV..IRTL............TSS......................................................VETQV..E...A....L.HVIQAVWA.NHP...Q...MIVIITEH.M----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------xxx..........................................................................................
A0A0V0W484_9BILA/495-757               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A0A2VE17_BEABA/534-788               ..............................................................................................................FKYK......NPD...TPFSAEGQEIGALL.RR.KAT.......DEE....IQPTIDAIQAQA..KE.RA.---....LDPVV.....................TSTDVFVT..AMC...WVGSKSLSHVL.A.CID.R..S.........KVR..LLDA...........gAAS......................................................PAARS..Q...I....I.SSVMAYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.SVADWA..ILads...............................................ashkGSP...GAA.L.A.Q.P.H.I..YEAIFN.TVSKVTAR..............---VRQLVTAAAPS----..........---...............----............................................................................-NSE....AAAV.DEE.ETRAKE.V.A...D.M.TELFRTIN.........D.............ALEAWAGGS...................KDEL.M..Q.QDGA.SE.--TDD...............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
NCBP1_DROPS/488-770                    ..............................................................................................................FKYAs...eeAAS...LPGTAVAHQLVVAI.RQ.KCS.......PEE....VVNILKEIPNSG..YS.GE.EMS...dGTFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...V....L.HNIYELWS.SHQ...Q...MMVVLVDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TSE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSVAKDKLSKA..........DSSs............seS--Dedaptkr.............................................................kkpithadKPSE....EAVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................MLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0P0VXC6_ORYSJ/66-412                ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
J4GS84_9APHY/535-843                   ..............................................................................................................YDYD......DPT...RPYHDAAQSVLNLL.RG.RAK.......AED....VIGHLDSLKNTI..SE.TA.EGD....VHVDT.....................VLRSVAMQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPM..LRHL............TSSsipgg............................................vgiaiPEARY..D...I....L.NAVSAFWK.RSR...H...MVVIVFDK.LMQYQ.IV.DPT.DVVSWA..FIygg................................................ssdASI...GKV.S.F.D.A.F.Q..WDVLKG.ALDKANGR..............VMIARRKVTALRKEEDDNa........aR-Aka..........sdsA--Tmevdaeg..............................................................kqanvipAAES....PALT.TAL.KAFTTL.T.R...E.Q.KAALSRTL.........D.............GFVGYLVAE...................D---.-..-.KPNP.HA.RKVITenawhn..................................ranwdeiEWETWE..TW..CW..FRHFSRMYSPYL-r............................................................................................
A0A2H3ZAZ5_PHODC/483-828               ..............................................................................................................FKYSte..dsREG...MDGYTLSKEFNSMV.RA.RKT.......ARE....ITSWVEE--NII..PV.HG.---....---FN.....................VALEVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CPD......................................................QDKQF..L...L....M.DEISSYWK.NNT...Q...MTAIAIDR.MMSYR.LI.SNL.SIVRWV..FS.....................................................lSNI...NQF.H.I.S.D.R.P..WEILRN.AVDKTYNR..............ITDLRKEIQSLEGSVLLA.........eE-Atrk........aikeY--Eaaesklevvdgqpvqsek........................................pgrlkrlkgyaekardneTSVR....ESLE.AKE.ALLARA.V.E...E.N.KALFLSLY.........K.............SFRDVLMERl................ppV---.-..-.----.--.-----...............................................------..--..--..-------------sadgkfpklrttnvdsmavdyeepatmevdhdngrtdtsqsngekvfprystgeqeqwclcmlgyvkafsrqyatei................
A0A0D3FIE9_9ORYZ/483-829               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgklrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A166DVT6_9HOMO/531-813               ..............................................................................................................YDYG......DPN...HPHHSLAREILNWF.QG.RTD.......QEQ....VKQGIDNQKERL..MD.SG.ESE....ATALS.....................ILRFIVVQ..SLH...EIGSRSFSHFL.N.AME.R..Y.........IKV..MRHI............STD......................................................SEAKA..D...I....L.EATGKFWR.RNP...Q...MISITFDK.LQQYQ.FV.EPS.DVITWA..FA......................................................A-K...NGG.G.L.G.F.A.E..WDLIKG.ALDKANGR..............VLVAKKKVALQRKEQEDQi.......akE-Kak...........vtGEMDvdgnl..................................................................aqdapVQQS....AGLT.TAL.SASSTL.L.S...D.Q.KLALSKAL.........E.............GFATLLVDTd................nlLSES.D..W.NSRT.TW.T--DE...............................................EWQLNQ..TW..NW..YRHFCRTYSPH--lt...........................................................................................
U6LAT1_EIMTE/168-380                   ..................................................................................................rdtsgapwtpee----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-ALKLFVF..CLL...SFGSKTQTHLN.R.ILS.N..Y.........LQT..FICF............ANQsedpa...........................................earepeVDIHP..A...V....L.QAVQKFWS.TSQ...Q...RTALTLHA.FLKSG.IL.QRA.RVLQEL..CA......................................................A-D...ANI.R.D.S.W.G.Q..LELVET.VLRGALDE..............CENAREEAAAASAP----..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------mptnteaeqllhflmvhliedliketsparsrflflrciffgrkyaefinlqklkeevemvlsgiedr.........................
M9M7J7_PSEA3/633-929                   ..............................................................................................................FTYA......GPE...HPYHAAATALLSSI.RA.KAS.......ADV....ILADFESFKASI..IS.QL.PQD....--GMVgsmd.............eaevVVRDLVVQ..CVL...QVGSRSFSHLL.N.IVE.R..Y.........HGL..LRTL............SRS......................................................ARMRA..A...M....L.AAAVRFWI.RSP...Q...WLHIVVDK.LLQYR.IV.EPA.DVVEFI..FNpprdep.........................................asiltagVSE...VGS.W.A.G.F.N.T..WGLLKL.TLDKVNGR..............VDQLRRRLEQSQRLEAEEle......rqE-Aaaa.........agfEQEEskaepgmplf........................................................pttatlpvrpEEKA....PSAD.DAR.ASLDAI.R.T...E.Q.RKVLLTVV.........Q.............GFLALKAEG...................----.-..-.----.--.-----...............................................-WNKWW..VD..GW..YTAFVRTFNRQ--ll...........................................................................................
A0A2D3VJ10_9PEZI/560-811               ..............................................................................................................YKFA......NDQ...TPYAKEGREVLALL.KK.KAP.......EEE....IQKVLDSVHVQA..AE.MG.G--....GDPLV.....................PSTDIYVT..AIL...SIGSKSLSHVL.S.TID.R..C.........KER..LLEI...........gQRS......................................................EPARR..Q...I....V.ASVLDFWA.DQP...G...TAVNIVDK.LLNYT.II.TPM.AVIQLA..MQd....................................................rMNR...GHA.L.A.S.S.Q.I..YEMVSI.TMYKVTNR..............---VRQVL----RERNNP..........---...............----............................................................................KVPF....EQRV.QID.EALPRE.R.Q...G.M.RALFDTIE.........D.............AVSAVANGS...................QDEM.M..E.RFD-.-G.DSTER...............................................DLIMLW..GA..RW..ARVWRRKRAIEE-s............................................................................................
C7YU08_NECH7/533-778                   ..............................................................................................................FKFS......NPE...TPFAKEGQEIGALL.RR.KAP.......DED....FQPIIDSIQSQA..TE.RA.---....LDPLV.....................ASVDVFVT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNAS......................................................EAARA..Q...I....I.SAVMAYWH.AHP...G...IALSIIEK.LLNYS.IL.TPF.TVVDWA..LGast...............................................psngTNG...GDA.L.V.Q.P.H.I..FELVSN.TISKVTSR..............---ARQILVS--------..........---...............----............................................................................----....--PE.TDE.ETRSKE.A.K...T.T.QDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.EGDG.S-.-SDRE...............................................TMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
G3JGQ9_CORMM/555-803                   ..............................................................................................................FKYK......SSD...TPFSAEGQQIGALL.RR.KAT.......DEE....IQPIIDAIQTQA..AE.RA.---....LDPVV.....................ASTDVFVT..AMC...WVGSKSLSHVL.A.CID.R..S.........KVR..LIDA...........gVAS......................................................PAAHA..Q...I....I.SSVMAYWH.AHP...G...IALSIIEK.LLNYS.IL.TPF.SVADWA..ILads...............................................ashqGAP...GAA.L.A.Q.P.H.I..YEAIFN.TVSKVTAR..............---VRQVLA---------..........---...............----............................................................................--AP....PDSE.PDQ.QTRAKE.V.A...D.M.TELFRTIN.........D.............ALESWAAGT...................KDEL.M..Q.DDGT.SE.--SEE...............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
Q5KMU1_CRYNJ/587-885                   ..............................................................................................................WAYE......KDD...HPLHAEAAALLSQI.RQ.KLP.......STE....IIKYITEMPNAS..SG.P-.GEP....LYP--.....................AVRQMVFE..TIS...HLGSRSFSHFL.N.ATE.R..Y.........SDV..LRFL............TPD......................................................FASRR..I...L....L.DAVNSYWR.RSS...E...MRLVTLDK.YLQYG.IL.EGI.DIVEWI..FAdd.................................................eaeGEE...GDG.W.T.D.G.D.K..WEVLSM.CLEKHLGR..............VKAISRRLKVIEREDEAA.........rA-Rkage......qlergE--Dvnvedd................................................................tnedsrPETS....KEAR.DAQ.TSLDIQ.S.T...R.L.EKVLLATF.........K.............HFIFALLPWt................aeREEG.I..T.TSS-.--.----Eglkgvlt................................lldsdeegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
A0A024TE12_9STRA/641-769               .......................................................................................qvfgkikaregttaieawidaqg----......---...--------------.--.---.......---....------------..--.--.---....---KD.....................VGLEMAVA..ALL...DAGSATFTHFR.T.LLD.K..Y.........LPV..LMHAi..........dA-Ngd..................................................ggVDRQV..V...V....I.ATVSSVWE.QSP...Q...HVILILNI.LLRHR.VL.SPV.AIVSWL..FG......................................................ADA...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------vqqyswyvdsmr.................................................................................
A0A226NEY1_CALSU/448-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd.............sD--Dddrs...................................................................sdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A067NZ14_PLEOS/550-856               ..............................................................................................................FEYD......EAD...HVHHDAAQSVLNLL.RG.RAK.......PDD....VIAELETLKSSL..ES.SD.TEH....VD--S.....................VVRSIVVQ..SLL...HIGARSFSHLL.N.AIE.R..Y.........LPL..LRHI............ASAgvsst............................................ggsgnAEAKT..D...I....L.TAAATFWR.QNG...Q...LVGIVFDK.LMQYQ.IV.DPT.DVITWT..FAngga..............................................vsdrNQH...TSK.Y.M.S.M.Y.E..WDLVKG.ALDKANGR..............VMIARRKVTALRKEDDETr.......arA-Nar...........vgETMEvdadg.................................................................kadelpTSEN....PQLT.AAL.KAFATL.T.R...E.Q.KAALSCTL.........E.............GFVGALTNP...................DQRV.Q..V.QQVV.SA.SEWENret........................................wnseQWSAWE..TW..GW..YRNFCRMYSPYL-r............................................................................................
A0A0G4MMZ4_9PEZI/1971-2215             ..............................................................................................................FKFS......DET...TPFSAEGRELAALL.KR.KVP.......DEE....FQPVLDRIHAAA..TE.HS.---....LDALV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..V.........KDR..LLDI...........gAAS......................................................EAARA..Q...I....I.TAVMAYWR.AQP...G...VAISIIEK.LLNYS.IL.TPL.SVIEWS..LVyn..................................................hsERE...GDA.L.A.E.A.H.V..FELVSN.TVTKVTGR..............---VRQIMTAPELD----..........---...............----............................................................................----....---A.DAE.ASKELD.K.K...A.M.RDLFSSLK.........D.............ALSSWKAGI..................kDEML.D..E.PDSE.E-.---RK...............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
A0A013VIN7_9SPHN/43-160                ...........................................................................................................isi----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.IV.GAL.AIAGWI..LRw....................................................iG-D...RRK.E.D.R.E.W.M..TGKLET.IVDKLNDD..............IKETRTDVKETQRRLHDV..........EQQr.............sT--Drekii.................................................................vlekdiSHFK....DSQT.RME.KQLEKI.G.E...E.Q.KTYFGEIA.........K.............SIRQIL---...................----.-..-.----.--.-----...............................................------..--..--..-------------evr..........................................................................................
A0A2H3ZQA9_PHODC/463-807               .............................................................................................................f-KYIie..dsQEG...MEGHTLSKELNSMI.RA.RKT.......ARE....ITLWVEENIIPL..HG.F-.---....----N.....................VALEVVVQ..TFL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CTD......................................................QDKQI..L...L....L.EEVSSYWK.NNT...Q...MTAIAIDR.MMGYR.LI.SNL.SIVRWV..LS.....................................................pSNI...NQF.H.T.S.D.R.P..WEILRN.SLNKTYNR..............VTDLRKEIQSLKKSVLLA.........eE-Atv..........kamK--Eyeaaeskldvvddqpvqse......................................kpgrlkrlkgyvekakddeTSIQ....ESLE.AKE.ALLARA.L.E...E.N.KALFFSLY.........K.............SFKDVLMERlppv..........sadgkLPKL.R..T.ANVD.SV.TIDSEpstmdvdhddgktdn.................sqsngervfhsyttgEQEQWClcTL..GY..VKAFSRQYA----sei..........................................................................................
A0A0F4GTG5_9PEZI/559-810               ..............................................................................................................FKFN......NDQ...TPYAKEGREVLALL.KK.KAA.......EEE....IQKVLDSVHAQA..SE.RG.V--....EDPLV.....................PSTDIYMT..SIL...SIGSKSLSHVL.S.TID.R..C.........KER..LLEI...........gGRS......................................................EAARR..Q...I....V.ASVLDFWC.DHP...G...TAVNIVDK.LLNYT.II.TPM.AVVQLA..VQd....................................................rIDR...GRA.L.A.S.S.Q.V..YEMVSI.TMFKVTNR..............---VRQVLRERNNI----..........---...............----............................................................................KLPF....EQRQ.QID.EALPRE.R.Q...G.M.RDLFAAIE.........D.............AVSSVAAGAnd...............emIERY.-..-.DGD-.--.-SEEQ...............................................QLIQLW..GS..RW..ARVWRRKAAIEE-a............................................................................................
U4TQ91_DENPD/16-284                    ............................................................................................................mt----......---...LPGTAAAHQLVVTI.RQ.KCT.......PEE....VLAVLKDLPNPR..SE.EE.-VD....GRFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...I....L.RNMFELWH.NHQ...Q...MMVVLVDK.MLKTQ.IV.ECS.AVANWI..FS......................................................KEI...GSE.F.T.K.N.Y.L..WEILHL.TIKKMNRH..............VTKLTGELTEAREKLARA..........EESsd...........seS--Deekkk..................................................................qedaeKPSE....EMVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGKD.YN.T----...............................................HWYKWT..IG..RL..QQVFLAHHEQVQK.............................................................................................
A0A1I8MX69_MUSDO/19-298                ...........................................................................................................als----......STS...LAGTQVAHQLVVAI.RQ.KCT.......PEE....VINILKELPNSG..EN.AD.QEM....SETSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKTQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIRKMNKH..............VIKLTIELNDAKEKLSKA..........DSSs.............sDS-Edeaapkr.............................................................kkpvttvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A1S9DA39_ASPOZ/529-782               ..............................................................................................................FKYS......LDT...TPYANEGTEIMQLI.RK.KAT.......DDD....ILPIINAIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWT.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QALFKVIE.........D.............SIMSVAEGHnd...............elMERG.D..G.SGEL.PE.D----...............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
A0A194RIN0_PAPMA/26-261                .......................................................................................................ftttlia----......-TS...LPGTEAAHRLVVCV.RN.KCT.......PEE....ALNVLRELPNPL..RD.GD.AA-....PHPHYn...................pLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...V....L.KNVWELWQ.RQP...Q...MVCVLVDK.MLKTQ.VV.ECS.AVATWL..FS......................................................KDM...APH.F.T.H.N.Y.L..WEILHL.TIDKMNKH..............------------------..........---...............----............................................................................----....-AVE.RME.ERLELA.H.T...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DARD.PN.T----...............................................HWYRST..VA..RL..RHVFLVHHEQVQK.............................................................................................
M4BIG7_HYAAE/207-459                   ............................................................................................................ma----......DET...SPASEFYQSVTTKL.KG.HPP.......AAA....LHSWLNE-ELPR..LE.IS.R--....----T.....................EAIEVVWT..CIL...EAGAATFTHMR.L.LLE.K..Y.........GKRgeLLGIsy.......qlgEDV......................................................TADEL..A...L....V.KTVASVWL.KSP...Q...HIGLILNA.MLRQE.LF.RPV.AIVIWV..FT......................................................PDA...VQQ.Y.S.W.P.Y.V..WEILRD.TLKFVQDA..............IDTKTQKMGQAAAPRS--..........---...............-SED...........................................................................rDEEM....LDVA.TLE.DDRKRL.Q.D...E.M.RQLLLLLF.........K.............GFNRVLTEH...................KAEC.E..A.EDSD.PH.D----...............................................NWFHST..LA..QM..QA-----------ighryrvp.....................................................................................
E3QAL0_COLGM/535-781                   ..............................................................................................................FKFN......DDS...TPFATEGREIAALL.RR.KAP.......DEE....FQPIIERIHSLA..IE.RG.---....LDPLV.....................TSTDIFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EVAKA..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.TVIEWA..LGgss...............................................hvegQSS...GDA.L.A.Q.P.H.V..FELVFG.TVAKVTGR..............---VRQLL----T-----..........---...............----............................................................................----....KEAE.ADE.EAKERE.C.K...A.M.RDLFRAMD.........D.............ALISWASGS...................KDEM.M..E.EMD-.-G.AGQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A1S3RRL3_SALSA/485-765               ..............................................................................................................YKYQd...eaNSA...LPGYAVAIAVGNAI.KN.RAS.......NEE....ILTVLKDVPNPN..QE.DD.DDE...gEGFNP.....................LKIEVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEI..LKAL............TDC......................................................DEGKL..H...I....L.RVVYEVWK.NHP...Q...MVSVLVDK.LIRTQ.IV.DCA.AVANWL..FS......................................................PSM...AHE.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLERQq.......hkK-Kds..........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.GSVD.FS.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
I7M7J6_TETTS/614-872                   ......................................................................................................tkyqqdpl----......---...------AQRFMELL.VQ.KKT.......HEE....MGEEINEALKEG.iDD.EG.EDE....NEKKN.....................FVISVFLE..CLF...FRSCETFTHLK.I.LYD.R..Y.........APL..LKKLl..........eEHG......................................................EVFQN..A...L....V.NTLLLFWQ.NNS...S...NLEHYLKK.FISNN.FI.TPQ.IVASSI..FEhl.................................................kelK--...-AS.S.A.S.V.R.Q..VHQLWL.FLRRITFN..............---IFDTFHNYTEEVNSN..........IYQ...............GQDE............................................................................EEKA....GEVE.TLS.QKLEKA.K.Q...Q.L.TELLEIIF.........S.............QFESIFSEV...................T-AD.E..I.KDKQ.Y-.-----...............................................------..--..--..-------------dtyflyfyrkykkfvdwentyqsqf....................................................................
A0A1X7S087_ZYMTR/559-810               ..............................................................................................................FKFN......NDQ...TPYAKEGREVLALL.KK.KAA.......EEE....IQKVLDSVHAQA..SE.RG.V--....EDPLV.....................PSTDIYMT..SIL...SIGSKSLSHVL.S.TID.R..C.........KER..LLEI...........gGRS......................................................EAARR..Q...I....V.ASVLDFWC.DHP...G...TAVNIVDK.LLNYT.II.TPM.AVVQLA..VQd....................................................rIDR...GRA.L.A.S.S.Q.V..YEMVSI.TMFKVTNR..............---VRQVLRERNNI----..........---...............----............................................................................KLPF....EQRQ.QID.EALPRE.R.Q...G.M.RDLFAAIE.........D.............AVSSVAAGAnd...............emIERY.-..-.DGD-.--.-SEEQ...............................................QLIQLW..GS..RW..ARVWRRKAAVEE-a............................................................................................
A0A0V0Y0P9_TRIPS/258-520               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aSDS......................................................KEAQL..H...I....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIDWI..FS......................................................EKM...RSS.L.M.R.Q.Y.V..WQIVFS.MSTRLARN..............IKKIQEDLEKKQTEEGTM..........-SS...............ASSD............................................................................DERN....SEIS.AIQ.MKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KMIILLSEH...................LLQS.D..A.EDRD.SH.I----...............................................SWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
H3GMP6_PHYRM/614-860                   ........................................................................aasqfyqsvttklkghppasalrswldeelprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAIEVVWT..CIL...EAGAATFTHMR.L.LLE.K..Y.........GRR..YELFggd.....dqsaEER......................................................DADEL..V...L....V.KTVASVWL.KSP...Q...HIGLILNS.MLRQG.LF.RPS.TIVTWV..FT......................................................PDA...VQQ.Y.S.W.P.Y.V..WEILND.TLEFVHDA..............---IRAKTRQLEQAAAPR..........-SA...............DDQD............................................................................NEEM....PDVA.ALE.DGRKRL.Q.D...E.L.QQLLVLLF.........R.............GFNRVITEH...................KAEC.D..A.EDAD.PR.D----...............................................NWFRSA..LA..QM..QAVG---------yrfrv........................................................................................
A0A016WZ31_9BILA/488-747               .............................................................................................................c-KFD......DEE...QPGHEAATKFMNMI.MA.RAD.......DNG....IMAEMRD---ED..GR.Y-.--D....P----.....................DLFGIFFA..ILL...KTSAKSFSHTF.V.ALS.R..Y.........STT..LKTV...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESL...RSE.N.D.R.Q.W.I..WEVLNT.ALERLSRH..............IHKVAHDVKILQKRVDRQ..........KAEne...........emE--Dnd........................................................................akTREQ....EELE.QQQ.EKLENL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEF...................IVHC.E..T.EGTD.FR.T----...............................................PYFAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
J9VFC5_CRYNH/587-885                   ..............................................................................................................WAYE......KDD...HPLHAEAAALLSQI.RQ.KLP.......STE....IIKYITEMSNAS..-S.GP.DEP....LYP--.....................AIRQMAFE..TIS...HLGSRSFSHFL.N.ATE.R..Y.........SDV..LRFL............TPD......................................................FASRR..I...L....L.DAVNSYWR.RSS...E...MRLVTLDK.YLQYG.IL.EGI.DIIEWI..FAdd.................................................eaeGEE...GDG.W.T.D.G.D.K..WEVLSM.CLEKHLGR..............VKAISRRLKVIEREDEAA.........rA-Rkage......qlergE--Dvnvedd................................................................tnedsrPETS....KEAR.DAQ.TSLDIQ.S.T...R.L.EKVLLATF.........K.............HFIFALLPW...................TAER.-..E.DGIA.TS.H---Eglkgvlt................................lldsdeegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
A9S1J0_PHYPA/495-842                   ..............................................................................................fvyapdnntsapeaev----......---...----ALATELTSLV.RG.KKT.......VRE....IQVWIDEQILPT..--.QG.Q--....----Q.....................ASIQIVAQ..TLL...YIGSKSFTHTI.T.VLE.K..Y.........CQI..FRKI............APD......................................................MGTQI..A...M....I.DTVSQLWR.NSA...Q...MTAIVIDR.MMGYR.MV.SNL.AIVAWV..FS.....................................................pQNV...QQF.H.T.S.D.Q.V..WEILRN.AINKTNNR..............TVDLRKEISAAEKVLKLAaagt..vkahS--...............---Kweaavaalnaaeaksedsrn....................................slsakvdwaktvadkaqdeeTSAQ....DSLE.SKG.ALLDRA.L.R...E.Q.EALFLAVY.........Q.............SFADLLTDR...................LSKP.L..P.EPQE.VS.NSLEDaegegadveapvameadeen......dedgtkqrnqkrttsadpqeeE-----..--..--..-------------qwrkctlgylraisrqycdev........................................................................
A0A0R3WB30_TAEAS/622-950               ..................................................................................sasatsekahpvkdelvpskrvrnkekm----......---...--------------.--.---.......---....------------..--.--.---....-NENEddldnc........lvpgvtnRELELFMT..ALL...YRAHKTISHTC.S.LLN.R..Y.........SET..FKTL............AST......................................................VELQV..E...A....L.HILQAVWC.NQS...Q...MVVAISDY.MSRQG.ML.DPE.SVVGWA..FSpfmsafsg......................................plapppstVHV...CPR.M.L.Q.S.H.V..WECLMH.TLVRVGQR..............IAQITPKLEAVKDHQAGAh.......hrK-Sasgsr.....sdgssS--Dmdnddddgdlrakivrgrrr...................................hqrhcrsgsrgsssgggggggGASP....DRLA.RLN.EERGEA.V.R...S.Q.CAVITLLL.........H.............RHVRLVATVes...............kaTEEV.E..T.SDNQ.SD.LVDLE...............................................AVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
A1DM04_NEOFI/529-782                   ..............................................................................................................FKYS......SDT...TPYAKEGREIMQLI.RR.KAG.......DEE....IQPLITAIEEQA..KA.LG.V--....DDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................rLQA...GTI.L.S.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQA----..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.A...D.M.QALFRVIE.........D.............SIVSVAGGSnd...............glMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
A0A059D9L3_EUCGR/68-412                ................................................................................................ygidegseqteeqr----......---...-----LSAELSKMV.KG.RQT.......ARE....LISWIEESVSPT..--.HG.---....---LE.....................STLKVVVQ..TLL...DIGSKSFTHLI.T.ILE.R..Y.........GQV..IAKI............CPD......................................................DERQA..M...L....I.EELSSYWK.NNP...Q...MRAITIDR.MMGYR.LI.SNV.AIVRWV..FS......................................................PVN...IDQ.F.HiS.D.H.P..WEILRN.AVSKTYNR..............IVDLRKEISSLKKDVISAee.....vsaKARa............dlE--Saeqklmlvdgeptvgen.........................................parmkrlksyaekakekeV--Si..rENLE.VKE.ALLGRA.Y.N...E.N.EALFLALY.........K.............KLSSVLKERlpep..........skartLREL.K..S.I---.--.----Hadetaveleepsamemdden.......grakeshsngekasdvykvgEEEQWC..IS..TLgyVKAFSRQYASE--fh...........................................................................................
R4X9M8_TAPDE/503-766                   ..............................................................................................................FPCN......TTG...HPYYEETSTLLTEL.TA.TAA.......LER....VNEQLSAIRRKA..ID.EG.S--....-DPEE.....................QELHILVS..CIL...QLGHQSFSHAL.N.TIE.R..N.........LQL..LQTK...........cDSS......................................................PTSRR..T...T....V.ATVMAFWS.GRP...F...IASTLLQK.LLNYR.LI.SPM.SILQNL..LL......................................................DSP...SAV.F.T.R.S.T.T..WELVRT.TIEKVNAR..............VTQVRARLDKLTNESNDNes......teN--...............-AMDtaet....................................................................tttePETV....SELD.KLR.KTWVDV.Q.E...E.Q.RDVFTFTI.........S.............QLSTRVADL...................KR--.-..-.--DA.GD.D----...............................................PWALYW..IR..GL..YRSILRRNKAQ--iv...........................................................................................
A0A1S3FQC8_DIPOR/492-767               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLASKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RIMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
E9CS92_COCPS/532-785                   ..............................................................................................................FKYA......QET...TPYSKEGQEILQLI.RK.KAS.......DEE....IAPVIASIEEQA..KA.HG.--L....ADPSI.....................PSTDAFVT..SIC...CVGSKSLSHLL.S.SIE.R..C.........KER..LLAI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIVDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLAA...GSI.L.A.K.P.H.I..FEMISA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................TLVE....PQLS.VIQ.DALTRE.S.A...D.M.RAMFRLID.........D.............SIVPVASGTnd...............vmM---.-..E.RDDD.SA.-LAPE..............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A1A9WAT5_9MUSC/7-270                 ............................................................................................................mg----......--S...LAGTQVAHQLVVAI.RQ.KCS.......PEE....VINILKELPNSG..EN.SD.QEM....SETSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKIQ.IV.DCS.AVATWI..FS......................................................KEM..tGNE.L.N.D.A.-.-..KEKFAK.ADSSSSDS..............----EDEATPKRKKPLTV..........VDK...............PTEEyffc....................................................................sslcFNEH....FMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A194V8W7_9PEZI/574-831               ..............................................................................................................FKFE......NDD...MPFAQEGRELAQLL.KR.KAP.......DEE....IQPVIERIHSSA..ID.QS.---....LDPLV.....................TSTDVFTT..AVL...AVGSKSLSHVL.A.AIE.R..T.........KER..LMDA...........gIAS......................................................EPARA..Q...I....I.TAVMDFWS.AHP...G...VAITIIEK.LLNYS.II.TPT.AVVQWA..LTgy..................................................agETK...GEA.L.A.R.S.Y.M..YEMVFN.TVAKVTKR..............---TREVVSAQQPEP---..........---...............----............................................................................QEDV....DMSS.EAE.ETKKRE.I.A...T.M.KELFKTME.........D.............SLYAWASGT...................KDEI.M..E.DGSL.DD.ASRDEr.............................................dSLVKRW..GN..RW..LRVVRRKSAIEE-a............................................................................................
A0A1Y2G5P3_9FUNG/567-829               ..............................................................................................................WKFE......NPE...HPYHAMASAVLNSL.RA.KNS.......IEQ....IEQTLESMKNAP..RL.ES.LTM....TERED.....................FIRELFTE..CVL...MLGSKSFSHVL.N.VIE.R..Y.........LTI..LQRL............NGT......................................................PEARL..H...T....V.KIVAQFWR.NNT...Q...FMGILLDK.MLNYR.VV.DAI.AIVKWV..FE.....................................................pEVW...QNE.W.H.R.S.F.V..WDILKN.TLNKVISR..............VAQVKDKLAEVRKEFEAV..........---...............---P...........................................................................pTKSA....EVVQ.GVE.NTLSIV.N.R...E.Q.KEVFLTLY.........Q.............KFVAILQSK...................LKEI.E..G.LNPG.SE.ELEQK...............................................TRSYQI..GQ..GW..FLEVGRRYSKEV-a............................................................................................
A0A1Y1YIV7_9PLEO/542-796               ..............................................................................................................FKYE......NPQ...TPFSPEGVALLHQI.RK.KAP.......DSE....IQETIDKIHKQA..LE.QG.--I....VDVLV.....................PSTDAFVT..AIC...RLGSKSLSHVL.S.CIE.R..G.........KER..LMSI...........aNTS......................................................ETARR..Q...V....V.ASVVEYWK.DQP...G...IAVNIIDK.LINYQ.IL.QPS.TVIEWA..LVd....................................................hLGA...GDP.L.T.K.D.W.V..FELVYN.TIAKVTSR..............---TRQIVTARLQK----..........---...............----............................................................................GLPQ....EQIK.LVD.DELTKD.R.E...R.S.RELFKLIA.........D.............SISGVAEGSad...............glI---.E..K.ETSG.EL.TA--Ee.............................................gQFIREW..AK..RW..HMVFVRKAQVEE-s............................................................................................
A0A2C5ZX71_9HYPO/534-781               ..............................................................................................................FKFS......DPD...VPFSKEGQEIGALL.RR.KAP.......DEE....LQAVVDSIQSQA..GE.QA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLDI...........gSAS......................................................AAARA..Q...V....I.TAVMSYWQ.AHP...G...VALSIIEK.LLNYS.VL.TPF.SIIDWT..LGagt...............................................pangTRG...GES.L.A.Q.P.H.M..LELVCN.TVAKVSGR..............---VRLVL----TSP---..........---...............----............................................................................----....---D.ADD.ETRDKE.V.Q...A.M.RDLFGAIA.........D.............ALAGWAGGE...................DETM.T..T.DDDA.DG.PGDRE...............................................ATIRRW..GQ..RW..LRVFRRLAAIEE-a............................................................................................
A0A182E5C2_ONCOC/552-816               ..............................................................................................................YDLN......DDE...HPDRDFAIILEKAF.RD.KIS.......ADE....MIDLLRSKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDAQL..T...I....L.RTLYETWK.LNG...Q...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KHE.F.E.R.L.W.I..WEILNR.ALEHVSGH..............VHRSRQAVENRKLKNERKd.......sdH-Ek............ddF--Dmead...................................................................ehhitDPNA....VELF.VKE.SEFADL.H.E...C.L.KNL---LL.........D.............KFAITLAEH...................IVNS.E..S.SGRD.FQ.N----...............................................NWYLYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
A0A1D6K2X6_MAIZE/1-286                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-MGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
F0XRE3_GROCL/583-838                   ..............................................................................................................FKFQ......TDD...TPFAAEGRELAALL.KR.KAP.......DEE....VQTVIGRIQDLA..LD.SG.R--....DEPLV.....................ASMDVFTT..AVL...WVGSKSLSHVL.A.CIE.R..T.........KDR..FLDA...........gAAS......................................................EAARS..Q...I....L.EAVMTFWA.AHP...G...IAVSITEK.LLNYA.IL.SPE.TVVKWA..LDkkeee...........................................adkaetAET...APR.L.S.Q.A.F.V..AELVFN.TVAKVTRR..............---MRQVVVTSQAASATV..........---...............----............................................................................VAAY....AAVD.AAR.EQQQNP.G.S...L.A.VAAVSKLF.........Q.............RVAEAVEPW...................----.-..-.-AAA.SS.P----...............................................LVVRAW..AE..RW..QRVVRRRQAIEE-a............................................................................................
A0A0D3E2U7_BRAOL/301-596               ......................................................................................................ymysleeg----......KEK...TEEHELSAELNRKV.KE.KQY.......ARD....MMSWIEETIYPV..HG.F-.---....----E.....................VTLTVVAQ..TLL...DIGSKNFTHLV.T.VLE.R..Y.........GQV..FAKL............CPD......................................................NDKQV..M...L....L.SQVSTYW-.---...-...--------.MMGYR.LV.SNQ.AIVRWV..FS......................................................PEN...VDQ.F.H.V.S.D.Q.pWEILGN.ALNKTYNR..............ISDLRKEISSIKKNVLVA.........eKASana........rvelE--Aaesklll..............................................................vegepvlGDDP....LKMK.R-L.KNDGGE.D.R...G.G.RVLLLQMF.........Q.............SFSAVLKERlpep..........tkarsLQDL.K..S.TGAE.DK.NSSAMevdsengnt............................kkrseigerqQWCLST..L-..GY..LTAFTRQYAKE--m............................................................................................
A0A2G8KM06_STIJA/431-705               .......................................................................................................fryidee----......TNQ...IPALPISRKLIEAF.KA.KAT.......MEQ....VEEILNQIPGPK..KE.DN.SGE....VEEAAn...................pLKIDVFVQ..SLL...FLGQKSFSHTF.S.ALA.K..F.........HPL..LKKL............GNT......................................................EESQI..F...M....L.RTIRDLWQ.NHQ...Q...MICVIIDK.LIRTT.IV.SCP.AVINWI..FS......................................................EHM...RVH.F.T.E.G.F.V..WEILHG.VLRKMNME..............VTQLQKELEDVKHKKSDE.........eD-Ge.............tS-GEeya......................................................................vsnTASE....SQVE.KLQ.ESYEAA.Q.S...E.Q.KNLFLIIL.........Q.............RFIILLTEH...................IVSC.E..S.KGTS.FQ.T----...............................................PWYNLS..IQ..RL..EQIFTLHHKQVS-k............................................................................................
A0A212F7L2_DANPL/487-767               ..............................................................................................................YKYAm...egAAS...LPGTEAAHQLVVCV.RN.KCT.......PEE....ALNVLRELPNPL..RE.GE.ANA....AHTAYn...................pLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...V....L.RNVWELWQ.RHS...Q...MVCVLVDK.MLKTQ.IV.ECS.AVATWL..FS......................................................KEM...APY.F.T.H.G.Y.L..WEILHL.TIDKMNKH..............VSKLSKELQEAREALARAdss...ssesE--...............---Desgsk.................................................................kkkdqdKPTE....EAVE.RME.ERLEMA.H.T...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRA.D..T.DARD.PH.T----...............................................HWYRAT..LA..RL..RQVFLLHHEQVQK.............................................................................................
A0A2C5X7X8_9PEZI/535-804               ..............................................................................................................FKFN......DPE...TLFSAEGIDMAALL.RR.KAD.......DEA....FQPIFNKIQTAA..LD.MG.---....TDPLV.....................ASVDVLMT..SVC...WVGSKSLSHGI.A.CIE.R..V.........KAK..LTEF...........aSAS......................................................EAARC..Q...L....I.TSIAQYWT.YHP...G...TVVALIDR.LLNIA.VL.TPT.AVVEWA..LTgags..............................................lvcdGPT...STV.L.S.R.A.L.V..FEIVVN.TVNRVILR..............---LHQPLEASELKPTPEtld....nlfK-Aiy...........dgV--Dkiqadptadeegvaape..........................................twkarwmrvfkrkeivqK---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------alaaekklakeikekeeeelareaqadieataaaeqd........................................................
W7MK74_GIBM7/531-776                   ..............................................................................................................FKFQ......NPE...TPFSKEGQEIASLL.RR.KGP.......DEE....FEPLFRSIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AIC...WVGSKSLSHVL.A.CIE.R..T.........KGR..LLEA...........gNSS......................................................DAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LVNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AAP------..........---...............----............................................................................----....---E.TDE.ETRFKE.M.K...S.T.QDLFRAMK.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIQRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
A0A1C1CQN4_9EURO/451-703               ..............................................................................................................FKYN......EES...TPFSAEAQEIAQLI.RR.KAT.......HDE....FTPILQKVEQDA..AS.QG.--L....PDPAL.....................AAVDAFMT..SIC...WVGSKSLSHAL.A.CTE.R..C.........KDR..LLAF...........sASS......................................................SACRK..Q...I....I.TSVMDYWR.DQR...G...VGVILIDK.LLNYQ.IL.TPP.SVIEWA..LId....................................................hVDR...GRL.L.A.T.T.W.C..YELVNN.TTGKVAGR..............---VRSLVAAIRTP----..........---...............----............................................................................GLTE....EQKN.ELQ.STLTTE.L.E...G.M.KSLFATIE.........D.............AVGSIRDGN...................QDEM.I..E.-SSD.AL.RAEDE...............................................ALLRNW..GG..RW..ARVFQRKGAVEE-s............................................................................................
A0A074XXI9_9PEZI/537-788               ..............................................................................................................FKYL......NEQ...TPYAQQGNAMHALI.RR.KAP.......EEE....IEAVINEIQALA..SE.HG.V--....EDVLV.....................PSTDAYMT..SIC...SVGSKSLSHVL.S.CIE.R..C.........KER..LLAI...........gPES......................................................ELARR..Q...I....I.TSVIDYWA.DHP...G...TAVNIIDK.LLNYT.II.TPM.SVIEWA..LHd....................................................hLQH...GRA.L.A.Q.T.H.I..YEMISA.TMFKVSNR..............---MRQIV----RARDET..........---...............----............................................................................DLSE....EQKN.LLD.ETLVRE.R.Q...T.M.RDLFNAII.........E.............AVETVANAAqd...............dmIERF.-..-.DGD-.--.-SAEQ...............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
A0A094F7J6_9PEZI/549-800               ..........................................................................................................iklt----......NLD...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.M..E.AGIG.ET.T--DE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A1Y2ATD1_9TREE/508-805               .............................................................................................................w-VYE......KDD...HPLHAEAVELLKLF.RQ.KAS.......AND....VRAHLETLPNAS..SG.PG.E-L....VSP--.....................QIRAMAVE..TLL...HLGSRSFSHFL.N.ATE.R..Y.........LDM..LRFL............TPD......................................................PASRQ..T...L....L.DSVGTYWK.RSS...Q...MRLVTVDK.YLQYG.VL.EGL.DVVDWV..FGedgg..............................................aetsDEE...GDG.W.T.D.G.E.K..WEVLKM.TLDKLVGK..............VTAVRRRARQVEKEDEAA..........KARraa.........ealE--Rgegvged.............................................................evepedvrLERS....KEAR.DAQ.TSLDIQ.I.S...K.L.ERVLRSAT.........R.............HFVADLVPWcf..............dpaS---.-..-.SAM-.GL.KSVLTllds.......................................gvegMWSVRA..KF..GW..WKHFVRLYQPH--ll...........................................................................................
A0A0P7WT97_9TELE/450-693               ........................................................................................................iykyed----......---...--------------.--.---.......---....------------..-E.NS.NEG....ESFNP.....................LKIDVFLQ..TLL...SLAAKSFSHSF.S.ALA.K..F.........HEV..LKTL............TES......................................................DEGKL..H...I....L.RVVCDVWK.NHP...Q...MISVLVDK.MIRTQ.IV.DCV.AVANWI..FS......................................................QDM...THE.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEDSKEKLEKQh........qK-Kdsg........deedMEED............................................................................SQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIFqmplsasseQ.............RFIMMLTEH...................LARC.E..T.GGTD.LN.T----...............................................PWYKNC..IE..RL..QQIFLMHHATIQ-q............................................................................................
A0A1X1BHP6_9APIC/754-979               ...............................................................................nlfaedktpevvmtdaatdpsgvktwnrddl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--VLIFWE..SVV...ILGNKSLTHLL.R.LIE.F..H.........GEV..LKNYi.........shEQSga..................................................feDTICY..K...V....L.LLTRNTLK.NDT...K...KFELVTDE.LLRQK.IV.TPA.DACRFV..YR......................................................FYP...TAE.F.F.S.N.H.A..PCILEC.AFDFVRER..............LDHSRARLAEGGSNMDVL..........---...............----............................................................................----....----.--H.KAHDER.E.A...M.M.RELLKTIT.........E.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ltnnllmqgvdsgheailasmlkniilnnareinmimqlrse...................................................
A0A1U8MNA5_GOSHI/500-846               .............................................................................................................f-KYSga.ddqEKT...EQEQALSAELSNKV.KG.RQS.......ARE....IILWIEENVYPI..HG.Q-.---....----E.....................ITLSVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..MAKL............CSD......................................................QDKQV..M...L....I.SEVGSYWK.NNA...Q...MTAIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IEQ.F.H.I.SdR.P..WEVLRN.AVSKTYNR..............ITDLRKEISSLKKSVVSAe........eA-Ask...........akA--Dleaaeskltlvegepvlge......................................nptklkhlksvaektkeetVSMH....DSLE.AKE.ALLARA.L.D...E.N.EVLFLSLY.........K.............NFSNVLMERlpda..........srdgtL---.-..-.----.--.-----...............................................------..--..--..-------------qslksvngdsmavdieepstmevddenerpkksqsnggkttngynvrekeqwclstlgyvkafsrqyasei......................
G0WF93_NAUDC/582-835                   ............................................................................................................lf--FK......LDS...VPMEAQVRQILDYI.HK.PNN.......QRE....LKDLEEIINTIK..EE.YG.NEI....TDFTR.....................FVIIVIMQ..AVV...HSGSRSLSHAN.K.YIN.D..L.........RDE..LLEIfs.......kleMDQ......................................................DLKEY..T...M....I.EAVLRYWN.TNS...Q...NGFLIVDA.LKFAK.LV.STK.SIYDFC..FDes.................................................nlnDGI...NHG.L.I.E.S.T.A..IEAIFR.NLSQELIS..............------------------..........---...............----............................................................................----....----.---.------.N.P...Q.S.VADFEIVF.........E.............KLCIIVNGT...................IKDL.G..V.QEDE.DI.-VVPNvssdmdidft...........................dvnesrrfnlSWKYAT..VT..SF..IKSLLRKYSDEYR.............................................................................................
NCBP1_DROME/488-770                    ..............................................................................................................YKYAn...eeAAN...LPGTTVAHQLVVAI.RQ.KCT.......PEE....VVNILKDIPNSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.L.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSEAKEKLAKA.........dS-Ss............sdS--Eddsshkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
W4KGI1_9HOMO/537-838                   ..............................................................................................................YDYD......DPA...TPHHDAAQSVLNQL.RA.RAK.......PED....VMSNLESIRNAI..AE.TS.EGD....VNVDS.....................VVRSIAVQ..SLL...HIGARSFSHFL.N.AIE.R..Y.........ILL..LRNL............AAGgiaag...........................................sgglasAEAKA..D...I....L.TIAATFWR.RSH...Q...MVGIVFDK.FMQYQ.IV.DPT.DIVRWA..FM......................................................H--...-QQ.R.G.D.G.L.D..WDVLKA.AIDKANGR..............VVVARKRVAALRKEEDDSr........aR-Akag........dstaM--Evdtea.................................................................kqdetpAVDS....PALV.TAL.KAFASL.T.R...E.Q.KSMLSQVL.........E.............GFVESLHSP...................T---.A..E.RPNP.CA.SEVITekawhn..................................ranwgddQWKAWT..TW..VL..YKHFCRTYSPYL-r............................................................................................
A0A2A4IXL6_HELVI/8-216                 ...........................................................................................................vlg----......DAS...LPGTEAAHQLVVCV.RN.KCT.......PEE....ALNVLRELPNPL..RE.GE.QPA....AAQAApy.................npLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...I....L.RNVWELWQ.RHT...Q...MVCVLVDK.MLKTQ.IV.ECN.AVATWL..FS......................................................KEM...APY.F.T.H.N.Y.L..WEILHL.TIDKMNKH..............VSKLSGELQEAREALARA..........DSS..............sSDSEde.......................................................................nssK---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------kkkdqdkptee..................................................................................
K1VU75_TRIAC/513-813                   .............................................................................................................w-VYE......SSE...NPLHAEATELLRLM.RQ.KVP.......ANE....VKSYLDNLPGAR..TE.GS.EVL....S---A.....................PILTMAVE..TIQ...HLGARSFSHFL.N.ATE.R..Y.........LDV..LRHM............TPD......................................................AASRR..V...L....L.DAVASFWR.QSA...Q...MRLITTDK.YLQYG.IL.EPM.DVVSWV..FAedps..............................................sssgTDA...ADG.W.T.D.G.D.K..WELLRM.TLDKVQGR..............VKAVSRRLAAVEKADEVAr.......arR-Aaerle....sgegvgD--Dee.......................................................................detLERS....REAR.DVQ.ASLDLQ.S.E...R.A.DKVFVATT.........Q.............AFVSELLPWa.................fPAEG.A..E.EGED.AG.----Sglkavfa................................lqdagetgAWSTRA..KW..GW..YREFARRYAT---gir..........................................................................................
A0A067R587_ZOONE/487-775               ..............................................................................................................FKYAa...egAGS...LPGTTSAHKLVVSI.RA.KCK.......PEE....VLHVLQDLPNPR..QD.ED.-VD....PRFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HYV..FKEL............AES......................................................EEAQI..C...I....L.RNMFDLWH.GHQ...Q...MMCVLIDK.MLKTQ.II.ECS.AVANWI..FS......................................................KDM...SGE.F.T.K.L.Y.L..WEILHL.TIKKMSKH..............VNRLGRELAEALERLRHAes......dsD--...............ESEDgdgegnnnsgq......................................................rgksggaddheKPSE....DMVD.RME.ERLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.FN.T----...............................................HWYKWT..IG..RL..QQVFLVHHEQVQK.............................................................................................
F6ZXS3_ORNAN/474-623                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------.............................................................................................
T1HND5_RHOPR/491-769                   ..............................................................................................................YKYTa...egSSS...LPGTQVAQQLMTAI.KN.RCS.......PED....LLAILKELPNPL..ED.DE.GPE....ARYNP.....................LKIDVFVQ..TLF...FLGSKSFSHSF.A.AIG.K..F.........NQV..FKLL............ADG......................................................EEAQL..C...I....L.RSIYELWR.NHQ...Q...MVCVLIDK.MLKIQ.LL.ECS.AVANWI..FS......................................................KEM...SHD.F.T.K.L.Y.I..WEILHL.TINKMSKY..............VSRLSRELSEAREKLARSg........aG-Sss...........gdE--Sddslt..................................................................grgddKPTE....EMVE.RME.ERLETA.Q.G...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DNKE.FD.N----...............................................YWYRWT..IG..RL..QHVFLAHHEQVQK.............................................................................................
A0A0G2IYJ0_9EURO/566-823               ..............................................................................................................FKYA......LET...TPYATEAQEIMHLI.RK.KAP.......DAE....IQPHILAIQQAA..AS.QP.D-T....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLAYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARAQG----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...D.V.QVMFEVIE.........G.............ALEGVINESngn.............esgMEDV.-..-.----.--.---GEgvgw.......................................eeekGIIREW..GR..RW..LRVFKRLRAVEE-a............................................................................................
A0A0K8L8H3_9EURO/529-791               ...............................................................................................fkyssdrftnilipt----......--A...TPYAKEGREIMQLI.RK.KAG.......DEE....IQPLITAIEEQA..KA.LG.V--....DDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................rLEA...GTI.L.S.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.A...D.M.QALFRVIE.........D.............SIVSVAGGSnd...............glMERG.D..G.SGDL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
A0A0C3GXC8_9PEZI/524-771               ..............................................................................................................FKYN......DES...LPFSHEGKEIMALI.RK.KGS.......EDD....IQPIIEQIHSQA..ID.MR.--L....PDPIA.....................LSTDAYMT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KDR..LLSL...........gTAH......................................................PAGRR..Q...I....I.DSVMGYWK.DQP...G...IGVNIVDK.LLNYT.IL.SPE.SVIDWA..LS......................................................R-N...GSR.L.A.E.A.Y.V..FEMVAA.TVGKVTGR..............---VRQVVLAATAR----..........---...............----............................................................................GLSE....EQKM.ILK.QTMETE.R.T...A.M.RELFQVME.........D.............ALVGWASGA...................KDQQ.V..E.SGDM.SS.---ED...............................................AMVRRW..GE..RW..LRVFRRRFAVEE-a............................................................................................
G8BCS6_CANPC/643-904                   ..............................................................................................................YNFT......NPE...LPLSNVASQVYEFLvSH.YKS.......NKE....MNELYNSVLEQI..QQ.VQ.SGQ....LDAMVsvdi............pnpvkFVINLFFQ..TYA...YIGSRSIYSEV.S.ILD.R..D.........VDK..LKFL............SGQpitsakkvanpd.............................defeklylsddevTNRQN..W...I....I.DAIFRIWV.HQS...Q...VIFLILEY.LIEFE.IL.DPK.YLIDKA..FK......................................................T--...NLI.I.D.N.V.S.C..IESVNR.ILETSKPP..............------------------..........---...............----............................................................................----....----.---.----VL.K.Q...L.M.IEIFTIVV.........S.............KLNELDLGVd.................dVVHI.D..E.LNED.NS.SEVDK...............................................QWLFYE..YL..GL..LKSYFRKYIKN--qa...........................................................................................
A0A0V1PBN6_9BILA/490-752               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A195AT54_9HYME/528-802               ..............................................................................................................YKYTp...kgASS...LPGSDAALKLIDSI.KN.KGT.......SED....VLAILNALPREN..EE.TN.NYN....----P.....................LKIDVFVQ..SLL...NLGSKSFSHSF.A.AIV.K..F.........HDI..FKML............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELTDAREKLRRA.........eS-Rsg..........sssD--Eednnk..................................................................ernreRPSE....DEVE.RKE.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
D6W9J4_TRICA/8-280                     ...........................................................................................................gfs----......-AS...LPGTTAAHQLVVSI.RQ.KCT.......PEE....VLGVLKDLPNPR..SE.EE.-TD....SRFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........LYV..FKIL............AES......................................................EEAQI..C...V....L.RNMFELWH.HHQ...Q...MMVVLVDK.MLKIQ.IV.ECS.AVANWI..FS......................................................KEM...TAE.F.T.K.M.Y.L..WEILHL.TIKKMNRH..............VIKLGGELAEAREKLARAe.......ssE-Se.............sE--Dedskk.................................................................kqsdneKPTE....EYVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGRD.YN.T----...............................................HWYKWT..IG..RL..QQVFLAHHEQVQK.............................................................................................
A0A0L0NHN1_9HYPO/531-776               ..............................................................................................................FKFN......NPD...TPFSKEGQELGALL.RC.KAL.......DEE....FQAVIDSIQSQA..SE.RA.---....LDPVA.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDA...........gSAS......................................................AAARA..Q...I....V.SAVMSYWQ.AHP...G...VALSIIEK.LLNYS.IL.TPF.SIVDWT..LVast...............................................pangTNG...GES.L.G.Q.A.H.I..FELVSN.TVAKVSGR..............---VRQVLTSHDA-----..........---...............----............................................................................----....----.-DD.EAREKE.T.K...A.M.KDLFRAIN.........D.............SLASWAGGN...................KDQM.M..E.DGDG.SG.--DKE...............................................ARIHRW..GQ..RW..LRVYQRMAAIEE-a............................................................................................
A0A1Y2EGM1_9FUNG/519-803               ..............................................................................................................YKYQ......NDDfgdQTLYEYAQEVYNAL.RT.KTP.......PQE....INIILDKIKSYI..SE.KN.QNA....ASMDIdeqd............ldpesTVLEIVVQ..SAM...MVGSKSFSHIL.N.VVE.R..Y.........ISI..LSTL............NET......................................................NEAKD..K...T....V.RYVADFWK.YNP...Q...FLEIILDK.LVNYR.VV.DPK.NIITWI..LS.....................................................dIIL...SDQ.Y.T.H.L.Y.V..WSILRN.TLKKVVLR..............VQQIKAKLEYNKKLYREQ.........eE-Q..............eKSEDaetn....................................................................etmrISHD....ESIA.NLE.RTQDIV.I.R...D.Q.KETFICVF.........Q.............RFVETTEIK...................IREF.E..T.QSID.PV.K---T...............................................PWWRW-..VV..GF..IRNVGRTYSTEI-q............................................................................................
A0A1G4KL50_9SACH/581-821               ............................................................................................................lf--FI......QPC...FPFNETVQNVINYF.HK.QPL.......ERS....SSELMTIFEELQ..NN.HG.NII....HDINR.....................LVVTILMQ..SLA...FSGNRSLSHAN.K.YIG.D..S.........RND..LLDI............MGKme.................................................vdqELKER..W...I....I.EAVIRYWN.SNS...Q...NGYLILDT.CKNFE.LI.SAK.SILNFS..FLe....................................................dNDR...NWG.L.V.D.A.T.S..VESTFR.TLTELSLR..............------------------..........---...............----............................................................................----....----.---.------.R.D...A.S.VETFLYVF.........E.............RLVEIASET...................VEKL.G..V.ASDV.AV.-VVPKdstai.....................................relelSWKYES..CL..GF..IKSILRKYADEY-t............................................................................................
A0A0G4IX35_PLABS/559-706               .......................................................................................................ddegkre----......---...--------------.--.---.......---....--ELCQKIHSRA..PF.DD.--L....LEVAQ.....................NDVELIVN..CIL...WHGQKSYSHFF.S.RFV.L..Y.........ETE..IADR............FK-......................................................-ENPG..S...L....I.GVVGKFWA.QSP...Q...RIAVIVDK.MMRHA.VV.PYE.GVVDWL..LGsy..................................................yrETA...QDV.Q.A.R.S.Y.V..FCILHN.AID-----..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------cakldgadvagrcv...............................................................................
A0A1D6RVT3_WHEAT/666-874               ......................................................................................................qfhvsdrp----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak.........aikE-LEeaksileivegqpvpser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLALG.L.E...E.G.KELLRLLF.........K.............SFLDVLTERlppvsa.......dgdvpnL---.-..-.----.--.-RAGDpnvtfpasdpeaatmeidne......ngadnnsqvnrenteagytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A182JWI5_9DIPT/6-289                 ............................................................................................................pa----......--S...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVVVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaaspnaqk........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVQK.............................................................................................
A0A284QXT3_9AGAR/520-815               ..............................................................................................................FEFD......DPI...NTHHDNAQSVLNLF.RG.RAN.......AED....VISHLDALRSAV..EA.SE.DGH....VNTDS.....................IVRSIAIQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LPL..LRHI............VNSga.................................................tgnVEAKT..D...V....M.NAVARFWK.YNS...Q...MVVIVFDK.LMQYQ.IV.DPT.DVVAWT..FEhgr...............................................teddVLG...SPL.A.L.G.V.L.Q..WDLLKG.ALDKGNGR..............VSIARKKLTVLRKEDDDT..........RARaiae.......dgasM--Evdae...................................................................akkneMPEN....PALT.SAI.KAFSTL.T.R...E.Q.KSVLSRTL.........E.............GFMSYLVPSsp..............dviT---.-..-.EKAW.HN.R---Anw..........................................gkeEWNTWE..TW..GW..YRHFCRVYSPYL-r............................................................................................
A0A0A2JUZ3_PENEN/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLS.VID.ETLARE.R.T...D.M.EALFKYIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGTL.PE.D----...............................................GIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A0R3PMY3_ANGCS/475-640               .........................................................................................................mlmkt----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...--TAKSFSHTF.V.ALT.R..Y.........SLT..LKTV...........aDSS......................................................DEMQE..V...L....L.QTLFHCWR.NNH...L...RLIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................GSL...RSE.T.H.K.Q.W.K..WEVLNT.ALERLSRH..............IHKVAHDVQILQKRVKHQri......ggDDE..............mDDMDv..........................................................................kTREQ....EELE.QQK.EKLENL.K.D...F.Q.KSLFLDVL.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------hv...........................................................................................
A0A1D6K2V4_MAIZE/137-483               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
A0A1B8CNJ7_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVMEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A0C2X9S7_HEBCY/536-856               .............................................................................................................h-EYD......DPA...TPHHDAAQAVLNLF.RG.RAK.......IED....VFTHLEALKTSL..ET.SE.EGH....VNVDS.....................IIRSIVLQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNL............TSGgisna............................................gggvnPEAKA..D...V....L.TAAASFWK.YNR...Q...MVAIVFDK.LMQYQ.IV.DPT.DVVAWT..FMngva.............................................vgqlaELG...GPM.N.L.S.A.F.E..WDLLRG.ALDKANGR..............VTIARRKVAALRKEDDDAra......rvKARa.............dETMEidaepkeen..........................................................qdakvpettPTDN....PALA.TAL.NAFSSL.T.K...E.Q.KTALSRTL.........E.............GFVSCLAPT...................SSDL.H..A.NPQA.R-.-TVITekawnn..................................ranwgrdEWNAWE..TW..GW..YRQFCRAYSPYLK.............................................................................................
A0A0N1P1T4_9EURO/543-788               ..............................................................................................................-KYE......KED...TPFSATFKEIVQSL.RK.RAP.......IEE....VKPLLEKVEGDA..EA.AG.YDA....VQAKT.....................VVLDVLIT..SIA...WVGSKSLSHVL.S.MVE.R..Y.........KPV..IDEL...........iGGD......................................................LAMQS..Q...L....I.ASFVEYWQ.FQL...G...VAITIVLK.LVNYQ.IV.TPL.GVVSWA..FNp...................................................agGDG...GRN.L.S.K.V.F.V..WEAVTG.VLLKVENK..............---VRELVRATRTP----..........---...............----............................................................................GLED....EERE.RVK.AVLDAEmR.D...S.F.HGLLAQIK.........N.............GLQGILQGG...................Q---.-..G.GLTE.ED.E----...............................................ALVKVW..IA..KW..QW-----------amdrrekv.....................................................................................
A0A0P5IV70_9CRUS/486-779               ..............................................................................................................FKYQt...egGNG...LPGATQVQALTELL.RK.KPT.......PEE....VLELIQQLPNPL..KD.DD.GDM....EPSHN....................pLAIEVFVQ..TLL...HLGSKSFTHTF.A.GLA.K..Y.........HSV..FKTI............CEN......................................................EEAQI..C...M....L.RQVYELWQ.NHP...Q...FLGVVVDK.MLKTQ.IV.ECC.AVANWI..FS......................................................RDM...APE.F.T.R.S.Y.I..WEILHL.TIRKMNKH..............VVRLEKEVADARAKLRAAp........sD-Se.............sS--Dddpnreagekrrr..................................................tvsnkdtpkdgeeQPTE....EMVE.RME.ERLEAA.Q.S...D.Q.KNLFLIVF.........Q.............RFIMILSEH...................VVRC.D..T.DGKD.FN.T----...............................................FWYQWT..VG..RL..QQVFMAHHEQVEK.............................................................................................
A0A182L8H1_9DIPT/11-294                ............................................................................................................ve----......-SS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaspnaqk.........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
C5DI24_LACTC/581-829                   .............................................................................................................l-FFT......ESS...LPFSDLVQQIVNYF.HK.QPL.......DRN....ISELVSILEKMK..VD.NE.TIV....VDFNR.....................LAVTTLVQ..VLV...FSGNRSISHAN.K.YIG.D..A.........RTE..LLEIlg.......kieASQ......................................................EQKER..W...I....V.EAIIRYWN.CNS...Q...NGYLIADT.CKNFD.LI.SSK.SILDFS..FLd....................................................dKGR...NWG.L.V.D.A.T.S..IESTFR.VLSELSSR..............------------------..........---...............----............................................................................----....----.---.------.R.D...T.S.VETFIFVF.........E.............RLVEIASNV...................VEEL.G..L.SVDS.EL.SASMAdpdemqde..............................sadlqkldcSWKYEG..CM..GF..VKSVLRKYADEY-a............................................................................................
A0A1V6QAU9_9EURO/531-784               ..............................................................................................................FKYA......SDM...TPYFKEGQELMQLI.RK.KAT.......DEE....IQPVIAAIEEQA..HS.QG.V--....EDPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAL...........gTES......................................................PRARC..Q...I....I.TSVMEYWA.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.A.H.I..FEMISA.TVGKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLT.AID.ETLVRE.R.A...D.M.QTLFKFIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGDL.PE.D----...............................................AIIRQW..GR..RW..LRVFCRKAAVEE-n............................................................................................
I1MLB1_SOYBN/485-828                   .....................................................................................................fsfgaeddk----......--E...SNEHVLSGQLNNMV.KG.KAP.......VRE....IISWIDESVLPN..--.-N.G--....---LE.....................VTLRVVVQ..TLL...NIGSKSFTHLM.T.VLE.R..Y.........GQV..FAKL............CPD......................................................QDKQV..M...L....I.AEVSSFWK.SNT...Q...MTAIAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................AEN...IEQ.F.H.M.S.DrP..WEILRN.AVSKTHNR..............ISDLRKEILSLKKNISSSe........eA-Ake...........akA--Eldaaeskltlvdgepvigd......................................nparlnrlkshaektkeevVSLQ....ESLE.AKE.ALLSRA.I.E...E.N.EALFLLLY.........K.............SFSNVLTER...................LPEG.S..R.TLHE.LK.SAQVDvvmavdpeepssmeldnqn........qrpqnshtngekkggaynvgEKEQWC..ITtlGY..VKAFSRQYAA---ei...........................................................................................
A0A094CF23_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTIIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWA.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQA.M..E.EGTG.ET.--PDE...............................................AFIRRW..GD..KW..LRVFRRKMAVEE-a............................................................................................
G4VPN2_SCHMA/522-896                   ..................................................kqemrsrlkarrrilresamkrnlkissednadeqvgvrsdsveklpfttapqvselspg----......---...--------------.--.---.......---....------------..--.--.---....--VTN.....................LAIELFYS..AML...IAGHKTISHTF.A.FIK.K..Y.........AAV..IRTL............TST......................................................VETQV..E...A....L.HVIQAVWA.NNP...Q...MIVIITEH.MCRVG.LI.DPE.AVVRWA..YSpimttlt.......................................ddtvnlnsANA...RPK.I.L.D.F.Y.V..WECLSR.TLVRVGRR..............VTRITNRLELAKETMEIN.........rR-Sspys.......tpdrE--Dadqggdgdsfsrtgvdsdsffkkpkdsis.................grvkvsdrrklmagcelvsssddeaygggkDNVG....GRVA.RLE.EARCEA.V.R...S.Q.CAVITLLL.........H.............RHARLTAEL...................ASEM.S..G.--PS.QN.HSFNTdspfflhept..........................qpkslsdealrNIMFWL..KG..RL..VQVVLEHCD----qli..........................................................................................
A0A0D2W9D3_GOSRA/483-829               .............................................................................................................f-KYSga.ddqEKT...EQEQALSAELSNKV.KG.RQT.......ARE....IILWVEETVYPI..HG.Q-.---....----E.....................ITLSVVIQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..MAKL............CSD......................................................QDKQV..M...L....I.SEVGSYWK.NNA...Q...MTAITIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IEQ.F.H.I.SdR.P..WEVLRN.AVSKTYNR..............ITDLRKEISSLKKSVVSAe........eA-Ask...........akA--Dleaaeskltlvegepvlge......................................nptklkhlksvaektkeetVSMH....DSLE.AKE.ALFARA.L.D...E.N.EVLFLSLY.........K.............NFSNVLMERlpda..........srdgtL---.-..-.----.--.-----...............................................------..--..--..-------------qslksvngdsmavdieepstmevddenerpkksqsnggkttngynvrekeqwclstlgyvkafsrqyasei......................
A0A0N4ZFL0_PARTI/493-768               .......................................................................................................lndvden----......---...--VYKISQDLAESL.SK.RMS.......NDD....LLEFVKDSVKNE..EKmEY.DQV....NLYDK.....................DKIKILLA..TLL...DLAKNAYTHNV.T.FFL.R..Y.........RPA..LLEI...........vKDD......................................................DQNRQ..L...I....L.DSIFTAWR.FNP...Q...LIELITDK.LLKMQ.IL.DTA.SIVKYI..IG.....................................................sQNL...GDF.I.D.R.R.Y.F..HQVLYL.SIHRFSKH..............VNNLCSAHDKLKYQIESV..........ERQltks.......ecidE--Qlnhnmdn.............................................................eidinsleN---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------peewlyvqkglleekeilysqnlkqlqviledvicyylsnisminknednilydfaygrlkqfii............................
A0A091LIY9_CATAU/358-638               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1D6K2V7_MAIZE/443-789               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
A0A0F0I9Q9_ASPPU/529-782               ..............................................................................................................FKYS......LDT...TPYANEGTEIMQLI.RK.KAT.......DDD....ILPIINAIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWT.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QALFKVIE.........D.............SIMSVAEGHnd...............elMERG.D..G.SGEL.PE.D----...............................................EIIRQW..GR..RW..LRAFRRKAGVEE-s............................................................................................
B7Q634_IXOSC/481-749                   ..............................................................................................................YRYAk...egAES...IPGAATAARLSTSI.RE.KCT.......PEE....ALEVLADLPNPL..QE.DD.VE-....PAHNP.....................LKIQVFVE..TLL...HIASKSFSHSF.A.GIA.K..F.........HYV..FKSL............AST......................................................EEAQI..C...V....L.RSTFN---.---...-...MMIGLVDK.FLKTQ.IV.ECS.AVANWI..FS......................................................KDL...AAE.F.T.R.S.Y.V..WEILHL.TIRKMIKHepp.......tdlmVERMEEKLEATQSDLKNLfl......iiFQS...............EDKE............................................................................PPTD....LMVE.RME.EKLEAT.Q.S...D.L.KNLFLIIF.........Q.............RFIMSLTEH...................IAHC.E..A.EGTN.FQ.T----...............................................HWFRWT..LG..RL..QEVFFQHHEHVFK.............................................................................................
A0A152A233_9MYCE/489-709               .......................................................................................................menkelv----......---...----SESHKLLLLF.TT.KEP.......LDG....IISHIANIPASV..--.--.---....-----.....................NVVELLTK..CIL...HIGVTSFSHLT.Y.AIE.R..Y.........ITL..FKAV............FKT......................................................PADHQ..E...C....I.RSILEFWR.NSQ...Q...HQVIVIDK.FVTFK.IL.NPQ.DTIQYF..FR......................................................PEN...YSQ.I.T.E.T.S.T..WEIIHN.SIQKTMIV..............IDVLSQDLEANKD-----..........---...............----............................................................................----....--SA.EIQ.QKLDSA.L.Q...E.Q.QQLFITLL.........N.............GLNDQIQSS...................VVQS.-..-.----.--.H----...............................................PLNLKL..IT..GY..LKSVSRKYFNQI-k............................................................................................
A0A010Q1H3_9PEZI/545-791               ..............................................................................................................FKFS......DES...TPFSAEGREIAALL.RR.KAP.......DEE....FQPIIERIHSLA..IE.RT.---....LDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EAAKS..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.SVIEWA..LSggs...............................................hvqgQSS...GDS.L.A.Q.P.H.V..FELVFG.TVSKVTGR..............---VRQLLAKEAEA----..........---...............----............................................................................----....----.-DE.DLKERD.T.K...A.M.RDLFKAME.........D.............ALVSWASGS...................KDEM.M..E.EMD-.-G.AGQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
G7YES0_CLOSI/524-852                   ...............................................................................................egelmsstetasqlt----......---...--------------.--.---.......---....------------..--.--.DLS....HGVTS.....................LLTELFFS..ALF...IAGHKTISHTF.S.YIK.K..Y.........ASA..IRTI............AST......................................................VEIQV..E...A....L.HVLQAVWI.NHP...Q...MIVIITEH.MCRSG.LI.DPE.AIVRWA..YSpimtslt.......................................eipigynpAGA...RPR.I.L.D.F.Y.V..WECLNR.TFMRVGRR..............VTRITNRLNAAKELMETEglrs.vspgsE-Rrdk.........spdD--Dddddendkrqrlgstrrpdrrna..............................magyemvsseneededdalfggkGSSG....SRVA.RLE.EARCEA.V.R...S.Q.CAVITLLL.........H.............RHACLTSEL...................AAEI.A..G.DDLD.IS.SVS-Rsstallhssg..........................lklglskqalqHIAFWL..KG..RL..VQVVLEHC-----dqlm.........................................................................................
G1S4W7_NOMLE/484-759                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
K7FR76_PELSI/202-482                   ..............................................................................................................YKYGd...esNKS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFGILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIDVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VVKIQKELEETKARLARQ.........hKRRd............sdD--Dyddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VI.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1V8SXE7_9PEZI/559-810               ..............................................................................................................FKYA......SDN...LPYATEARALLKLL.KE.KAS.......EEQ....IQAIFDDISDQA..SS.HG.V--....PDPLV.....................SSTDVYMT..CIL...NVGSKSMSHVI.S.NID.R..L.........KDK..LSAL...........aTQS......................................................EAARR..Q...I....I.SSVVDFWS.LHP...G...NAANIVDK.LLNYT.II.TPM.SVIEWA..LHe....................................................rMDR...GRA.L.A.S.A.Q.M..YELVSH.TVAKVSAR..............---VRQVLQQRANT----..........---...............----............................................................................SLPF....DQRQ.VID.AVLPRE.R.Q...T.L.RDLYATIE.........D.............AVASVANGS...................QDEM.-..M.ERYE.GG.-EEER...............................................AIIMQW..GE..RW..VRVWRRKAAVEE-a............................................................................................
A0A1A9Y8W0_GLOFF/3-254                 ............................................................................................................lk----......-SS...LTGTQVAHQLVVAI.RQ.KCS.......PEE....VINILKELPNSG..EN.SD.QEM....SDSSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKIQ.IV.DCS.AVATWI..FS......................................................KEM...---.-.-.-.-.-.-..---TGN.ELNDAKEK..............FAKADSSSSDSEDEAAPK..........-RKk............pvTVVD............................................................................KPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..VG..RL..QQVFLMHHEQVQK.............................................................................................
A0A078A463_STYLE/472-727               .........................................................................................................lkycn----......--E...SQDNPDAQIILDKL.NS.KET.......PKN....LFEALVGEQSKL..EA.TG.E--....-----.....................QLKEIFLE..CIM...ARTKKSLEHLK.R.FIEiY..Y.........HEI..IKPFf.........lgTTI......................................................AESQI..T...L....M.KSVCQMWI.NNP...R...KNLQIIDK.LFSLG.LV.IPK.YAVQYC..LDsli................................................rkiSEN...EEL.S.Q.D.L.I.E..FKILNN.LSQLVNQR..............QQQMFTLY----NQKDMPq.......ssKEKm.............sI--Degasthq.............................................................hldlsyskRVQI....KNNE.DFI.KEFEQG.Q.K...E.K.EETLTLIQ.........K.............GLFDLVDNS...................ENK-.-..-.----.--.-----...............................................------..--..--..-------------ivadqsiill...................................................................................
A0A061GTR0_THECC/484-830               ..............................................................................................................FKYSve..dgGER...TEQHAISAEISNKV.KG.RQT.......AHE....IISLIEENIYPA..--.HG.---....---LE.....................ITLSVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CPD......................................................QDKQV..M...L....I.AEVSSYWK.NNA...Q...MTSIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IGQ.F.HiS.D.R.P..WEILRN.AVSKTYNR..............ITDLRKEISSLKKGVISAee.....aasKAKa............alE--Aaeskltlvegepvlgen.........................................parlkslktqaekakeeeVSIH....DSLQ.AKE.ALLARA.L.D...E.N.EVLFLSLY.........K.............NFSNVLVERl................pdA---.-..-.----.--.-----...............................................------..--..--..-------------sragtlqalksihgdsmavdleesstmevddengrpkksqpngskatniynvgekeqwclstlgyvkafsrqyasesn...............
J3P394_GAGT3/538-792                   ..............................................................................................................FKFA......KDD...VPFARQGREMVKLL.KS.KVP.......DEE....IQPLIEQIQNEA..VD.QG.---....RDPLV.....................SSTDVFMT..AVL...AVGSKSLSHVL.A.CIE.R..V.........KDR..LLDS...........gSAS......................................................AAART..Q...I....M.AAVMSYWS.AHP...G...VALSIVEK.LLNYA.IL.TPQ.VVAEWA..VSg....................................................eASD...EAR.L.A.H.A.Y.L..YELVLN.TVIKVSGR..............---ARQIVAQQEAAKPAA..........--Dg............dlAMTD............................................................................ASNG....DGPD.HVP.YADTPE.A.K...D.L.RELFQLIE.........S.............AVKARSASS...................VLAA.-..-.----.AG.D----...............................................PLARQW..VD..RW..LRAFQRRAAVEE-n............................................................................................
A0A0P7B6P1_9HYPO/534-779               ..............................................................................................................FKFK......NPD...TPFSKEGQEIGALL.RR.KAP.......DEE....FQPIIDSIQTQA..TE.LA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLDA...........gSAS......................................................DAARA..Q...I....I.SAVMAYWH.AHP...G...VALSIVEK.LLNYS.IL.TPF.SVIDWA..LVast...............................................pangTNG...GES.L.A.Q.S.H.V..FELVSN.TVAKVTGR..............---TRQLLVSP-------..........---...............----............................................................................----....---D.ADE.ETRTKE.A.T...A.T.KDLFRAMN.........D.............ALASWAGGN...................KDEL.M..E.GGD-.-G.TSDRE...............................................ALIRRW..GQ..RW..YRVFKRMGAIEE-a............................................................................................
A0A177UPK9_9BASI/692-1080              ..............................................................................................................FTYE......PQS...HALHSHASEILRAI.RA.KAT.......HPV....VDTQLESLRRDI..IV.PS.GSD....VPPMDidgvqsnkl...mlsdpdaekVQRDVFIQ..CLL...LAGSRSFSHFL.N.VVE.R..Y.........HSV..LRQL............SSN......................................................PNARL..A...M....L.GAASRFWA.RSP...Q...WTLIVFDK.LLQYR.IV.EPA.DVITFV..FHppteldvvtqgsgnevgssf..............skttevtvnvpaegtaanstTER...LRD.W.S.T.F.G.W..WEVVKL.TVEKVNGR..............VDQLQARLATNEKNDEAD.........kE-Rkda.........aatT--Sgeghaagekdtngngattsgattg............................slfpssaaeversmreaaekaereRVMK....NATG.EAR.KALEAI.R.I...E.Q.RKVLVGTT.........S.............GFVHLLQVTeal............agpkTVEM.D..E.DTEE.GA.NNDDVpt..........................................neiEWRAWW..VG..KW..YHEFVRLFAKHL-s............................................................................................
A0A0B2WQP4_9HYPO/534-780               ..............................................................................................................FKYM......NSD...TPFAKEGQEISGLL.RR.KAP.......DEE....IQPLMDSIQAQA..RE.QA.---....LDPVV.....................ASTDVFVT..AVC...WVGSKSLSHVL.A.CID.R..V.........KGR..LIDV...........gSAH......................................................PGARA..Q...I....I.SSIMDYWA.AHP...G...VAIIIIEK.LLNYS.IL.TPL.SIVDWT..LVaast..............................................apngARG...GAA.L.G.D.A.H.M..LELVAN.TVAKVSGR..............---VRQLL----TSPD--..........---...............----............................................................................----....----.ADG.GTCDKE.V.S...S.M.RDLFAAVN.........D.............ALASWASGT...................KDQL.M..E.DGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRLAAMEE-t............................................................................................
A0A1D6K2V6_MAIZE/538-884               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
A0A182J1C2_9DIPT/5-267                 .......................................................................................................qfhsvdp----......DTS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPILG..DS.SE.TEM....TETTFn...................pLKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HTV..FKSL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................K-E...MVG.R.E.M.N.E.A..KDKLAR.TAESSSSE..............---SEDEASTNPQR-RRK..........NAD...............GSGE............................................................................KPTE....EQVE.RME.EKLEAA.Y.V...E.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A167W2D8_9HYPO/535-773               ..............................................................................................................FKFS......KPD...TPFSKEGQEIAALL.RR.KAP.......DEE....LQPVVESIQAQA..TE.QA.---....LDPVV.....................TSTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LVDV...........gTAN......................................................AAARL..Q...I....I.AAVTNYWS.AHP...G...VALSIIEK.LLNYS.IL.TPL.SIVEWT..LN......................................................R-D...GDA.L.S.K.P.H.M..FELVFN.TVTKVSGR..............---VRQLAVSPDAE----..........---...............----............................................................................----....----.--Q.ELRDKE.V.A...A.M.RDLFRAIN.........D.............ALASWASGS...................KDQM.M..E.EDGD.-G.SSAHE...............................................ALLRRW..GQ..RW..LRVFSRRAAIEE-t............................................................................................
A0A2B7WM85_9EURO/561-813               ..............................................................................................................FKYA......LET...TPFATEAQEIMQLI.RK.KAP.......ESE....IEPHILAIQQAA..AS.QP.D-I....ADPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLAI...........gPKS......................................................PAARR..Q...I....I.TSVLSYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hLEG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQA----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...D.V.QVMFEVIE.........G.............ALDGVINGS...................IESG.S..G.--ME.DV.GEEEK...............................................VIIREW..AT..RW..RRVFKRLRAVEE-a............................................................................................
A0A0H2RDM1_9HOMO/527-814               ..............................................................................................................YEYD......EPS...KPHHDTAQSLLGLL.KG.RTK.......ADE....VITHIETLKNDL..AE.S-.EIN....ANVDT.....................LIRSMAIQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPV..LRHL............APT......................................................SDAKL..D...I....L.LAAADFWR.RQR...Q...MVLIVFDK.LMQYQ.IV.DPS.DVIAWA..FSkg..................................................snAST...SPC.R.I.D.A.F.R..WGLIES.ALDKANGR..............VAIARRKVVALRKEEDES.........rA-Rata.........sgnM--Evdadva...............................................................aeteeapVVDS....PALT.NAV.KAQTTL.I.K...E.Q.KAVLSNTL.........G.............KFIDKLKDT...................SSIL.S..E.KAWQ.NR.ANW-Ed.............................................aEWETWE..TW..AF..YRNFCRLYAPYL-r............................................................................................
G2YWH9_BOTF4/338-585                   ..............................................................................................................FKFD......DPS...TPFSAEGQEILALL.RK.KAT.......EEE....IQPVVDRIHALA..VE.QA.--L....PDPLV.....................PSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KDR..LLAI...........gPVS......................................................PVARR..Q...I....I.TSVMQYWK.DQP...G...IGVNIIDK.LLNYT.IL.SPQ.SVVQWA..IG......................................................S-E...GKR.L.S.Q.S.F.V..YEMVEA.TVGKVTGR..............IRQVQLSL-------RVP..........---...............----............................................................................GLLE....EQKQ.LIE.KTVEME.R.I...N.M.RELGREMD.........E.............LLTAWANGS..................kDQEI.E..M.DGRE.ED.R----...............................................ALVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
M2T3B7_COCH5/564-819                   ..............................................................................................................FKYDn....pALD...TPYAVEGQTLLNQL.RK.KAT.......AEE....VQVTIDSIHEKA..VA.QG.V--....GEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................ETARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPQ....EQIE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............STRGVAEGS..................aDTML.E..K.SSSG.AL.TEEEV...............................................ELIKSW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A093H9N5_STRCA/499-777               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFNILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKAL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VLKIHRELEETKARLARQ.........hKRRd............sdD--Ddddrs..................................................................sdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LARC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
D0MS56_PHYIT/605-857                   .....................................................................aaspasdfyqsvttklkghppasalrswlneelprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAVEVVWT..CIL...EAGAATFTHMR.L.LLE.K..Y.........GKR..SELFggd.....eqsaEET......................................................EADEL..V...V....V.KTVASVWL.KSP...Q...HIGLILNS.MLRQG.LL.RPA.TIVTWV..FT......................................................PDA...VQQ.Y.S.W.P.Y.V..WEILND.TLKFVQDA..............IAAKTQQLEQASAPRSS-..........---...............DDRD............................................................................NEEM....PDVA.ALE.DGRKRL.Q.D...E.L.RQLLVMLF.........R.............GLNRVITEH...................KAEC.D..S.EGSD.PR.D----...............................................NWFRSA..LA..QM..QAVGLRHR-----vple.........................................................................................
M1URS2_CYAM1/727-1017                  .........................................................................spaasllasipepvkvelaqrlvasaydavpylnehv----......---...--------------.--.---.......---....------------..--.--.---....--PKE.....................LRPAVFLQ..ALL...RGGYGAPSFFA.N.LVE.R..W.........GGV..LRELc.........rdPGA......................................................AAAGL..Q...L....V.SVVLQVWE.SSH...Q...HALLSLNC.LSSAG.IL.DPS.TVVTGV..YRqllnr...........................................yptsddL-S...FAA.L.N.DlR.F.P..FETVRF.FLNQYRDR..............LRRIQTDIEMLLLAIS--..........--R..............aPERD...........................................................................lDTME....AALT.RAR.QMLQQH.R.Q...G.L.KRFLAATL.........D.............SLAQILRHYhg..............ssgG---.D..R.GDRD.HH.E-T-Ddhedhggtasats.....................astgdtapaalvrGWLLER..SL..GL..VQELLRT------qldqt........................................................................................
A0A136J743_9PEZI/534-773               ..............................................................................................................FKYN......DEQ...TPFSTEGKELAALL.KR.KAP.......DEE....IQPVIDRIHSMA..LD.QA.---....LDPLV.....................TSTDIFMT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDA...........gAAS......................................................EAVRA..Q...I....I.SAVMTYWS.SHP...G...VAVSIVEK.LLNYS.IV.TPA.AVIDWS..LVsd..................................................raGKY...GEA.L.S.K.S.W.V..FELVFN.TVTKVTGR..............---YRQVV----------..........---...............----............................................................................----....--SD.NAG.EAPEDE.I.S...A.M.RDLFKSMD.........D.............SLSSWAQGT..................kDQML.D..P.ASAD.GG.E----...............................................DLVKRW..GQ..RW..LRVFRRKSAIEE-a............................................................................................
M5WNM4_PRUPE/485-830                   ......................................................................................................fkfsveet----......SEG...NGQHALSVDLRTMV.KG.RAS.......ARE....MIVWIEESVFPV..HG.ME.---....-----.....................GTLNVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CGD......................................................QDKQV..M...L....I.TEIDSYWR.NNS...Q...MSAVAIDR.MMGYR.LL.SNL.AIVRWV..FS......................................................PAN...IEQ.F.H.L.SdR.P..WEILRN.TVSKTYNR..............VCDLRKEILSLKKSIVSAe........eA-Aatak......aelvaA--Esklslmdgepvlgenp...........................................vrlkrlksyaekakeeeLSVR....ESLE.AKE.ALLARA.L.D...E.F.EALFLSLY.........K.............NFLNVLTERlpsastc....vtlqglksI---.-..-.----.--.----Hadsmavdveessamevdden.......grpkksqlnggrmssvynvgE-----..--..--..-------------keqwclstlgylkafsrqyasei......................................................................
A0A068YAH4_ECHMU/628-946               ...........................................................................................gksrpakneltsskrarnk----......---...--------------.--.---.......---....---------E--..-K.ME.DNE....DDFDNclvp.............gvtnRELELFMT..ALL...YRAHKTISHTC.S.LLN.R..Y.........SEA..FKTL............AST......................................................VELQV..E...A....L.HILQAVWC.NQS...Q...MVVAISDY.MSRQG.ML.DPE.SVVGWA..FSpfmsafcg......................................plapppstVHV...CPR.M.L.Q.S.H.V..WECLMH.TLVRVGQR..............IAQITPRLEAVKDQAGVHh........rK-Sas..........gsrS--Dgsssdldndygdgdlrtkivr.................................vrrrhqrhcrvgshgsssggggGTSP....DRLA.RLK.EERGEA.V.R...S.Q.CAVITLLL.........H.............RHVRLVATVea...............kaTEEM.G..G.PDNP.SD.LVDLA...............................................SVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
A0A180GCG6_PUCT1/625-960               ..............................................................................................................FEYE......DPA...HRDHLAALDVVQLL.KH.KEP.......VSR....LLDYLTKMQERL..AA.E-.GIE....ESVQD.....................VTREVAIQ..ALL...NVGSRSFSHFL.N.ILE.R..Y.........LEL..LRNL............TNS......................................................ASARA..S...L....L.QTVSKFWR.KNG...Q...FELIVIDK.LLEYR.VI.DPI.DSLRHS..FE......................................................TYK...TSQ.W.G.E.L.Q.F..WDGMKM.TIEKVTRR..............VKASRTKLAKLKKDEEDQr........dR-Qraag.......geilE--Agngaanmgdinmkdgidgeeg.................................kkdeerteevkgetiqlkeeleTMRR....GEIA.TAE.RELEAN.L.T...E.Q.VIVLAEAI.........G.............RFSSARSEA...................EERL.K..N.EQDS.QP.A--DEvvepsncdqkd.........................qvrkvsakdvaFWKAWW..LR..GW..CREFYRLFGPEI-s............................................................................................
A0A093HJ93_STRCA/444-717               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFL--------q............................................................................................
A0A0E0GMC2_ORYNI/483-829               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRKYATE--i............................................................................................
A0A2H3E336_ARMGA/520-815               ..............................................................................................................FEFD......DPI...NPHHDNAQSVLNLF.RG.RAN.......AED....VISHLDALRSAV..ET.SE.DGH....VNTDS.....................IVRTIAIQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LPL..LRHI............VNSga.................................................tgnVEAKT..D...V....M.NAVARFWK.YNS...Q...MVVIVFDK.LMQYQ.IV.DPT.DVVAWT..FQhgr...............................................teddVLG...SPS.A.L.G.V.L.Q..WDLLKG.ALDKGNGR..............VSIARKKLTVLRKEDDDT..........RARaiae.......dgasM--Evdae...................................................................akkneMPEN....PALT.SAI.KAFSTL.T.K...E.Q.KSVLSRTL.........E.............GFMSYLVPSsp..............dviT---.-..-.EKAW.HN.R---Anw..........................................gkeEWNTWE..TW..GW..YRHFCRVYSPYL-r............................................................................................
A0A0F2M4P4_SPOSC/607-939               ................................................................................................fkyaepkegaaata----......ADD...VPFAAEGRELAVLL.KR.KAA.......DED....VQAVIERIHSQA..LD.AG.---....LDPLV.....................TSTDVFTT..AVL...WVGSKSLSHVL.A.AIE.R..T.........KDR..LLDA...........gAAS......................................................EAART..Q...I....L.VAVMAFWG.AHS...G...VAVSITEK.LLNYA.IL.TPD.TIVQWA..LSkn..................................................dqKGA...SAS.L.A.V.N.Y.V..AELVFN.TVDKVTRR..............---VHQLVGASQTAATAVaa......atQ-Avea.........areR--Qrnppppppppsaavaapkdgdldvamdedaga...........assthaaasamaeavaaaaadadaaveaaeaarVQAT....ADLE.AAR.AAEAAE.T.K...A.M.RDLFRLLG.........E.............ALQPWLAGD...................D---.-..-.----.--.S----...............................................GLAKAW..AV..RW..QRVVQRRAAVEE-a............................................................................................
A0A182NQV2_9DIPT/1-282                 ..............................................................................................................----......--S...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKDKLARTv........eS-Sss...........esE--Eeeggepnpqk........................................................rrkntetageKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A0E0KDN5_ORYPU/442-788               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDGQIIPV..--.--.---....-NGAK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.QI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAAkv.....aseK-Aa............reL--Eeaksiieivdgqpvpsen........................................pvrlrrlqvradktkaeeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnsaardpeattmeidne......ngadndsqlngqnkkighnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A287D7F1_ICTTR/449-724               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VVKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1B9I912_9TREE/593-882               ..............................................................................................................WAYE......KPD...HPLHAEAKELLQLF.RS.KAT.......TSD....IRLHLDNLPGSE..EG.IS.---....----A.....................NVRKMVFE..TLF...QLGSRSFSHFL.N.ATE.R..Y.........IDT..LRYL............TSD......................................................QASRK..V...L....L.SAVWDYWK.YSH...Q...QKLITVDK.YLQYG.IL.EGL.DVVEYL..FEedg................................................dteGEE...GDG.W.T.D.E.W.K..WEILKM.TIEKHSGR..............VQAIKNRMKVIEREDESAr.......arR-Aaeilek..ggdvgegE--Dedl.....................................................................tdirPEGS....KAFN.DAQ.TSLDIQ.S.T...R.L.EKILISTM.........K.............QFISSLLPN...................----.E..I.AANQ.GL.KGVLTllqs.......................................gesaLWSVRA..KW..GW..YREFVRLYSAQ--ll...........................................................................................
A0A1I8GTG6_9PLAT/742-1052              .................................................................................................ykydieedfspev----......---...---VQSAQRLIDAI.RE.RCT.......PER....AIEVLNTLPVPA..GG.AE.NGG....PNERHl...................lLKVDVFFS..TLL...FLGSKSFSHSF.A.ALA.K..F.........HSV..CKALv..........pLDN......................................................QAAKL..R...V....L.ASLYECWR.WHE...Q...MLIVLLDK.LVKVQ.LV.DCQ.AVFDWL..FGdclg.............................................dsgegLLP...KQE.L.S.R.C.Y.S..WDAAES.TLSKMCKQ..............LARLNEDWAKARQRYDSY.........hE-Kmrs.........gtaGDEDaaaaqklptdq......................................................sgpaamlvdedTPTR....DELD.AKL.DRLEKA.R.Q...E.L.RLLVAC--.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------llrcavwgaegggipsdeacsgsgdeeanerhlrrlvyerslacltmhysdv.........................................
A0A0A0M082_CUCSA/485-828               .............................................................................................................f-KFSte..ddGEK...SEQHALSAELYNMV.KG.RAP.......ARE....LISWLDESVIPK..--.HG.---....---LD.....................VSLVVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..ISRI............CHD......................................................QDKQV..L...L....I.SEVGSYWK.NNT...Q...MTAIAIDR.MMGYR.LI.SNL.SIVKWI..FS.....................................................pENL...QLY.H.T.S.D.R.P..WEILRN.ALCKTYNR..............ISDLRKEISSLKKDVVAAe........eA-Aa.............rTQEElsaaesklslvdgepvlge......................................npvrlkrlksyagrakeqeI--Si..rDSLE.AKE.ALLARA.L.E...E.N.EILFLSLY.........K.............SFSSILTERlpa............saqtL---.-..-.--QD.LK.STNPAdanamdveepsamemdnves......rpekshlngrtehaytvceneQWCL-T..TL..GY..VKAFSRQYAS---ei...........................................................................................
NCBP1_CAEBR/487-763                    ..........................................................................................................ryll----......DEE...DAMSQRAETFTQMF.QE.RQP.......ADA....FLKELKSTDEND..EL.PY.N--....----I.....................NEFGVFVT..VML...KMASKTYSHNF.S.ALF.R..Y.........KDT..LKTV...........cDAA......................................................EQYQE..K...L....L.ETLYSCWK.SNQ...Q...MLMILTDK.LLKMQ.II.DCS.SVVGWL..FD......................................................EKM...WQE.H.N.R.Q.W.L..FEVLNQ.ALEKLTRQ..............INVVEKDIKDLTEKVESKek......vtE-Agd...........vkME-Eetvv....................................................................deklKGEM....EELE.NHK.EKLDRM.V.S...F.Q.RNLFNDFL.........I.............AFVEEIKSAa................tnTSEM.D..G.SGDV.GG.S--ES...............................................SKFLWL..RG..RF..CHVLLAHAETL--lk...........................................................................................
S8ADJ2_DACHA/535-781                   ..............................................................................................................FKFE......VDD...IAFPEEGKQLLNLI.RQ.KAP.......NEE....VDTLMNAITEAA..NN.KG.--L....PDPSK.....................YARDMYMT..CIC...HIGAKSLSHVL.S.CIE.R..C.........KDK..LTQL...........gQES......................................................NQAQR..Q...I....V.GTVMRYWH.EQP...G...IGANVIDK.LLNYS.IL.TPL.SVIEWV..IL......................................................DAG...RDA.L.P.R.G.H.A..WEMVNT.TTRKVVSR..............----TRNLAAARSVP---..........---...............----............................................................................DLPE....DQMT.MVE.QGHDVA.K.A...E.Q.AELFRVVM.........E.............SLGKYADGT...................VPPP.E..G.TTED.DA.-----...............................................VWLKWW..AA..SW..LRALKRQSDIEE-a............................................................................................
G3UGQ0_LOXAF/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMSKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTN.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHL----iiqq.........................................................................................
A0A2G2YIC8_CAPAN/485-827               ..............................................................................................fkysaeegtdpteral----......---...------SLELKDMV.KG.RKT.......ARE....IISWVEENVFPT..HG.F-.---....----D.....................ITLGVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........AQV..IAKM............CTD......................................................DDQQV..K...L....I.TEVSSFWQ.NNV...Q...MTAIAIDR.MMSYR.LL.SNL.AIVRWV..FS.....................................................pLNL...DRF.H.V.S.D.S.P..WEILRN.AVSKTYNR..............ISDLRKEISSLERSVVLAe.......gaA-Srar.........qelE--Saesklsivdgepvlge...........................................npvrikrltsyaekakeE--EvsirESLE.AKE.ALLARA.V.D...E.I.EALFLSLY.........K.............SFVTALAEP...................LHDA.S..R.DGTL.RP.SGDADdmtidledssvmeldkdde.........rpkkshpngsrerngynldEKQQWCltTL..GY..LKAFTRQYASE--i............................................................................................
K9GB08_PEND2/520-773                   ..............................................................................................................FKFS......SEM...APYSNEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTDS......................................................QHARR..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LTe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLS.VID.DTLVRE.R.A...D.M.QALFKYIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
C3Y2C6_BRAFL/446-544                   ............................................................................................kpkfvqevlgkcvsgsed----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........--E..............mQDMD............................................................................GVDE....EEIE.RLQ.ERLESA.Q.S...E.Q.KKLFLVIF.........Q.............RFIMVLTEH...................LGRC.E..T.SGKD.FN.T----...............................................AWYRYS..SE..RL..QQIFLQHHSTVT-k............................................................................................
X0CZL2_FUSOX/531-776                   ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AA-------..........---...............----............................................................................----....--PE.TDE.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
A0A090N3S9_OSTTA/510-740               ......................................................................................gklqqmlaekrqgyevvqwigseg----......---...--------------.--.---.......---....------------..--.--.ATM....ASPEV.....................LLRSLVVA..AL-...ERGQKCITHHD.V.LLK.R..Y.........AAP..IREL............VEK......................................................AGGEV..A...-....V.DAAVGIWR.GHY...Q...MAPIAVER.LLALD.LV.APS.AVVNWV..VQ......................................................--R...AAV.F.G.E.D.D.T..YEIAST.VCDFVCASea..........svVGKRSALVSKIRAAEAEAsg.....agrA-A...............--EElsaqgrsyeaqq....................................................aaaaeaqaveeiAQHE....AELA.AT-.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------eapiaranalaretclqlcgglvkasah.................................................................
A0A0V1KLW1_9BILA/510-772               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A059IYW6_9EURO/548-801               ..............................................................................................................FKFS......QET...TPYSKEGQELMKLI.RQ.KSS.......DEE....IEAVITSIEEQA..KT.HG.--L....TDPLI.....................ASTDVYMT..SIC...YVGSKSLSHFL.S.CIE.R..C.........KER..LLAI...........gPKS......................................................DAARR..Q...I....I.NSVMEYWV.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVLEWA..LVd....................................................nLAA...GST.L.A.K.P.H.I..FEMISA.TMRKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................TLYE....PQLS.ILD.ETLKKE.K.A...D.M.LSMFQLIE.........D.............TLVPVAGGY...................SDAM.M..E.-RTE.DD.SLQPE..............................................nVMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
B6K6M4_SCHJY/513-724                   ..............................................................................................................FPYG......AED...HPMNVTSHKITNQL.TM.REP.......IAS....IEAELSSFSQEE..--.--.---....-----.....................-ALRLFFS..CVF...HMGSKSFSHML.N.VFE.K..H.........IDV..IKHF...........sRAS......................................................SDSEY..I...V....V.SSLFEYWK.FQP...T...IAVTWADK.LLNYS.IV.GAT.AIIQWL..TK......................................................QDD...IRL.W.S.R.I.Y.V..WDLLTT.TLNKLDAR..............VKQFDNSEATEGTEENVL..........KEE...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------stterravyellrtrlpelaqsaslpwsahyvqlvqayle.....................................................
A0A250WP45_9CHLO/634-1008              .........................................................................................................rvsvw----......---...------AGELLGFI.RQ.KVT.......SES....ALEWLEEHVVTH..SE.SM.MD-....EDDKQghdnee........aatakaqLMLQVAMR..AVL...AAGSKTPSHLS.V.ALE.R..Y.........SSL..LSQL............MKNg....................................................gAGVQQ..V...L....L.REAAIFYR.QLP...Q...KLLMVVDR.LMALH.LL.EVS.ELVTWS..LHaaaeacddgy.................................tkhcnidtsgkEIQ...GSG.S.D.T.A.V.A..WEVLYY.GLQRAGSR..............LPQVKEKQARKEEEVEALrk.....kvlA-Aa............erA--Siesdampvpgpgneaeirr......................................vlarveaanneekllevklQQAE....AELE.LCS.KASDNT.G.V...D.A.SSALLATY.........S.............CFKNILHRL...................----.-..-.----.--.-----...............................................------..--..--..-------------elqahktqeaavaataeaeeagpaggeheeavegdgqerlsvaaaalatataaaaaerlelwyqqlrvfvrrfrvess...............
A0A0A2KK18_PENIT/534-787               ..............................................................................................................FKYS......SEM...APYSKDGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gAES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLS.VID.ETLARE.R.T...D.M.AALFKYIE.........D.............SIVSIAAGSnd...............eqMERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A1B8GSX3_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A0J6Y631_COCIT/532-785               ..............................................................................................................FKYA......QET...TPYSKEGQEILQLI.RK.KAS.......DEE....IAPVIASIEEQA..KA.HG.--I....ADPSI.....................PSTDAFVT..SIC...CVGSKSLSHLL.S.SIE.R..C.........KER..LLAI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIVDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLAA...GSI.L.A.K.P.H.I..FEMISA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................TLVE....PQLS.VIQ.DALTRE.S.A...D.M.RAMFRLID.........D.............SIVPVASGTnd...............vmM---.-..E.RDDD.SA.-LAPE..............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A093XLE1_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQT.M..E.GGNG.DT.--SDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A094IIM4_9PEZI/549-800               ..........................................................................................................iklt----......NLD...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.M..E.AGIG.ET.T--DE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A0N4TG51_BRUPA/1-160                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KPE.F.E.R.L.W.I..WEILNI.ALEHVSGH..............VRRNRQAIENAKLKKEEKe.......lnDEKdd...........fdM--Etneh....................................................................ddmaDPNA....VESF.VKE.SEFADL.H.E...C.L.KNLLLDVL.........H.............KFTVTLTEH...................IVNS.E..S.SGND.FQ.N----...............................................NWYLYV..TG..RF..KNVFLK-------vk...........................................................................................
A0A161VER2_9PEZI/546-792               ..............................................................................................................FKFN......DDN...TPFAAEGREIAALL.RR.KAP.......DEE....FQPIIERIHSLA..IE.RS.---....LDPLV.....................TSTDIFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EVAKA..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.TVIEWA..LAgss...............................................hvegQSS...GDA.L.A.Q.P.H.V..FELVFG.TVAKVTGR..............---VRQLL----T-----..........---...............----............................................................................----....KEAE.ADE.EAKERE.T.K...A.M.RDLFKAMD.........D.............ALVSWASGS...................KDEM.M..E.EMD-.-G.AGQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
G1LDU0_AILME/487-762                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
M3HQQ7_CANMX/613-790                   ..............................................................................................................FNFT......NSQ...LPFHEVGSRVYDFIlTH.WKS.......NTE....FNELYKSILADV..-D.V-.---....PNRER.....................FAINLILQ..TYA...YIGSRSIYSVV.S.IFS.R..D.........INK..LKFL............SGApidyvgeeaq.................................fedlhlteeqkENRQN..W...I....I.ESIFRIWV.HQP...Q...VVFLIMEY.LIEFG.VI.NPK.YLLSKS..LE......................................................S--...HLI.I.D.N.V.S.C..MESINR.ILSNSQS-..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------k............................................................................................
B4I3F9_DROSE/496-719                   ..............................................................................................................FKFV......DET...LPGAILSKDLLEAM.RCpRAS.......PKI....ISEIIKSSTGIG..--.--.---....P---L.....................LKINVFTQ..NCL...HLGSKSFSHTF.A.ILA.K..Y.........QSV..FKDL...........vKGD......................................................WDGQI..A...V....L.NGVFDVWV.ASD...H...YKFVVAEK.LVKVF.II.EPI.SIVTWI..FG......................................................PSM...RKE.L.T.K.M.Y.I..WELLHS.AVRHLKRV..............----QHDVEVVDVD----..........---...............----............................................................................----....----.---.-NPNAC.D.P...V.V.KSVLYTVV.........E.............RLVKILCSA...................P--F.A..D.EGTE.EH.-----...............................................YWFQWV..LG..RL..-------------eetlfiyaddfk.................................................................................
A0A1Z5TEZ1_HORWE/557-807               ..............................................................................................................FKYA......DDS...MPFAKEGREVLGLL.KK.KAP.......ESE....IQPVLDVVHSEA..AN.HG.---....VEPLI.....................ATMDVYAT..AIC...SIGSKSLSHAL.S.TID.R..C.........KER..LLAL...........aPQS......................................................EAARR..Q...I....I.SSVFEFWS.EHP...G...TAVNIVDK.LLNYM.IV.TPM.SVILWA..LQd....................................................hMDR...GRA.L.A.K.S.E.T..YELISI.TMNKVTTR..............---VRQIL----RERDNF..........---...............----............................................................................ALDF....SQRQ.AID.EALPRE.R.E...S.M.RTLFAAIE.........D.............AVAGVAEGA...................QDEM.-..-.IERF.DG.EELEQ...............................................TMIQGW..GQ..RW..AKVWRRKAIVE--eg...........................................................................................
A0A167MD15_9HYPO/533-785               ..............................................................................................................FKYK......NPD...TPFSAEGQQIGALL.RR.KAT.......DEE....IQPTIDAIQAQA..QE.RA.---....LDPVV.....................ASTDVFVT..AMC...WVGSKSLSHVL.A.CID.R..S.........KGR..LIDA...........gAAS......................................................PAARA..Q...I....I.SSVMAYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.SVADWA..ILads...............................................ashkGSP...GAA.L.A.Q.P.H.I..YEVIFN.TVSKVTGR..............---VRQVVSAIGGDSIDE..........---...............----............................................................................----....----.EEV.AARAKE.V.A...D.M.TELFRTVN.........D.............ALESWAGGS...................KDEL.M..E.HDGA.GG.-ETDE...............................................TLIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
F9FRW4_FUSOF/531-776                   ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AA-------..........---...............----............................................................................----....--PE.TDE.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
W9WCJ0_9EURO/542-794                   ..............................................................................................................FKYN......EES...TPFAVEAKEIAQLI.RR.KAQ.......HDE....FTPVLEKIEQDA..TS.QG.--L....PEPTI.....................AAVDAFVT..SIC...WVGSKSLSHAL.A.CTE.R..C.........KGR..LLEF...........sASS......................................................STCRK..Q...I....V.TSVMDYWR.DQR...G...VGVILIDK.LLNYQ.IL.TPA.SVIEWA..LId....................................................hVDR...GRL.L.A.T.T.W.C..YELVNN.TTHKVAGR..............---VRSLVAAIRTP----..........---...............----............................................................................GLTE....EQRK.ELQ.STLTSE.L.E...G.M.KSLFATIE.........D.............AVGSIRDGN...................QDEM.I..E.-SSD.AL.RAEDE...............................................ALLRNW..GG..RW..ARVFQRKGAVEE-s............................................................................................
A0A0U1M141_TALIS/531-784               ..............................................................................................................FKYS......SDT...MPYAKQGSELMQLI.RK.KAS.......DEE....IEPVIAEIEQQA..KE.HG.L--....DEPMI.....................PSTDAFVT..SVC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................SPARR..Q...I....L.TSVMEYWA.EQP...G...IAINIIDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................rIDA...GKI.L.A.Q.T.H.V..YEMISA.TVGKVTNR..............---IRQIV----AARIQP..........---...............----............................................................................GLYE....PQLS.VLD.ETLVRE.R.S...D.M.QALFTLIG.........D.............CLAPVARGS...................NDEL.M..E.RGDD.AS.TEAEN...............................................ELIRQW..AQ..RW..LRVFKRKAEVE--aa...........................................................................................
NCBP1_YEAST/581-828                    .............................................................................................................l-YFR......QEG...VPMENTVRKILDYT.HK.ANN.......SRE....VTELESILGELK..NE.YG.SII....SDFNR.....................FVIILLVQ..AVT...DSGSRSLSHAN.K.YIN.D..L.........KED..LKTI............FAKie.................................................ldiETKEY..I...I....I.EAVLTFWN.ANP...Q...TGFLVADA.FKYAG.LL.TSR.TIFTFI..FNe....................................................tGLK...NNG.L.I.E.A.T.A..IEAVFR.NLSQQISE..............------------------..........---...............----............................................................................----....----.---.------.E.N...E.S.GNNFEFVF.........E.............RLCTIANST...................IDLL.D..V.NADE.DI.E-IPKvngemdid..............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
G3ATF2_SPAPN/671-853                   ..............................................................................................................YNFA......NPD...LPYNESATKVYEFVvAH.WKT.......NDE....FSTLCQDILTSL..ES.H-.---....PNPMQ.....................FLVNLVFQ..TYA...YIGSRSIYSVV.S.ILS.R..D.........INK..LKHL............SGAtityandeph.................................fdtpeltpeevTLRQQ..W...I....I.DAIFRVWI.HQP...Q...VVFLILEY.LIEFG.IV.DAK.HIVTKA..LE......................................................S--...NLI.I.D.N.V.S.C..MESVNR.ILGSANKE..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------liiv.........................................................................................
NCBP1_DROVI/552-753                    .............................................................................................................q----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.--S.K..F.........HVV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLDTELDNAKEKLSKA..........DSSs............sdT--Dedtphkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A024GLJ2_9STRA/647-873               ........................................................................................taffesvrsklkehptasnles----......---...--------------.--.---.......---....------WLKEQI..NK.AE.---....--VDR....................lEAIEVFVT..ALL...ESGAATFTHLR.L.VLE.K..Y.........AEV..FTDP............ESTl...................................................sgSDEQV..R...I....I.TALSSVWQ.HSP...Q...HIEVISNL.MLRQN.II.SSA.AIIKWI..FT......................................................ADV...TQQ.Y.C.W.P.Y.V..WTIARD.AMTFLQNR..............RKQTEQCA----KA----..........---...............----............................................................................----....ADSD.IGD.NILRPV.S.E...E.E.KQVMRSML.........E.............GFRDVLSSH...................KRRC.A..S.DGNS.YQ.D----...............................................HWFNSL..V-..--..-------------tqikafairfqet................................................................................
A0A158NPN5_ATTCE/488-762               ..............................................................................................................YKYTp...kgASS...LPGSDAALKLIDSI.KN.KGT.......SED....VLAILNALPREN..EE.TN.NYN....----P.....................LKIDVFVQ..SLL...NLGSKSFSHSF.A.AIV.K..F.........HDI..FKML............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELTDAREKLRRA.........eS-Rsg..........sssD--Eednnk..................................................................ernreRPSE....DEVE.RKE.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..VG..RL..QQVFLSHQEQVQK.............................................................................................
C5DQ64_ZYGRC/585-760                   .............................................................................................................l-YFR......HES...FPAHQQVRQLLDYV.HK.QND.......SRE....VSELETIINSIR..QE.YG.DII....ANFEK.....................FIIVVLIQ..TVV...HSGSRSLSHAN.K.YIG.D..L.........KDD..LTHIlg.......qmeMDD......................................................STKQF..T...I....V.EAVLRFWN.SNS...Q...NGFLIADT.FKFAG.FL.SPL.SIFQFS..FNeek................................................sggSTK...NYG.L.V.D.G.T.S..IESTFR.NLTQHIGD..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------qe...........................................................................................
U4L4H6_PYROM/539-791                   ..............................................................................................................FKFD......LDE...NPFKIAGKELLVAV.SE.RKE.......DAE....VEPLIAAIATAA..AE.AGlADE....ADPRK.....................YARDAYIT..CIC...HIGAKSLSHVL.S.CIE.R..C.........KDK..LLSI...........gHEH......................................................PDARR..Q...I....V.GSVLSYWK.DQP...G...IGANVVDK.LLNYS.VV.TPL.SVIEWV..LL......................................................DAG...PEA.L.A.K.T.Y.A..WEMVAT.TIHKVNNR..............---VRQIVAAKSSVLGAE..........---...............----............................................................................GVPE....DQIA.IFQ.ATLKSA.Q.D...E.Q.AEILAYVE.........K.............RLSELATFE...................D-AG.D..E.VD--.--.-VESV...............................................AWIQWW..AK..GW..LRAFRRMFEVT--eg...........................................................................................
A0A0J7NBX7_LASNI/408-640               ..............................................................................................................YKYSs...egASS...LPGTAAAHELVVSI.RR.KCT.......PEE....VLTVLNTLPGPR..EN.EE.TNN....YNP--.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELAEAREKLRRA.........eS-Rsg..........sssE--Dednnk..................................................................eknreRPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------l............................................................................................
C1GXS9_PARBA/567-819                   ..............................................................................................................FKYS......FET...TPYATEAQEIMQLI.RK.KAT.......DAD....LQPHIQAIEQQA..AA.SG.A--....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLEYWA.DQP...G...IGVNIIDK.LLNYA.IL.TPL.SVIEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQL----..........---...............----............................................................................GLVE....PQLS.VID.ETLRRE.R.G...D.V.GVMFDVIE.........G.............ALVGVVGGAg.................aG--D.G..M.QGNG.AM.----Eg............................................egGIISEW..GR..RW..LRVFRRMKAVEE-a............................................................................................
L1IJA4_GUITH/538-815                   .....................................................................................................srreecsvl----......---...--------------.--.---.......---....----EEFVANSL..SD.LT.SET....P--TA.....................DRAKILVA..AMV...YEGRESFSHVL.G.IVG.R..Y.........LKV..LRSC............VEG......................................................EQEQF..A...C....A.TAISHTWK.KNP...Q...CFVMVMDK.FVAMK.LI.SPI.NLAKWL..LS......................................................SFE...YVE.G.R.G.D.A.V..WELMIM.AIRKPVEL..............VRTVRRDLSEAQKELDKL..........KQTs............deE--De.........................................................................emIQKA....DRIS.RIK.NVLRSS.T.R...D.Q.DDILIAVI.........R.............GLVLLANEC...................YERK.E..E.KEKE.ED.NNETE...............................................------..--..--..-------------esgnkkpkldpeqagdgadakngdamdaetkeeeeeedeasktksskrkhkkrseg.....................................
V7CU42_PHAVU/486-827                   ...................................................................................................sfgaedgkesn----......---...--EHELSGKLNNMV.KG.KSP.......VRE....IISWIDESVFPN..--.-N.G--....---LE.....................VTLRVIVQ..TLL...NIGSKSFTHLI.T.VLE.R..Y.........GQV..FAKV............CPD......................................................EDRQV..M...L....I.AEVSSFWK.SNT...Q...MTAIAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................AEN...IEQ.F.H.T.SdR.P..WEILRN.AVSKTHNR..............ISDLRKEILTIRKNISSAe........eA-Ake...........akA--Eldaaeskltlvdgepvlgd......................................npvrlnrlkshaektkeevVTLQ....ESLE.SKE.ALLVRA.I.E...E.N.EALFLLLY.........K.............SFSNVLTERlpe............gtrtL---.-..-.--HE.LK.SAQVDvmavdteeppsmelddenq.........rsqnsqsngekkggaytvgEKEQWC..ITtlGY..VKAFSRQYAAE--i............................................................................................
A0A1F5LTQ7_9EURO/531-784               ..............................................................................................................FKYS......SDM...TPYSKEGQEIMQLI.RK.KAT.......DEE....IQPVIAAIEEQA..KS.QG.V--....EDPKV.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAL...........gTES......................................................PRARC..Q...I....I.TSVMEYWA.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sIAA...GTI.L.S.K.A.H.I..FEMISA.TVGKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLT.AID.ETLVRE.R.A...D.M.QTLFKFIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGDL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-t............................................................................................
A0A088A145_APIME/488-764               ..............................................................................................................YKYTs...egASS...LPGTAAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPR..EN.EE.T--....NNFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIG.K..F.........HYV..FQVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...VSE.F.T.K.L.Y.I..WEILHL.TIRKKNKH..............VTKLSTELAEAREKLRRA.........eS-Rsg..........sssE--Dednnk..................................................................drnreKPSE....DVVE.RME.EKLETA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LGRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
A0A094DN20_9PEZI/550-800               .........................................................................................................kltkl----......--D...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQA.M..E.AGIG.ET.T--DE...............................................AFIQRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A286ULN3_9HOMO/535-820               ..............................................................................................................YEYE......DPR...HPQYEHAETLLELL.RN.RTQ.......ADD....ISAHLESLKNRL..SE.SL.DGG....YNVDS.....................VVRLMTVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPV..LRSL............ASS......................................................PDAKR..D...I....L.NAASRFWS.RNR...Q...MIRIVFDK.LMQYQ.IV.DPT.DIIGWA..FAph.................................................aqgEDK...DVT.R.V.D.A.F.R..WEIIEG.ALNKANGR..............VMISRRKVAALRKEEDDTr........aR-Ek............agENMEvdpd...................................................................aeverTEDS....PALK.TAL.KAYNTL.G.R...E.Q.RAVLSKTL.........N.............EFVNALDGTg................siLEDS.A..W.NGRQ.NW.TNK--...............................................EWNAWE..TW..SW..YRNFCRLYSPYLK.............................................................................................
A0A1D6K2X2_MAIZE/137-386               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvl...........................................................eivegqpapAERP....GRIR.RLE.SHVKNA.E.D...E.E.RTLEESLE.........A.............K--------...................----.-..-.----.--.-----...............................................------..--..--..-------------gvllaraheeskvh...............................................................................
A0A1V4J6J9_PATFA/481-761               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFNILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1Q8RKW6_9PEZI/538-784               ..............................................................................................................FKFN......DDG...TPFAAEGREIAVLL.RR.KAA.......DEE....FQPIIERIHSLA..IE.RG.---....LDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EAAKA..Q...I....L.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.SVIEWG..LVgss...............................................hvngQSS...GDS.L.A.Q.P.H.V..FELVFG.TVAKVTGR..............---VRQLV----TK----..........---...............----............................................................................----....-EAE.EDE.EAKERE.V.K...A.M.RNLFKAME.........D.............ALVSWASGS...................KDEM.M..E.ELD-.-G.AGQRD...............................................ALLRQW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A218WME2_PUNGR/485-831               ..............................................................................................................FKYStd..geSEK...TEEHSLSAELCKMV.KA.RQT.......SRE....IISWVENTVYPT..HN.--.---....---LE.....................ITLRVVLQ..TLL...DIGSKSFTHLI.T.ILE.R..Y.........GQV..IAKI............CPD......................................................EDRQV..F...L....I.EEICSYWK.NHA...Q...MTAIAIDR.MMGYR.LI.SNL.AIVRWV..FS.....................................................pVNL...DQF.H.T.T.D.R.P..WEILRN.AISKTYNR..............ITDLRKEISSLNTSLVSAee.....aaaKAKa............elE--Asesklmlvdgepalgen.........................................pvrmkrlksyaektkekeESIR....ESLE.VKG.ALLARA.L.A...E.N.EALFLTLY.........K.............KFSSVLMDRlpdpskagk.lrdlksihaTEEM.A..V.ETEE.SS.T---Memddesgkakksq.....................tnggnastsynvgE-----..--..--..-------------keqwclstlgyvkafsreyasei......................................................................
A0A1L9SZE2_9EURO/530-783               ..............................................................................................................FKYM......SDT...MPYANEGREIMQLV.RK.KAT.......DDE....IQPLIAAIEKQA..TG.LG.V--....ESPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................PAARR..Q...I....I.TSVMEYWA.DQP...G...IGINIIDK.LLNYT.II.TPL.SVIEWA..LId....................................................qLNA...GTI.L.A.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.K...D.M.HALFQVIE.........D.............SVVSVAGGSnd...............qlMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GK..RW..LRVFRRKSAVEE-a............................................................................................
A0A1L8HX89_XENLA/485-761               ..............................................................................................................FKYGd...esNSA...LPGYSVAVTLTNEI.KN.KAS.......DKE....IFNILKDIPNPN..QD.DD.DDE...gISFNP.....................LKIEVFVQ..SLL...NLASKSFSHAF.S.ALA.K..F.........HDI..FKAL............SES......................................................DEGKL..H...I....L.RVAYDVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VQKIQKELEETKQRLAKQ.........hKHRds...........ddN--Deds.....................................................................grkdGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GAID.VN.T----...............................................AWYKNC..RE..RL..QQIFLQHHQTIQ-q............................................................................................
A0A137QAE7_9AGAR/530-841               ..............................................................................................................FEYE......DPS...HPHHEAAQSVLNLF.RG.RAN.......AED....VIAHLDTLKSQL..EA.SD.EGH...tANLDS.....................LVRSIAVQ..SLL...NIGSRSFSHLL.N.GIE.R..Y.........LAV..LRNL............ASGgvsss............................................gghgnIEAKN..D...I....L.AAVASFWK.DNR...Q...MVAIVFDK.LMQYQ.IV.DPT.DVVGWT..FLngsv.............................................vgqlrEVE...KPL.N.L.S.A.F.E..WDLLKA.ALDKANGR..............VVIARRKVATLRKEDDDAr........aKAKas...........qgM--Evdget..................................................................kpdenEIEN....PALE.TAL.KASESL.I.R...E.Q.KAALSRTL.........E.............GFVSCLAPS...................--AG.D..S.NPNP.HS.RNVIGeeawqn..................................rdnwgrdEWNAWE..TW..GW..YRQFVRAYAPYL-r............................................................................................
A0A0C9YV80_9HOMO/543-848               ..............................................................................................................-EYE......EPS...HPYHDAYHSILSLL.RG.RSR.......AEE....VIAQLDTLKTTL..DT.SH.-TD....MHVDS.....................TIRSLAIQ..SLL...SIGSRSFSHFL.N.AIE.R..Y.........LPL..LRGLa..........vPTD......................................................LDAKR..D...I....L.VATAAFWK.RNK...H...MIGIVFDK.LMQYQ.IV.DPT.DIVAWI..FNdtp................................................sgnDIA...RPV.Y.I.K.A.F.E..WELLKG.ALDKANGR..............VTIARKKVAALRKEQDDSia......raKASgga........dvgnM--Evdgemk...............................................................plkqdesATEN....PQLT.TAL.KAFTSL.T.R...E.Q.RSVLAKTL.........E.............GFVSCLSPV...................--PG.D..A.HQNT.HS.KTVIEehtwer..................................raswtneEWMTWE..TW..GW..YRHFCRLYSPYL-r............................................................................................
G5C1C6_HETGA/252-527                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0P0VXC8_ORYSJ/1-244                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0C3DJ93_9HOMO/544-850               ..............................................................................................................-EYE......DPS...NPHHELSESILSLL.RG.RSR.......AEE....VIAHLDSLKSTL..DV.VP.YPH....THIDS.....................FIRSLAFQ..SVL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRGLt..........pPGD......................................................TEAKR..D...I....L.TTTSLFWR.RNR...H...MVGIVFDK.LMQYQ.IV.DPT.DVVAWI..FStla................................................tsdDRG...GPL.Y.V.Q.T.S.E..WELLKG.ALDKANGR..............VTVARKKVAALRKEHDDSia......raKARgga........dagnM--Evdgemk...............................................................pldqdesVTEN....PQLT.TAL.KAYTSL.T.R...E.Q.RNVLAKTV.........E.............GFVACLSPA...................--PG.D..A.HQNP.HA.EAVIQeqawes..................................raswsrdEWMTWE..SW..GW..YRHFCRAYSPYL-r............................................................................................
A0A0A1NA79_9FUNG/153-420               ..............................................................................................................FKYE......SAE...DPLHAKSKEVIDSI.RT.KKS.......VEE....LRDLLSRYKEEL..AS.SG.VSS...eVEQQS.....................VIRELFTQ..CLL...LVGSKSFSHVL.N.VVE.R..Y.........LEV..LRFL............NAT......................................................PEGRL..H...T....V.QIVSSFWK.DNT...Q...FLGILVDK.LLNYR.VI.DPA.SVITWI..FE......................................................SDQ...FKQ.V.G.R.A.Y.V..WEVLKN.TLSKVNSR..............VAQVKSKLDNLQSTHEVN..........KAKr............seS--Ettem...................................................................teaeeQQEL....DSIR.IVE.NSLATV.T.R...E.R.KEVFLLVC.........Q.............KFTQMLKAI...................E---.-..-.QDSN.-S.N----...............................................QWTIWW..AF..GW..YKEILRVNYKEC-k............................................................................................
A0A1S8W419_9FUNG/531-800               ...............................................................................................aessgdeglcqlagf----......---...---------ISKSI.SE.RAD.......LHT....MEAILTKVEQYA..SA.ET.-IE....IDGKSltiema.........msspesVTRDVFIN..CVM...FQGSKSFSHIL.N.VIE.R..Y.........LPL..LQKC............NRT......................................................VEARM..H...T....L.EITAAFWK.GNT...Q...FIEIVLDK.LTNYR.IV.DPK.TVLLWI..FQ.....................................................pKIL...DVS.F.S.R.F.Y.L..WSILRN.TLIKVNLK..............AEQISLRLETAKSQASNF..........---...............--SD...........................................................................mTAQG....GEIQ.TLE.MAREAA.L.R...E.K.KETFLLVF.........Q.............KYVELTSSK...................LRQC.M..A.EGIE.PT.A---T...............................................PWWRW-..VV..GF..FREISRAFKT---dve..........................................................................................
A0A154PSU0_9HYME/488-764               ..............................................................................................................YKYTs...egASS...LPGTAAAHELVVSI.RR.KCT.......LEE....VLNVLNTLPGPR..EN.EE.T--....NNFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIG.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MIVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...TPE.F.T.K.L.Y.I..WEILHL.TIRKKNKH..............VTKLSTELTEAREKLRRA.........eS-Rse..........sssE--Dddnnk..................................................................drnkeKPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
A0A1B9GWC1_9TREE/588-886               .............................................................................................................w-PYE......KPD...HPLHAEAKEVLQLF.RQ.KAS.......FSE....VKAHIEQLPNAS..TG.PG.-EP....I---F....................pAVRQMIVE..TLL...HLGSRSFSHFL.N.ATE.R..Y.........IDI..LRYL............TPD......................................................YASRQ..T...L....L.QGIMSYWR.YSS...Q...QRLVTIDK.YLQYG.VL.EGL.DVLDFL..FSddg................................................vaeGEE...ADG.W.T.D.G.W.K..WEILRM.TVEKHVGR..............VNAIKRRLRVIEREDEAAr.......arR-Aae..........rleS--Ggdvgtee..............................................................dlgeevrPEGS....KEFR.DAQ.TSLDIQ.V.T...R.L.EKILTTTI.........K.............HFVLTLLPW...................TASD.P..A.SVSS.AG.----Dglkgvlt................................llesgeeaMWSVRA..RF..GW..YREFVRLWSA---hl...........................................................................................
A5DTG5_LODEL/721-913                   .............................................................................................etketeetretdeteat----......---...--------------.--.---.......---....--KETDETDKTK..QQ.QQ.QQQ....QQQQSqhleal.........ipepvkFAINLIMQ..SYC...YIGSRSIYSEV.S.ILS.R..D.........ADK..LKYL............SGQpiepkttapvslve.........................getefenldlteedvQNRQN..W...I....I.DSIFRIWV.HQP...Q...VVFLILEN.LIEFG.VI.KPE.FLLAKA..FK......................................................S--...NLI.I.D.N.V.S.C..MESVNR.ILENSK--..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------pavlkqg......................................................................................
A0A093YR42_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTIIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWAAGS...................KDQA.M..E.EGTG.ET.--PDE...............................................AFIRRW..GD..KW..LRVFRRKMAVEE-a............................................................................................
W4GQH0_9STRA/654-868                   ........................................................................................................lrsqye----......---...--------QVFGKI.KA.REE.......AAA....VQAWIDDTSAAH..DG.A-.---....P---H.....................VVLEMVVA..AIL...DAGSATFTHFR.T.LLD.K..Y.........VGV..LVAA...........iDAD......................................................VERQV..V...V....I.AAVSSVWE.QSP...Q...HVILILSI.LLRHH.VL.TPV.AVVTWL..FG......................................................ADA...VQQ.Y.S.W.P.Y.V..WEILDN.TVRYALET..............--------QAAKSTPNAV..........---...............----............................................................................----....----.---.--DDAW.A.G...S.V.EDLFVAVF.........E.............GLSRVIAAH...................KAQC.D..K.DGTT.FK.D----...............................................NWYAST..LA..RM..QSV----------grdfr........................................................................................
K8EBJ4_9CHLO/510-783                   .................................................................................................yvdsvnaqtnnai----......---...-------DTIREML.KA.KTP.......SDE....LEQWLKESSGGL..TA.E-.---....-----.....................QCLACVAT..AIL...VHGQKCITHLD.T.LLT.R..Y.........DIL..LRKL...........iDHS......................................................STKAR..E...L....L.EAIVNVWE.G-S...Q...NAKIAVDR.TICAK.LC.DIA.FVAEWA.gMK......................................................YAE...NPV.L.Y.S.D.T.C..GYVLEH.ATAEEEHA..............LERTRRILHRVHDAEREA..........EAA..............gQAAErfladgl..............................................................mheatraQTAE....AAAV.ELA.ASLDAG.A.S...E.M.KQFVTVAR.........E.............KASEITVLCar..............scvLKAM.E..L.SDQT.GA.D----...............................................ARLNKR..IE..RL..LRGFREQ------lagkes.......................................................................................
A0A2B7XVE1_9EURO/534-787               ..............................................................................................................FKYA......LET...TPYSKEGKEIMQLI.RK.KAS.......DEE....IEPSITSIQEQA..TT.HG.V--....SDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..C.........KER..LLAI...........gPQS......................................................PAARR..Q...I....I.QSVMDYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPI.SVIEWA..LVd....................................................nLAG...GTI.T.T.K.P.H.I..FEMVSG.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................GLVE....PQLS.VLD.DTLSRE.K.Q...D.M.QNMFQLIE.........D.............ALVAVGNGT...................NDRM.I..E.RTDD.GK.LAEED...............................................ELVREW..GQ..RW..LRVFRRKSAVEE-a............................................................................................
A0A077ZBZ7_TRITR/409-664               ........................................................................................................kfsfeg----......---...TVPSELALELQEAI.KA.RKE.......PEK....LLPILFPEGESS..-E.NG.GGP....VESTE.....................YKAEVMIS..QLL...VLGQRTMSQTL.S.LLT.R..F.........APV..LDQL...........vKNN......................................................ENAQL..S...L....L.NALRETWP.TFE...Q...RIGVVVDK.LFRLE.IV.PAP.IIIKWV..FS......................................................REM...KNE.F.L.K.Q.Y.V..WEIIFS.TFDKLCIN..............YRVLSDKLEAVTGENRSP..........---...............--ER............................................................................SEDP....AEVL.ALQ.EGLDAC.L.G...S.Q.KAFIFTLF.........Q.............HFIITLSEH...................LLTV.D..E.SGDR.VS.-----...............................................DWYRIV..FG..RM..CQFFTT-------qcieiqr......................................................................................
A0A093FVP3_GAVST/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0N0P9G8_PAPXU/41-313                .............................................................................................................c----......-SS...LPGTEAAHRLVVCV.RN.KCT.......PEE....ALNVLRELPNPL..RD.GD.AA-....PHPHYn...................pLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...V....L.KNVWELWQ.RQP...Q...MVCVLVDK.MLKTQ.VV.ECS.AVATWL..FS......................................................KDM...APH.F.T.H.N.Y.L..WEILHL.TIDKMNKH..............VSKLSGELQEAREALARAdss....ssdS--...............---Edesgtk................................................................kkkdhdKPTE....EAVE.RME.ERLELA.H.T...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DARD.PN.T----...............................................HWYRST..VA..RL..RHVFLVHHEQVQK.............................................................................................
A0A0P1BIA5_9BASI/737-1103              ..............................................................................................................FTYA......AEG...HPHREAALALIQSF.RA.RAT.......AQV....IMANMDALKTQI..VP.DQ.QDD....AMYEDaaeaandgk...vrdereadiLVRDIIFQ..AIL...SVGSRSFSHFL.N.VVE.R..Y.........HAL..LRQL............SST......................................................PELRK..A...I....L.ASVVRFWA.RSP...Q...WVQIVFDK.LLQYR.IV.EPT.DIIDFV..FQpsgirfpdlvvmgs..........................gdgvegsfsrvdsaAKI...PRD.W.S.N.A.S.W..WDIVRL.TVEKVNGR..............VDQVRKRLEALEREEAAEe........eQ-Raaa.........qvaGDEErakaeqepapapapepklplfpg..............................aslpprppvaaspmktpsapppaKKAQ....GTSA.EAK.VALEAI.Q.A...E.Q.RKVMLGTT.........R.............GFAMLLKASq................gdLSSA.G..P.MLDE.HT.--SQE...............................................AWLAWW..VR..AW..YRDFARLFAKQL-a............................................................................................
A0A091PUG5_HALAL/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
NCBP1_DROPE/488-770                    ..............................................................................................................FKYAs...eeAAS...LPGTAVAHQLVVAI.RQ.KCS.......PEE....VVNILKEIPNSG..YS.GE.EMS...dGTFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...V....L.HNIYELWS.SHQ...Q...MMVVLVDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TSE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSVAKDKLSKA..........DSSs............seS--Dedaptkr.............................................................kkpithadKPSE....EAVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................MLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0W7VGT1_9HYPO/518-763               ..............................................................................................................FKFN......NPD...TPFASEGQELSGLL.RK.KAP.......DEE....FQPIIDKIQSDA..SE.RA.---....LDPVV.....................ASTDVLMT..AIC...WVGSKSLSHVI.A.CIE.R..S.........KSR..LVDA...........aNSS......................................................PAAQN..Q...I....L.AAVMAYWS.AHP...G...IALSIVDK.LVNYS.IL.TPT.SIVRWA..LTadp...............................................vadgATA...GES.L.A.Q.P.H.I..FELVLN.TVTKVSFK..............---TRQLV----SS----..........---...............----............................................................................----....--PE.TDE.ETRKAE.S.K...A.I.VDLFSTLN.........D.............LLVSWAGGS...................KDEL.M..E.TGDG.S-.-SERE...............................................ATIRQW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
U5HA64_USTV1/692-970                   ......................................................................................................sqdlvave----......-NA...SPYAALAGRIFDLL.RA.KAS.......TSQ....IETELKGIDATL..QT.DH.TLT....ADESR....................aLILDMTVQ..SIL...SIGSRSFSHFL.N.VLE.R..Y.........LVL..LRNL............TPS......................................................VSTRS..E...L....L.KSVAKFWT.HHR...Q...FHLIVLDK.LLQYR.LV.DGA.DVISWV..FD......................................................PTR...NGV.W.S.D.M.D.D..WLALNA.TISTLKGR..............VKAAQGRLEGLLTEADTHr........aR-Eqlg.........snnN--Nndledstme.........................................................vndsigvvvvVVDT....TEIS.LAR.TQLSTQ.N.E...D.L.SNCLLNVL.........E.............HFSNLLPEA...................R---.-..-.----.--.--KLD...............................................DWTGFW..IE..GW..FREFVR-------llie.........................................................................................
A0A167UN26_9PEZI/605-861               ............................................................................................................pa----......---...--FAAEGRELAALL.KR.KAP.......DED....VQAVIERIHSQA..LD.SG.---....RDPLV.....................ASTDVFTT..AVL...WVGSKSLSHVL.A.CIE.R..T.........KNR..FLDA...........gAAS......................................................EAART..Q...I....L.TSVMAFWD.AHP...G...VAIAIAEK.LLNYA.IL.SPA.AVVQWA..LVaphr.............................................qqqqqQQQ...PPP.L.A.Q.T.H.V..AELAFN.TVDKVTRR..............---AETALATATAD----..........---...............----............................................................................----....--AA.AAR.TAEANE.T.R...A.M.RDLFRLLD.........E.............ALQPWLATA...................LTAA.A..A.DAGA.DA.GADTDadank.....................................npsegALLQAW..AV..RW..QRVVQRRAAVEE-a............................................................................................
A0A0V0TEK0_9BILA/514-776               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
B1N4Y9_ENTHI/2-83                      ..............................................................................................spinytikniqqgvii----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............ESN......................................................EIPSS..I...I....L.NNLYNYWK.FNK...T...QCIFIIDY.LMKER.IL.SC-.--FNYI..FN......................................................DSK...SYS.F.H.Y.I.D.I..RDSLKT.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------in...........................................................................................
A0A1Y2HV68_9FUNG/457-608               .................................................................................kmepqsraahdqvmalattqlggmtdagm----......---...--------------.--.---.......---....------------..--.--.-DP....S---Ta..................ipLVRRAFVT..ALL...TYGE-TMSHKV.N.VLE.R..Y.........VPV..LKDLa..........pAQD......................................................ASARV..D...L....V.DVVHRVFR.RNR...Q...CLLIILDK.LLQHR.LV.VPE.QGMQWL..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aqagqvyeerraraearrverakkavsedmdvv............................................................
G4YES6_PHYSP/618-870                   ............................................................................................................aa----......EES...SPASEFYQSVTTKL.KG.HPP.......ASA....LRSWLNE-ELPR..LE.IS.R--....----A.....................EAIEVVWT..CIL...EAGAATFTHMR.L.LLE.K..Y.........GKR..NELFgae.....dqpiEEA......................................................DADEL..V...L....V.KTVANVWL.KSP...Q...HIGLILNA.MLRQG.LF.RPS.TIITWV..FT......................................................ADA...VQQ.Y.S.W.P.Y.V..WEILND.TLKFVQDA..............ILAKTRQLEQASAP----..........RAS...............DDRD............................................................................NEDM....PDVA.ALE.DGRKRL.Q.D...E.L.RQLLVLLF.........R.............GFNRVIGEH...................KAEC.D..S.EGSD.PR.D----...............................................NWFRSA..LA..QM..QAVG---------hrfrv........................................................................................
A0A2H3FKG4_9HELO/534-779               ..............................................................................................................FKYA......LAD...TPFSQEGQEILELL.KK.KSP.......EDI....IQPVIDRIHRQA..QA.LA.--L....PDELV.....................CSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLAL...........gPVS......................................................PAARK..Q...I....I.DSVMEYWK.DQP...G...IGVNIVDK.LLNYT.IL.SPA.SVVDWA..LS......................................................Q-H...GSR.L.G.Q.P.F.V..YEMVSA.TIGKVTNR..............---VRQVVRANRVQ----..........---...............----............................................................................GLLP....EQKA.LMD.EGVARE.R.A...A.M.KELFDRME.........D.............ELVAWAQGS...................KDQL.Q..R.-GVD.GE.S----...............................................AMVRQW..GE..RW..LRVFRRKFAVEE-a............................................................................................
D3BF03_POLPP/465-691                   ............................................................................................................he----......-ES...KDLVSQSHKLLLSF.KQ.KEP.......IEN....IIQQVAAIPENI..--.--.---....-----.....................NVVELVTK..CIL...HIGSTSFSHLT.Y.AIE.R..Y.........VTL..FKTT............IKS......................................................NEDRF..E...C....L.KSTLQFWQ.SSH...Q...HVVIVVDK.LITYK.IL.API.DPIAML..LSg....................................................dPKN...GVV.V.T.D.A.Y.V..WEIIYN.SIEKTNII..............IDTLAKDYEVSMNSA---..........---...............----............................................................................----....----.EKE.LKLKSA.Q.T...E.Q.QTLFTTMF.........K.............SLDALLKNP...................----.-..-.----.--.-----...............................................------..--..--..-------------hidpvstkilsghlkstarrylnqlkplfet..............................................................
B9RIH1_RICCO/444-789                   ..............................................................................................................FKYSte..dgKER...TEQHAVSAELINKV.KG.RQT.......ARE....IISWVEESVLPH..--.HG.---....---WE.....................VTLTVVVQ..TFL...EIGSKSFTHLI.T.VLE.R..Y.........GQV..IARI............CHD......................................................HDKQF..M...L....I.AEVSSYWK.NNG...Q...MTAIAIDR.MMGYR.LL.SNL.AIVKWV..FC......................................................PTN...IDQ.FhT.S.D.R.P..WEVLRN.AISKTYNR..............ICDLRKEISSLKNSVVSAe.......eaA-Ak............akA--Eldaaeskltlvdgepvlge......................................nparmkrltsnaektkeeeVSAR....DSLE.AKE.ALLARA.L.D...E.N.EALFTSLY.........K.............NFSNVLIER...................----.-..-.----.--.-----...............................................------..--..--..-------------lpdaskiqtlrglksihgdemvvdldessemdvdnengrpkksqsngekssyvynigekeqwclstlgyvkafsrqyasei............
J9EFK0_WUCBA/484-675                   ..............................................................................................................YDLN......DDE...HPDRDFAMVLEKAF.RE.KIS.......ADE....MVDLLRNKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDAQL..T...I....L.RTLYETWK.LHG...Q...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KPE.F.G.R.L.W.I..WEILNI.ALEHVSGH..............VRRNRQTIENAKLKKEEKe........lN--...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------dekddfvsdfviilc..............................................................................
A0A091CMF8_FUKDA/333-418               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lf...........................................................................................
A0A1D6K2X5_MAIZE/141-487               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
G2QS19_THITE/535-793                   ..............................................................................................................FKFA......SDD...TPFAAEGREILALL.KR.KAP.......DEE....IEAVIQRIQSLA..ID.RE.---....IDALV.....................ASTDVFVT..CVL...HFGNKSLSHVL.A.AIE.R..T.........KDR..LADA...........gAAS......................................................DAART..Q...I....I.SATMAYWS.AHP...G...VALSIIEK.LLNYS.IL.TPA.TVINWA..LIgr..................................................agSTR...GEA.L.A.T.A.H.L..YEMVFN.TVMKVTGR..............---VRQLATKPPSPPHQQ..........---...............----............................................................................-AQS....SADA.EEA.ETRERE.I.R...A.M.RALFAAIE.........D.............ALAAWAAGS..................kDEMM.E..A.SEGA.AG.DSETE...............................................RLVRRW..GE..RW..LRVFRRRAAIEE-a............................................................................................
NCBP1_DROMO/488-770                    ..............................................................................................................YKYTn...eeAAN...LPGITVALQLVGAI.RQ.KCT.......PEE....VVNILKEIPNTG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSEAKEKLSKA..........DSSs............sdT--Dedtphkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A1I7XEC4_HETBA/492-619               ..............................................................................................................YTLD......DET...EEGHNRARTLMALF.QE.RVS.......DET....MLAELKGEDGNF..DP.K-.SFA....----Iffavglqv.....yslflifkFYFLYFLQ..VLL...KLACKSFSHNF.A.ALT.R..Y.........HRT..LKLI...........aDSS......................................................EEMQA..V...V....L.RTLYDCWK.CNH...Q...VC------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------hkn..........................................................................................
C4JPG9_UNCRE/529-782                   ..............................................................................................................FKYA......QET...TPYSKEGQEILQLL.RK.KAP.......DED....IAPVIASIEEQA..KA.HG.--L....ADPTI.....................PSTDAFMT..SIC...CVGSKSLSHFL.S.SIE.R..C.........KER..LLGI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLSA...GSI.L.A.K.P.H.I..YEMIAA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................GLVE....PQLS.VIQ.DTLARE.R.A...D.V.QAMFQLID.........D.............SIVAVASGSnd...............vmM---.-..E.RADD.SA.LALEN...............................................ELIREW..GK..RW..LRVFRRKGAVEE-a............................................................................................
A0A0L6WMN3_9AGAR/545-843               ..............................................................................................................FEYD......DTT...NPHHEAAQGVLNLF.RG.RAK.......AED....VINHLETLKNTL..ET.SE.NGP....INVDA.....................TTCSIVIQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LPL..LRNV............AGSsnv................................................laaAEAKA..G...I....L.TSAAIFWK.NNP...Q...MVGIVFDK.LMQYQ.IV.DPN.DVVGWT..FTsg.................................................sglGLG...GQF.S.L.S.A.F.E..WDLVRG.ALDKANGR..............VLIARRKVTALRKEEDDTra......rvKAKa.............nESMEvdadt.................................................................kpedetTVEN....PAMT.TAL.KALDSL.T.A...E.Q.KSGLSRTL.........E.............GFVACLTQSsf...............apTVIT.D..Q.AWHN.RA.NWDDD...............................................DWNAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
A0A1Z5S9J1_SORBI/483-829               ..............................................................................................................FKFHsd..esNEN...TDGQKLSKELVGLI.RG.KKT.......VHD....IILWVEE---QI..IP.TN.G--....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLI.T.VLE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LV.SNL.AIVKWV..FS......................................................PAN...IEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLLVA.........kE-Asak........aikeL--Eeaksvleivegqpaiaer........................................pgrirrleshvknaedkeRTIE....ESLE.VKG.ALLARA.L.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsv.......dgkipnL---.R..T.----.--.---GDqdvnfapqdpeaatmeidne......ngadndsepngrstkngynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
I1RT35_GIBZE/532-777                   ..............................................................................................................FKFK......NPE...TPFSKEGMEIAGLL.RR.KAA.......DEE....FQPFIDSIQSQA..SE.LS.---....LDPLV.....................VSTDVFMT..AIC...WVGSKSLSHVL.A.CID.R..A.........KGR..LLEA...........gNTS......................................................EAARA..Q...I....I.SALMSYWH.AHP...G...IALSITEK.LLNYS.IL.TPL.TVVDWA..IVast...............................................pangANG...GES.L.A.E.P.H.I..FELVSN.TLTKVATR..............---SRQVI----SSP---..........---...............----............................................................................----....---D.TDD.ETRAKE.V.K...S.I.HDLFRATN.........D.............ALISWAGGS...................KDEL.M..E.EGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
F4W7L2_ACREC/18-291                    ..............................................................................................................YKYTp....kGNS...LPGSDAAVKLIDSI.KN.KGT.......SED....VLAILNTLPGEN..EE.TN.NYN....----P.....................LKIDVFVQ..SLL...NLGSKSFSHSF.A.AIV.K..F.........HDI..FKML............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELIDAREKLRRA.........eS-Rsg..........sssD--Eednnk..................................................................ernreRPSE....DEVE.RKE.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
S7PPW1_MYOBR/483-758                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......SDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.I.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELDEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
C6HGR2_AJECH/477-709                   ..............................................................................................................FKYA......LES...TPYAAEAQEIMQLI.RK.KAP.......DAE....IEPHILAIQHAA..AN.Q-.TDT....ADSLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLSYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIEG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVVARVQR----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...E.V.QVMFEVIE.........G.............ALEGVISGS..................gMED-.-..-.----.--.-----...............................................------..--..--..-------------vdggvgrgggeeam...............................................................................
A0A0L1J250_ASPNO/554-805               ...........................................................................................................sss----......-TA...TPYANEGTEIMQLI.RK.KAA.......DDD....ILPIISSIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWK.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISS.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.DTLNRE.K.A...D.M.QALFKVIE.........D.............SIVSVAGGNnd...............glMERG.D..G.SGEL.PE.D----...............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
A0A091EPF3_CORBR/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DGE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................stdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
R9P1P9_PSEHS/526-840                   ..............................................................................................................FTYQ......DES...HPYFAQATRLINSI.KA.KAS.......AEV....ILADFESFKSSI..LE.TS.SAL....PTDDVagmvrd.........plqaevVVRDLTIQ..SIL...SVGSRSFSHFL.N.IVE.R..Y.........HSL..LRQL............SKT......................................................SRMRV..A...I....L.SGSVKFWR.ANQ...Q...WIGIVVDK.LLQYR.IV.EPA.DVVEFI..FSppkdep.........................................qtiassaAGE...EEG.W.V.G.F.N.R..WNLLKL.TLEKVNGR..............VDQLSKRLDESRRKEAEEle......rkE-Aslaa.......glpeE--Tpeqtddlpkpllfp................................................tsailptrpptdqtSSKD....ISST.EAL.ASLEAI.Q.S...E.Q.RKVLITTL.........L.............GFKSHILAP...................T---.-..-.----.KG.-----...............................................DWPKWW..IE..SW..YKQFVRCFNRQ--ll...........................................................................................
J3LNQ4_ORYBR/483-828                   ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.KKT.......VRD....IILWVEEQIIPA..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........NQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAITIDR.MMVYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IYDLRKEIQTLRKGLQAA.........kE-Ase..........kanR--Eleeaksiieivdgqpvpve......................................kpgrlkrlqtradtmkeeeVTTE....ESLE.AKD.ALLVRG.L.E...E.S.KELLRLLF.........K.............SFVDVLTERlppisa.......dgevpnL---.-..-.----.--.-RAGDpnvnsaasapeatmdidnen.......gadndsqlngqntkvghnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A177WVJ4_BATDE/518-788               ............................................................................................yetaekcgdeglflladl----......---...---------LNKSI.SV.RAD.......AAT....VEQILVKVEKYA..SG.QT.VE-....VEGKSitpgmt.........tgfsenAAREMLIT..CVM...LQGSKSFSHIL.N.VIE.R..Y.........LPL..LQKC............NET......................................................MEDRA..H...T....L.HVTAEFWK.DNT...Q...FTEIVIDK.LTNYR.II.DPQ.TVILWM..FR.....................................................pEFL...DTQ.Y.S.R.F.Y.M..WGILRN.TLIKVNLK..............AEQISRKLEDAKSNATSF..........---...............---S............................................................................EISG....DGIQ.ALE.NAMEAS.L.R...E.K.KETFVMVF.........Q.............KYVELTSSK...................IRNC.A..A.EGTD.AT.S---T...............................................SWWRW-..VV..GF..FREVSRAFK----edve.........................................................................................
A0A1D5XT71_WHEAT/483-829               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak........aikeL--Eeaksileivegqpvsser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTEC...................LPPV.S..A.DGDV.PN.LRAGDpnvtfpasdpeavtmeidne......ngadnnsqvngentevgytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A226PNU8_COLVI/29-305                ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd.............sD--Dddrs...................................................................sdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
M3VW75_FELCA/470-739                   ............................................................................................................cl----......-DS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
M5BLJ3_THACB/522-726                   ..............................................................................................................YAYE......DSD...HPHYQVAAGLLTMI.KD.RAK.......ADE....VTAHCLKLARSV..--.--.---....-----.....................PIQHMVMQ..ALL...HVGSRSFSHFL.N.AVE.R..Y.........LPL..LRGE............AGSdvst..............................................seknKEKAR..I...I....L.CAAGEYWE.RNQ...Q...MVGVVFDK.LMQYQ.II.EPS.DVVDYA..FEl...................................................saKGG...GTP.G.L.S.C.E.R..WLLVEA.ALNKANGR..............VVSAKRKVATLNKQEEDR..........RA-...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------raianaggigmdvdgdaqpgtfr......................................................................
L8X8T5_THACA/522-802                   ..............................................................................................................YAYE......SPD...HPHYQDAADLLAMV.KD.RAK.......ADE....VTAHCLKLSRSV..--.--.---....-----.....................PVQHMVMQ..SLL...HVGSRSFSHFL.N.AVE.R..Y.........LPL..LRGE............AGSsaat..............................................neknREKAR..V...I....L.CAAGEYWE.RNQ...Q...MVGVVFDK.LMQYQ.II.EPS.DVIEYA..FEl...................................................gtKTG...ETP.G.L.S.C.E.R..WLLVEA.ALNKANGR..............VVSAKRKVVTLNKDEEER..........RARaian......aggigMDVDgdaq...................................................................paepdMPTS....QSLV.SAQ.KALETL.T.K...D.Q.KKAFQCAI.........T.............GFVNTLTKA..................gVPAL.A..P.AGAW.GR.V----...............................................EWNAWE..TW..CW..YRQFCRAYVPQL-r............................................................................................
A0A0D0AV19_9AGAR/534-847               ..............................................................................................................FMYE......DPT...KPHHDAAQSILNLF.RG.RAK.......AED....VIAHLDTLRNTL..EA.EI.SDS....GQPDNv..................nsLVRVIATQ..SLL...HIGARSFSHLL.N.AIE.R..Y.........LPL..LRTL............ASGgvtsa............................................astgnPEAKT..D...I....L.SATASFWK.YNS...Q...MVAIVFDK.LMQYQ.IV.DPA.DVVSWT..FShvsetg..........................................idepeaDLK...APL.S.L.S.T.F.E..WNLLKA.ALNKAIGR..............VNIARRKLALLRKEDDEN..........RAR..............vRHMDvdgep..................................................................kpaesVPEN....PALN.VAL.KAFSSL.T.R...E.Q.KSALSRTL.........E.............GFISCLAPS...................ITSA.H..P.--NP.QA.KEILTehswhn..................................rvnwgkeEWSAWE..TW..GW..YRHFCRVYSPYL-r............................................................................................
W2LIH0_PHYPR/604-856                   ...................................................................pdsaspasdfyqsvttklkghppasalrswlneelprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAVEVVWT..CIL...EAGVATFTHMR.L.LLE.K..Y.........GKR..NELFgge.....dqsaEET......................................................EADEL..V...V....V.KTVASVWL.KSP...Q...HIGLILNS.MLRQG.LL.RPL.TIVTWV..FT......................................................ADA...VQQ.Y.S.W.P.Y.V..WQILND.TLKFVQDA..............IGAKTKQLEQASTPR---..........-SS...............DDRD............................................................................NEEM....PDVA.ALE.DSRKRL.Q.D...E.L.RQLLVLLF.........R.............GFNRVITEH...................KAEC.D..S.EGSD.PR.D----...............................................NWFRSA..LA..QM..QAVGHR-------yrvp.........................................................................................
D7T129_VITVI/485-830                   ..............................................................................................................FKYSte..dgKER...NEQHALSMELSSMV.KG.RQV.......SRE....VISWIEESVIPV..--.HG.S--....----E.....................VALSVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CHD......................................................QDKQV..V...L....I.DEVSSYWK.NSA...Q...MTAIAIDR.MMGYR.LI.SNF.AIVKWV..FS......................................................SEN...IEQ.FhT.S.D.H.P..WEILRN.AVSKTYNR..............ISDLRKEISSLKKSLALAegd...avtrKA-...............---Eleaaeskltlvdgepvlge......................................npgrlkrlksyaekakeeeVSVR....DSLE.AKE.ALLARA.L.D...E.N.EALFLSLY.........K.............NFSNVLMERl................pdT---.-..-.----.--.-----...............................................------..--..--..-------------sqagtlrglktiqademavdleesstmdvdnengrpqksqtnggkanngynvgekeqwclsilgyvkafsrqyasei................
A0A1W4WJ55_AGRPL/487-766               ..............................................................................................................YKYAk...egGAP...VPGVQTAHQLVISI.RQ.KCT.......PEE....VLGVLKDLPNPR..SE.EE.-AD....SRFNP.....................FKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...V....L.RNMFELWH.NHQ...Q...MMVVLVDK.MLKTQ.IV.ECS.AVANWI..FS......................................................KEM...QVE.F.T.K.V.Y.L..WEILHL.TIKKMNKH..............VIKLTGELNESREKLARA.........eS-Sss...........esE--Dddtvsk...............................................................kkaenseKPTE....EMVE.RME.EKLEAA.Q.A...D.Q.KNLFLIVF.........Q.............RFIMVLSEH...................LVRC.D..T.DGRD.YN.T----...............................................HWYKWT..IG..RL..QQVFLEHHEQVQK.............................................................................................
A0A0M8P211_9EURO/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VN-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gAES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLT.VID.ETLARE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGSnd...............eqIERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A177CE24_9PLEO/557-811               ..............................................................................................................FKYD......NPD...VPYSAQAKELIQQL.KK.KAP.......AEE....VQKTIDQIHDLA..TE.QG.V--....ADVLI.....................PSTDAFVT..AIC...RLGAKSLAHVL.S.CIE.R..G.........KDR..LIEV...........aQTS......................................................EAARR..Q...I....V.ASVFGYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVIQWV..LGe....................................................nLGA...GEG.L.A.E.S.W.V..YEIVSI.TIAKVSSR..............---NRQIVNSRVVK----..........---...............----............................................................................GLPQ....DMID.MVE.ATLSKD.R.D...A.A.RELFKYLE.........D.............VLRAFAQGS...................TDRL.M..EkEMNG.EI.SKEDS...............................................ELIKAW..GK..RW..HTVFVRKSAVEE-s............................................................................................
Q4Z3J7_PLABA/85-308                    ..................................................flnnsncwdnysililffkslmffdssnvsslkrvfknhaviflsyknsgifktedeqiq----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................--FEV..E...L....L.NIVYTYFN.-NC...A...LLNVIVNI.LIENK.IV.KEM.SVINFI..FH......................................................KLS...DYS.L.D.E.Y.Y.I..VQLLYD.GVNNLIIK..............RENNENERN---------..........---...............KFRR............................................................................RKTE....SENE.NLI.KELEDE.K.N...E.I.VNKIFHLT.........N.............QTIIMISEK...................MMKL.K..N.DNNS.YM.S----...............................................------..--..--..-------------kellkeslvflrtyieyididqflqqchek...............................................................
A0A1B0CVJ0_LUTLO/11-117                ...........................................................................yyskrkekdlyaiifgntqfkqfahlvyfffkiki----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................---K....KMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
G0VGQ5_NAUCC/583-831                   ............................................................................................................lf--FK......LSS...IPMDESVRTLLDYV.HK.QNE.......QRD....VNDLKTIISDIK..EQ.YG.STV....TDFNR.....................FIIVLLIQ..CVV...HSGSRSLSHAN.K.YIS.D..L.........KDE..LNEVfg.......aleISQ......................................................EEKEY..T...I....I.DAVMKYWN.KNS...Q...NGFLIADA.LKFAG.LI.SAK.SLYNFC..FTe....................................................iNGK...NYG.I.V.D.G.T.A..IEAIFR.NLSQQGIS..............------------------..........---...............----............................................................................----....----.---.------.N.P...E.N.VEDFEFVF.........E.............KLCIIVNGV...................VQEL.G..V.QTTE.EI.PAQILdpememdl..............................etegprlnsLWKYST..TV..SF..IKSILRRYSKEYR.............................................................................................
A0A1D6RVT2_WHEAT/678-886               ......................................................................................................qfhvsdrp----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak.........aikE-LEeaksileivegqpvpser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLALG.L.E...E.G.KELLRLLF.........K.............SFLDVLTERlppvsa.......dgdvpnL---.-..-.----.--.-RAGDpnvtfpasdpeaatmeidne......ngadnnsqvnrenteagytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A2C5XL02_9HYPO/535-777               ..............................................................................................................FKFS......DDA...TPFSAEGQEMGALL.KR.KGS.......DDE....MQAVMDRVQALA..SE.QG.---....VDPVV.....................ANADVFMT..TIC...WVGSKSLSHVL.A.CID.R..T.........KGR..LVEV...........gAAS......................................................PAARA..Q...I....I.TAVMTYWA.AHP...G...VALSILEK.LLNYS.II.SPV.SIVDWA..LVass...............................................pcggSEG...GHS.L.A.K.P.H.V..LELVRN.TVAKVSGR..............---IREVLTSADAD----..........---...............----............................................................................----....----.--A.QTREKE.S.Q...S.M.RDLLGAIN.........A.............ALAVWAAGE...................S-DA.D..V.MDDG.EG.G----...............................................AMIRRW..AS..RW..MRVFGRMAAIEE-a............................................................................................
A0A0V0S086_9BILA/466-715               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............EHKSIINYA...................D---.-..-.----.--.-----...............................................------..--..--..-------------elssylftsdidavitepffny.......................................................................
A0A1E4RTW3_CYBJA/573-812               ..........................................................................................................lyvc----......-DK...LPLKPYVEKLIEVI.HT.NQQ.......PQN....LQQAIEELKTVT..EP.FT.NG-....---EE.....................LLITIVFQ..AIA...FVGSKSTSHVA.K.CID.S..T.........RDQ..LKNLl.........spS-Sdemd.............................................deqkaLEKQV..W...A....V.GAVLSYWN.QDP...H...CGYLAVDV.LENFG.VV.SPL.AVLKHS..LDd....................................................sRDV...NIG.L.V.N.V.A.T..IESIFR.SLTRVVFS..............-------G-----S----..........---...............----............................................................................----....----.---.--STKE.L.I...Y.V.FETLLKTI.........S.............KTCQVLTQSeai.............pipDVEA.-..-.----.--.----Dvte........................................evelSWKYHT..TL..GF..VRAVLRKFSDEY-t............................................................................................
E1BMM0_BOVIN/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
W2RVM6_9EURO/542-793                   ..............................................................................................................-KFE......KEG...VPFGDKAKEIVQLI.RK.RAS.......VDE....MEPILEQVEAEA..KA.GG.SND....LQARA.....................IAIDVLAT..SIT...WVGSKSLSHVL.A.IVD.R..S.........KSV..LAKLm..........aIDN......................................................VAMQS..Q...I....I.SSIFEYWQ.FQP...G...TASIITLK.LVNYQ.VL.TPE.GVIAWT..FGt....................................................gIDG...GRC.L.S.R.V.H.S..WEIVTG.VLGKVAMK..............---VKEVVHLARTP----..........---...............----............................................................................GLDE....EKRT.ELS.GVLETE.M.T...G.H.RALFAQMK.........R.............GLQTVQTGQ...................M---.A..A.NGDR.ML.TEEEEal...........................................vkVWVAKW..SW..--..-------------cmdrkekvme...................................................................................
V5ENX7_KALBG/658-969                   ..............................................................................................................FTYA......DEA...HPYAAQAGRLINSI.KA.KAS.......AEV....ILADFETFKSSI..IE.TT.TSL....PTETSagmvpn.........atqadvVVRDLTIQ..CIL...SVGSRSFSHFL.N.IVE.R..Y.........HAL..LRQL............SRS......................................................GRMRA..A...I....L.AGAVRFWN.ASQ...Q...WVHIVVDK.LLQYR.IV.EPA.DVVEFI..FSppvde...........................................pgairtGGE...REG.W.A.G.F.N.T..WTLLRL.TLEKVNGR..............VDQLQKRLEEIQRKEGEEae......rkE-Aaaa........aglpF--Sdepeaapekaepl..................................................fptsatlpirpeeKSAE....PSST.EAL.ANLDAI.K.S...E.Q.RKVLILSV.........T.............GFKNLLLSA...................D---.-..-.---G.SQ.----D...............................................EWTQWW..IS..SW..YKQFVRCFNRQ--ll...........................................................................................
A5DCB1_PICGU/640-902                   ..............................................................................................................FYFG......NNR...LPLHEISNKVYEFLvAQ.WKP.......NED....LLDIYQELQDNL..SS.HP.AID....AET--.....................FTVNVFLQ..TYA...YLGSRSIYSVV.S.LIS.R..D.........KLK..LKYLlg.......apiD-Dkdyvpgstfr.................................feernltqeqiDKRQN..L...A....I.DSIFRLWV.NQS...Q...MAFLLLEY.LIEYK.IL.QPI.YLVGKC..LS......................................................LET...NLV.I.D.N.V.A.C..MESINR.ILESSYTT..............------------------..........---...............----............................................................................----....----.---.-----D.R.D...E.F.NVLYQYLL.........E.............RIIQNLSSLae...............gnN---.-..-.---D.EI.KITTEfsdeeadd..............................lekmnvidkQWLFYE..YT..GL..LKSYLRKYYEES-t............................................................................................
A0A1S3TVT3_VIGRR/491-827               ....................................................................................................dgkesnehgl----......---...------SGKLNSMV.KG.KSP.......VRE....IISWIDESVLPN..--.-N.G--....---LE.....................VTLRVIVQ..TLL...NIGSKSFTHLI.T.VLE.R..Y.........AQV..FVKV............CPX......................................................EDXQV..M...L....I.AEVSSFWK.SNT...Q...MTAIAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................AEN...IEQ.F.H.T.SdR.P..WEILRN.AVSKTHNR..............ISDLRKEILTIKKNISSAe........eA-Ake...........akA--Eldaaeskltlvdgepvlgd......................................npvrlnrlkshaekttedvVTVK....ESLE.SKE.ALLVRA.I.E...E.N.EALFLLLY.........K.............SFSNVLTER...................LPEG.T..R.TLHE.LK.SVQVDvmavdaeepptmelddenq.........rsqnsqsngekkggayvvgEKEQWC..ITtlGY..VKAFSRQYAA---ei...........................................................................................
Q6CH33_YARLI/537-707                   ..............................................................................................................YEYI......ESE...NQYREVADQLLDVF.KD.KYDq....gvSET....YLEVIDSIKEAV..PD.NR.---....----E.....................LLLDIVIG..AAI...FVGSRSLSLSQ.D.WIN.R..L.........AQQ..LQHV............IES......................................................AEDES..A...A....V.TTVMQFYR.NQP...H...VGTVVLHF.LLLEN.VI.SPA.AIITWL..FE......................................................SPG...DVV.F.T.E.N.H.G..WECLIR.TLDEVAQE..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------gevqdhvgpfks.................................................................................
A0A091SIX8_9AVES/187-467               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
C5MAR3_CANTT/620-797                   ..............................................................................................................FNFT......NNE...LPFHEVGSKVYDFIlTH.FKS.......NTD....FNELYKSVISEV..E-.--.--V....PNPER.....................FVVNMILQ..TYA...YIGSRSIYSVV.S.ILS.R..D.........INK..LKFL............SGAaidyvgeeaq.................................fqdlhlteeqkQDRQI..W...I....I.DAIFRIWI.HQP...Q...VVFLILEY.LIEFG.II.KPK.YLLQKA..LE......................................................S--...NLI.I.D.N.V.S.C..MESINR.VLANSK--..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------sk...........................................................................................
A0A0A0A8E0_CHAVO/186-466               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KS.KAS.......NDE....IFNILKDVPNPN..KD.DN.DDE...gLTFNP.....................LKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HKV..FKVL............AEG......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRe............sdE--Ddddndr................................................................ssdredGPLE....EQIE.RLQ.ERVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
S8D3A0_9LAMI/487-821                   ......................................................................................yssddgdekerglsselsrmvkek----......---...--------------.--.-LA.......IRE....---IISWIEDQV..LP.SH.G--....---LD.....................VTLRVVVQ..TLL...NFGSKSFTHLI.T.VLE.R..Y.........GQV..MAKI............CSD......................................................EDKQI..M...L....I.SEVRFFWK.NNA...Q...MTAICIDR.MMGYR.LI.SNV.SIVRWV..FS......................................................ASN...VDE.F.H.V.SdR.P..WEILGN.AVSKTYNR..............IADLRKELPSLKKSIATAt.......eaA-Anae.........aelE--Eerskntltlvdgepvlse.......................................ntikmkrlksraektkeqeISTR....KSLE.AKE.ALLEKA.A.Y...E.I.QELFILLF.........K.............SFSDALAGPlqetsgl....srlsggedE---.-..-.----.--.----Maidreevdldddddg................qaqkshskrkdgyrvgEKEQWCltTL..GY..VKAFARQYASE--i............................................................................................
A0A1G4K715_9SACH/581-829               ............................................................................................................ll--FK......QGV...IPGSAYVLRLLDYF.HK.QPL.......DRN....VSEIEAIFKEMQ..DE.FN.SQI....PNFNR.....................FAVTVIAQ..ALV...YSGNRSLSHAN.K.YIG.D..A.........KNE..LQEFls.......kidSPD......................................................EIKER..W...I....V.EAVLRFWN.SNS...Q...NGYLIADT.FKNND.II.SCE.SILSFS..LLd....................................................dNGR...NWG.L.V.D.A.T.A..IESTFR.ILSELALR..............------------------..........---...............----............................................................................----....----.---.------.K.Q...T.S.VKTYAFVY.........E.............RCLQLLAET...................AAGL.G..V.SEDE.EI.KSPIIddetmmdl..............................pselpkldlIWKYEA..IL..GL..LKSILRKYSDEF-v............................................................................................
A0A0J8R493_COCIT/532-785               ..............................................................................................................FKYA......QET...TPYSKEGQEILQLI.RK.KAS.......DEE....IAPVIASIEEQA..KA.HG.--I....ADPSI.....................PSTDAFVT..SIC...CVGSKSLSHLL.S.SIE.R..C.........KER..LLAI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIVDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLAA...GSI.L.A.K.P.H.I..FEMISA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................TLVE....PQLS.VIQ.DALTRE.S.A...D.M.RAMFRLID.........D.............SIVPVASGTnd...............vmM---.-..E.RDDD.SA.-LAPE..............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A1W0WKL7_HYPDU/516-782               .....................................................................................................kfdienpet----......---...LEGVKQALEVHEAV.RD.KKD.......VTR....ILEIIREVPKPE..AE.LD.---....TEFNP.....................LQIELFVH..VVM...GMYAKTFTHLF.A.ALH.K..F.........SPV..IRDL............LAG......................................................EQEQI..F...F....L.QTLYDLFR.HRE...Y...TMIVLVDR.LLRMQ.LI.DAA.SVVNWI..FS......................................................KDM...KLH.F.S.Q.H.H.V..WEILQQ.TIHRVSTL..............VQRCHADLEAAKAKVKEA.........mDQEpp...........agADENp..........................................................................ePMEE....DATE.ALE.EAHDRS.L.S...Q.Q.KNMFLVIF.........Q.............RFVMAFTDH...................LEQP.G..Q.KTKA.TE.S----...............................................MWWKTA..IG..HM..QYILMTNYE----li...........................................................................................
M3AD00_PSEFD/560-811                   ..............................................................................................................FKFA......NDQ...TPYAKEGREVLTLL.KK.KAP.......EDE....IQKVLDSVHEQA..TA.LG.--H....ADPLA.....................PSTDIYMT..SIL...SIGSKSLSHVL.S.TID.R..C.........KDR..LLSV...........gQRS......................................................ELARR..Q...I....I.ESVVQFWS.DHP...G...TAINIVDK.LLNYT.IV.TPM.SVIQWA..LQd....................................................rMDS...GRA.L.A.S.S.Q.V..YEMVSI.TMFKVTNR..............---VRQVL----RERNNL..........---...............----............................................................................SLPY....ESRQ.QID.EALPNE.R.Q...A.M.RDLFAAIE.........D.............AVAAVANGSqd...............gmIERF.-..-.NGAI.A-.----E..............................................rDLIVLW..GK..RW..ERVWQRKAAVEE-a............................................................................................
NCBP1_XENTR/485-761                    ..............................................................................................................FKYGd...esNSA...LPGYSVAVALTNAI.KN.KAS.......DKE....IFNILKDIPNPN..QD.DD.DDE...gISFNP.....................LKIEVFVQ..TLL...SLASKSFSHSF.S.ALA.K..F.........HDI..FKAL............SES......................................................DEGKL..H...I....L.RVVYDIWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SRD.F.P.R.F.Y.I..WEILHS.TIRKMNKH..............VQKIQKELEDMKLRLAKQ.........hKHRds...........ddN--Deds.....................................................................grkdGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VN.T----...............................................AWYKNC..RE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1L0DEC1_9ASCO/661-929               ..............................................................................................................YEFS......NPL...LPLNEVANKLYDFIiAN.WRS.......NEQ....FYEMLNETVEAI..KS.SI.-VD....VNSER.....................ILINLLFQ..TYA...YIGSRSIYSVV.S.ILN.R..D.........VAK..LKYIsg.......vevS-Eedykvsgtdfk................................fpdlnltpqdfNNRQK..W...T....I.ESILRIWI.HQP...Q...VAFLILEY.LIEFG.IL.KPQ.FIIQKA..LE......................................................SDH...NLI.I.N.N.V.S.C..MESINR.VLSASSKK..............------------------..........---...............----............................................................................----....----.---.------.-.D...E.F.KEVILTLF.........T.............LIVENLNNI...................VSKL.E..L.KNPE.TE.EVKIIkdftdeesn............................daalmekidlQWLFYE..YK..GL..LKTYLRKFNLQ--hs...........................................................................................
A0A093FXU4_DRYPU/455-735               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVETA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
R1EHV8_EMIHU/505-759                   ............................................................................llnrlrsraeqagrygeiwgeqapadvldwlqre----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-----VVH..SLL...DAGAKSVSHLE.R.LLD.K..F.........NWL..VAAA............AQD......................................................GPARA..R...V....V.GAVAAYWR.APR...-...--------.----E.LV.DPQ.ALVGWL..CS......................................................APE...RRR.L.A.W.P.S.T..WEGLHL.LFERSLSH..............FKSVEGELKAEEDKYAEYvem....iggE--...............--EEgstsaagrthpsva................................................ratcataalldacaRASR....QRLE.TKR.AISERA.R.R...E.K.KELFANFF.........A.............GVCGAFDEH...................AKAA.A..A.AGAP.VE.T----...............................................AWWSAA..IG..--..-------------havglcrrhiaeys...............................................................................
E3NEH5_CAERE/504-779                   ...........................................................................................................yli---D......EED...TALVQRAETFTQMF.QE.RQP.......AEA....FLNELKSAEGSE..EL.P-.---....--YNI.....................NEFGLFVM..VML...KMASKTFSHNF.S.ALF.R..Y.........QAT..LKTV...........cDAS......................................................EQYQE..K...L....L.ETLFSCWK.SNQ...Q...MLMILTDK.LLKMQ.VI.DCS.AVVAWL..FD......................................................EKM...WAE.H.N.R.Q.W.L..FEVLNQ.ALEKLTRQ..............INVVEKDIKELTERVENKgt.....ddvKEEe............meA--Eeek.....................................................................neklKQDV....DDLE.NHK.EKLERM.V.T...F.Q.KGLFNDFL.........I.............AFVEEIKIAg................anTSEM.D..G.SGDT.AG.R--QS...............................................PKFQWL..KG..RF..CHVLLAHAETL--lk...........................................................................................
S9XU20_CAMFR/244-494                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............HHQII----...................----.-..-.----.--.-----...............................................------..--..--..-------------qqymvtlenllftae..............................................................................
A0A1D6K2V8_MAIZE/357-703               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
A0A066X9Z7_COLSU/534-780               ..............................................................................................................FKFN......DDS...TPFAAEGREIAALL.RR.KAP.......DEE....FQPIIERIHSLA..IE.RS.---....LDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gVAS......................................................EVAKA..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.II.LPI.TVIEWA..LSgss...............................................hvkgQSS...GDA.L.A.Q.P.H.V..FELVFG.TVAKVTGR..............---VRQLL----T-----..........---...............----............................................................................----....KEAE.ADE.EAKERE.T.K...A.M.RDLFKAMD.........D.............ALVSWASGS...................KDEM.M..E.EMD-.-G.AGQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A1U7T2V3_TARSY/1-153                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.MIRTQ.IV.DCA.TVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrgs....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A093Q1T5_9PASS/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DGE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................stdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
Q4N8N4_THEPA/710-964                   ............................................................tqatntnltnsqldlntnltsiqvdlnsnltntqtanlvsagnvevwkrd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................DLILLFWD..TLL...IFGSKSMTHLY.R.LLE.F..H.........SDV..LKMFe..........tPESp...................................................feESLPY..K...V....M.WQTVVTFE.RDH...K...RLELSFDF.FIRNN.VF.TCP.MILKFL..FT......................................................L-P...ANV.L.M.S.N.F.F..FYAVNS.VFSEVHSR..............LVNFRESYKVALRELAGTv.......amEAK..............kQELDtve.....................................................................ldyfNFFE....QFVR.LVS.DRLSTS.D.A...N.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------irkvleellvrklvkyslqekvniklynsvtnvhe..........................................................
W6NQB7_HAECO/631-891                   .............................................................................................................c-KFD......DEN...QPGYEAASKFLALI.QS.RSD.......DNA....IMAEIRDEENRY..--.-D.---....P----.....................DLFGIFFA..VLL...KTSAKSFSHTF.V.ALS.R..Y.........STT..LKTI...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESL...KSE.T.D.R.Q.W.V..WEVLNT.ALERLSRH..............IHKVAHDVDILQKRVERQr........iEAGe............emE--Dsd........................................................................vkTREQ....EELE.QQQ.EKLENL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEF...................IVNC.E..T.EGTD.FR.T----...............................................PYYAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
Q4WDL2_ASPFU/362-611                   ............................................................................................................pt----......--A...TPYAKEGREIMQLI.RR.KAG.......DEE....IQPLITAIEEQA..KA.LG.V--....DDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................rLQA...GTI.L.S.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.A...D.M.QALFRVIE.........D.............SVVSVAGGSnd...............glMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
G3QGA9_GORGO/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
W4Y6T8_STRPU/494-770                   ..............................................................................................................YKYGe...egAES...LPGYAIAQTLCDLI.KK.KGS.......IEV....VLEVLKDAPNPK..DV.DG.MED...eTSFNA.....................LKIDVFVQ..VLL...YLGSKSFSHSF.G.ALA.K..F.........LPV..LKEL............AVN......................................................EESQI..Y...I....L.RVIKDLWR.NHS...Q...RIAVLVDK.LLRTR.VI.SCP.AVANWL..FS......................................................SFM...SSS.F.T.R.M.F.V..WEILHS.TINTMNKH..............VKGCETELEEARQSAKRP.........dD-Vd............meS--Deedr...................................................................yditkAASE....SKIE.QLQ.EKLEGA.Q.S...E.E.KKLFLIIF.........Q.............RFVMVLGEH...................MVSC.E..N.KGEE.FR.T----...............................................PWFIHA..IQ..RL..QQIFLVHYHQVV-k............................................................................................
A0A1W4VZW0_DROFC/497-721               ..............................................................................................................FKYV......DQL...LPGAKLSKELLEVM.RT.KDT......sPEA....ISGVINAFNGIG..--.-P.---....----L.....................LKTNVFTQ..NCL...HLGAKSFSHTF.A.IIT.K..Y.........HLV..FKEL...........aGND......................................................PEQQH..A...I....L.SAIFEVWE.DSD...H...LKFVVSEK.LLRRT.VL.ESR.CIVSWV..FG......................................................PLM...HKE.L.T.K.M.Y.I..WELLHS.TVRWVKHL..............-QKQNEVV----SVDDP-..........---...............----............................................................................----....----.---.---NET.D.Y...A.V.RGILLDIL.........H.............RFVKVLSAA...................--PQ.G..K.KGSE.EE.-----...............................................LWFQWV..LG..RL..LETLFIYAEDY--kr...........................................................................................
A0A0K6FSW1_9HOMO/543-823               ..............................................................................................................YAYD......DPD...HPHYQEAADLLVMV.KE.RAK.......ADE....VAAHCLKLPRSV..--.--.---....-----.....................PVQHMVMQ..SLL...HVGSRSFSHFL.N.AVE.R..Y.........LPL..LRGE............AGSgslt..............................................gdkdKEKAR..P...I....L.CAAGEYWQ.KNQ...Q...MIGIVFDK.LMQYQ.II.DPS.DVIEYA..FEs...................................................gvKEG...ETF.G.L.S.S.E.R..WLLVEA.ALNKANGR..............VVGAKRKVATLNKDEDER..........RARamak......gggigMDVDgdgq...................................................................laepdMPAS....QSLV.SAQ.KALDTL.T.K...D.Q.KKVFQSAI.........T.............GFINALTKA..................gVPAL.A..S.AGTW.GQ.A----...............................................EWSAWE..TW..CW..YRQFCRAYVPQL-r............................................................................................
W1QCA3_OGAPD/671-917                   ..............................................................................................................YLFN......NEE...HPYHELCHSIYTNI.QE.GES.......LQQ....FNDLIVLLKEQI..AK.ES.SEH....PGAEEylig.............nidcYIVTLVIQ..STC...IIGSRSLSVVE.SgALE.L..C.........GAK..LRKVlg.......lpaA-Egehedlend...................................qfpllkaeevAERQK..W...L....I.DGVLRLWN.NEP...R...IGYLILER.IKNKG.FI.SAT.QLVDSF..FA.....................................................nNES...LTM.I.S.Q.V.Y.A..SELFDR.MVTSSASE..............-AEAKDLLQT--------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------fyskiiehidllieklgddreemilgtveteesadqdtelrw...................................................
A0A1B7NR61_9EURO/546-749               ..............................................................................................................FKYA......VET...TPYATEAQEIMNLI.RK.KAP.......DSE....IEPHILAIQHAA..AS.QP.D-T....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLAI...........gPQS......................................................PAARR..Q...I....I.TSVLAYWA.DQP...G...SGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIEG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQG----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.K.G...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------dvqvmvdfv....................................................................................
A0A101M9Z8_9EURO/531-784               ..............................................................................................................FKYF......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gAES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sIAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLT.IID.ETLARE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGSnd...............eqMERG.D..G.SGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
G8BVZ2_TETPH/580-828                   .............................................................................................................l-YFI......QEN...VPISATVRKLLDYM.HK.QGE.......NKV....VTELDEIIKEFK..ED.YG.NII....VDFDR.....................FIVALMIQ..CVA...HSGSRSLSHAN.K.YIS.D..L.........TED..IKHA............FSSle.................................................ideAKKEY..T...I....V.EAMLRFWN.SNS...Q...TGFLNTDA.LRYAG.FI.TTK.SLFSFC..FEe....................................................sNGR...NLG.L.T.D.A.T.A..VESVLR.NLSQDSAL..............------------------..........---...............----............................................................................----....----.---.------.T.S...G.N.TENFENIF.........E.............KLCLILNDC...................VSKL.G..A.TVTE.AI.-VLPMldesatsfd.............................pallqqldlIWKYQT..AL..SF..IKSILRKYSKEYK.............................................................................................
A0A0K9QQ75_SPIOL/496-811               ......................................................................................................aewlalse----......---...--------DLNGMV.RG.RQT.......ARE....IISWIDENVAPV..--.HG.---....---LD.....................VTLQVVIQ..TLL...NIGSKSFTHLM.T.VLE.R..Y.........GQV..IAKV............CPD......................................................EDRQA..M...L....I.SEVSTFWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PVN..vDQF.H.T.S.D.L.S..WEILRN.AVSKTYNR..............ICDLRKEISSLKRRLESAee.....atsNA-...............---Kaeieaaesqltlmngepvvg....................................enpfklqrlitasekaeeeeVSLR....ESLE.AKE.ALLFRA.L.G...E.N.EALFLSLY.........N.............NFSIILLDR...................----.-..-.----.--.-----...............................................------..--..--..-------------lpadsaigtsrsllssqtdlmtldsdepsgmdvdvnqekglnnvsngekgaatynlsetdqw...............................
A0A0D2AUR0_9EURO/543-795               ..............................................................................................................FKYN......DDS...TPFATQGKEIAQLV.RS.KAA.......NEE....FSPVLETIEQEA..TA.SG.--M....PNPEL.....................ASTDAFVT..SIC...WIGSKSLSHVL.A.CIE.R..C.........KER..LLAI...........sSRS......................................................SACRK..Q...I....M.TSVMDYWK.DQT...G...VGVIILDK.LLNYQ.IL.TPS.SIIEWA..LVd....................................................rVAR...GSL.L.A.S.A.W.C..YELVEK.TTKKVGSR..............---VHSIVHAIRQP----..........---...............----............................................................................GLTD....DQKG.ELQ.QALTKE.L.E...G.M.TILYASIQ.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEDE...............................................ELIKAW..GG..KW..AKTFQRKCAVEE-n............................................................................................
A0A0N4YK42_NIPBR/693-912               ..............................................................................................................FKFD......DEN...QPGHEAAEKFVSLL.QS.RSD.......DNA....IMAEIRR---ED..GR.Y-.--D....P----.....................DLFGIFFA..VLM...RTAAKSFSHTF.V.ALA.R..Y.........STT..LKTI...........aDTS......................................................DEMQE..V...L....L.HCLFQCWR.HNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESI...RSE.T.D.R.Q.W.V..WDVLNT.ALERLSRH..............IHKVAHDVHILQKRVERQ..........RAEt............geE-MEdg.......................................................................dakTREQ....EELE.QQQ.EKLDNL.K.D...F.Q.KSLFLDVL.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------hvscg........................................................................................
V4MF45_EUTSA/484-814                   ....................................................................................................ymysleegke----......--K...TEEQQLSAELNKKV.KE.KQS.......ARD....MMSWIEETIYPV..HG.F-.---....----E.....................ITLTVVVQ..SLL...DIGSKSFTHLV.T.VLE.R..Y.........GQV..FAKL............CPD......................................................NDKQV..M...L....L.SQVSTYWK.NNV...Q...MTAVAIDR.MMGYR.LV.SNL.AIVRWV..FS......................................................PEN...VDQ.F.H.V.S.D.Q.pWEILGN.ALNKTYNR..............LSDLRKEISNITKNLLVA.........eKASsna........rielE--Aaesklslvdgvpvlgen.........................................pakmkrlkstvektgeaeVSLR....ESLE.AKE.ALLNRA.L.S...E.T.EVLLLSLF.........Q.............SFLAVLKERlpestk.......arslqdL---.-..-.----.--.----Ksigaedenssamevd................sengnpkkkceigereQWCLST..L-..GY..LTAFTRQYA----nei..........................................................................................
A0A091Q804_LEPDC/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NEE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A182UHZ3_9DIPT/14-299                ...........................................................................................................slq----......TSS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaspnaqk.........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A1D6RVT1_WHEAT/678-886               ......................................................................................................qfhvsdrp----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak.........aikE-LEeaksileivegqpvpser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLALG.L.E...E.G.KELLRLLF.........K.............SFLDVLTERlppvsa.......dgdvpnL---.-..-.----.--.-RAGDpnvtfpasdpeaatmeidne......ngadnnsqvnrenteagytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
F2PUZ7_TRIEC/541-794                   ..............................................................................................................FKFS......QET...TPYSKEGQELMKLI.RQ.KSS.......DEE....IEAVITSIEEQA..KT.HG.--L....TDPLI.....................ASTDVYMT..SIC...YVGSKSLSHFL.S.CIE.R..C.........KER..LLAI...........gPKS......................................................DAARC..Q...I....I.NSVMEYWV.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVLEWA..LVd....................................................nLAA...GST.L.A.K.P.H.I..FEMISA.TMRKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................TLYE....PQLS.ILD.ETLKKE.K.A...D.M.LSMFQLIE.........D.............TLVPVAGGY...................SDAM.M..E.-RTE.DD.SLQPE..............................................nVMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
A0A074YS93_AURPU/536-787               ..............................................................................................................FKYL......NEQ...TPYSQQGNAMHALI.RR.KAP.......EEE....IEVVINEIQALA..SE.HG.V--....EDVLV.....................PSTDAYMT..SIC...SVGSKSLSHVL.S.CIE.R..C.........KER..LLAI...........gPQS......................................................ELARR..Q...I....I.TSVIDYWA.DHP...G...TAVNIIDK.LLNYT.II.TPM.SVIEWA..LHd....................................................hMQH...GRA.L.A.Q.T.H.I..YEMISA.TMFKVSNR..............---MRQIVRARAEA----..........---...............----............................................................................DLSE....EQKA.LLD.ETLVRE.R.Q...T.M.RDLFNAII.........E.............AVSTVASAAqd...............dmIERF.-..-.DGD-.--.-SAEQ...............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
X1XHK1_ACYPI/1-136                     .............................................................................................................m----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...IPE.F.T.K.L.Y.I..WEILSL.TINKMSRH..............VDRLTRELNEAREKLRTTaa......isN-S..............sD--Dsdtetekaeakprqs.............................................ttttfggqgvpmdvddNVTE....EMVE.RME.EKLEMA.Q.A...D.Q.KNLFLIVF.........Q.............HH-------...................----.-..-.----.--.-----...............................................------..--..--..-------------eqvqkysstlegllftqdldih.......................................................................
A0A0W8D1U9_PHYNI/604-856               ...................................................................pdsaspasnfyqsvttklkghppasalrswlneelprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAVEVVWT..CIL...EAGVATFTHMR.L.LLE.K..Y.........GKR..NELFgge.....dqsaEET......................................................EADEL..V...V....V.KTVASVWL.KSP...Q...HIGLILNS.MLRQG.LL.RPS.TIVTWV..FT......................................................ADA...VQQ.Y.S.W.P.Y.V..WEILND.TLKFVQDA..............IGAKTKQLEQASTPR---..........-SS...............DDRD............................................................................NEEM....PDVA.ALE.DSRKRL.Q.D...E.L.RQLLVLLF.........R.............GFNRVITEH...................KAEC.D..S.EGSD.PR.D----...............................................NWFRSA..LA..QM..QAVGHR-------yrvp.........................................................................................
A0A0D0DS55_9HOMO/544-867               ..............................................................................................................FEYE......DPT...NPYHDVAQSILSLL.RG.RSR.......VDE....VISHIDTLRISL..ES.TS.IPL....PHPHTsv.................daLIRSLAVQ..CLL...SIGSRSFSHLL.N.AVE.R..Y.........LPL..LRGL...........aN-Pnpah.............................................gggdeTEAKR..N...I....L.DAAAFFWR.RNQ...Q...MVGIVFDK.LMQYQ.IV.DPT.DVVAWT..FGhagml...........................................dgmgdgDPG...RPS.C.I.G.A.F.E..WDLIKG.ALDKANGR..............VMVARRKVAALRKEQDDSia......raKASgga........dvasM--Eadadvk...............................................................pikqddpAAES....PQLK.IAL.KAFTSL.T.R...E.Q.KCALSRTI.........E.............SFVSCLALS...................--PS.D..P.RHNP.YG.QSVTTeqawqk..................................rltwsndEWKTWE..TW..GW..YRHFCRMYAPYL-r............................................................................................
H0EIC4_GLAL7/760-946                   ............................................................................................................dd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...--GSKSLSHVL.S.SIE.R..C.........RER..LLAI...........gPRS......................................................SDARK..Q...I....I.DSVMDYWK.DQP...G...IGVNIVDK.LLNYT.IL.SPG.SVIEWA..VS......................................................Q-H...GNR.L.S.M.S.Y.V..YEMVSL.TIGKVTGR..............---TRQVV----RSSKVP..........---...............----............................................................................GLTA....EQRT.LVV.QSMQAE.R.K...S.M.KDLFALME.........D.............SLVSWATGS...................KDQV.M..Q.S--G.DG.TSDEE...............................................AVIRQW..GE..RW..LRVFRRKYAVEE-a............................................................................................
A0A1D6RVT2_WHEAT/531-645               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAI----.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------aixx.........................................................................................
A0A1B0FFF1_GLOMM/489-772               ..............................................................................................................YKYAs...eeAGS...LAGTQVAHQLVVAI.RQ.KCS.......PEE....VINILKELPNSG..EN.SD.QEM....SDSSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKIQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLSNELNDAKEKFAKA..........DSSs.............sDS-Edeatpkr.............................................................kkpvtvvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..VG..RL..QQVFLMHHEQVQK.............................................................................................
F7AA70_XENTR/484-760                   ..............................................................................................................FKYGd...esNSA...LPGYSVAVALTNAI.KN.KAS.......DKE....IFNILKDIPNPN..QD.DD.DDE...gISFNP.....................LKIEVFVQ..TLL...SLASKSFSHSF.S.ALA.K..F.........HDI..FKAL............SES......................................................DEGKL..H...I....L.RVVYDIWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SRD.F.P.R.F.Y.I..WEILHS.TIRKMNKH..............VQKIQKELEDMKLRLAKQ.........hKHRds...........ddN--Deds.....................................................................grkdGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VN.T----...............................................AWYKNC..RE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1B0DJX8_PHLPP/1-271                 .............................................................................................................a----......---...LPGTPTAHQLVVSI.RQ.KCT.......PEE....VLDVLKDLPNPN..EN.EG.-DG....GDFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HQV..FKSI............AET......................................................EEAQI..C...I....L.HNLFELWK.NHQ...Q...MMCVLVDK.LLKLQ.IV.ECS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLGTELGEAKEKLAGE..........ESSs............seS--Eeesaakk..............................................................kkieiadKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DGKD.YD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0N5AUR6_9BILA/501-762               ..................................................................................................dnensdtnemim----......---...--------------.--.---.......---....--RFETIIREKK..PP.DE.V--....----Ipll..............gnngEYLATFLS..VLL...NSAKTTFSHSF.A.ALT.K..Y.........YQV..LKQV...........iGEK......................................................DDLQM..V...V....L.VTIYDLWK.YHH...Q...MVVLLVRK.LLVMS.LV.EAH.TVVKWI..FS......................................................SEM...KNE.F.E.R.L.W.V..YELLSF.TLQHIDGH..............VRRAAENVKTLKNESSVK..........KETn.............nNE-Engdveman...........................................................sgngeaeseNTAS....ADVS.AKE.EELSKL.K.A...F.F.KDLLIAVL.........H.............EFAVLLNEH...................IVSS.E..A.SGTS.FD.T----...............................................DWYRLI..VG..RF..EGIFLQ-------fweil........................................................................................
A0A1V8UBP4_9PEZI/557-808               ..............................................................................................................FKYA......DDK...MPYASEARALLKLL.KE.KAS.......EEQ....IQAILDDVRDQA..TS.HG.V--....PDPLV.....................PSTDVYMT..CIL...NFGSKSMSHVI.S.NID.R..L.........KDK..LSAL...........aTQS......................................................EAARR..Q...I....I.SSVVDFWS.LHP...G...NAANIVDK.LLNYT.II.TPM.SVIEWA..LHe....................................................rMDR...GRA.L.A.S.A.Q.M..YELVSH.TVAKVSAR..............---VRQVLQQRANT----..........---...............----............................................................................SLPF....DQRQ.VID.AVLPRE.R.Q...T.L.RDLYATIE.........D.............AVASVANGSqd...............emMERY.-..-.EGE-.--.-EEER...............................................AIIMQW..GE..RW..ARVWRRKAAVEE-a............................................................................................
A0A2A9PB92_9HYPO/536-778               ..............................................................................................................FKFN......HAE...TAFSAEGQEMGALL.KR.KSS.......DEE....MQAVIDRVQAQA..NE.QG.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..S.........KGR..LNDA...........gEAS......................................................PAARA..Q...I....M.TAVMSYWR.AHP...G...VALSILDK.LLNYS.IL.SPV.SIVDWT..LVag..................................................spGGG...VQA.L.A.Q.P.H.M..LELVRN.TVAKVSGR..............---VRDVLTSADSD----..........---...............----............................................................................----....----.--A.EAREKE.T.Q...A.M.RNLFKAIN.........D.............ALAVWAGEG...................KDQK.M..M.DDGD.A-.-ADRE...............................................AMIRRW..GS..RW..LRVFRRMAAIEE-a............................................................................................
B9QCY2_TOXGV/839-1114                  ............................................................krerrsfsesaedavdasskrglndesreeetkdsrdafeadsgpyedde----......---...--------------.--.---.......---....------------..--.--.---....----Eghl..............wtltDLSQVLVF..ALL...ARGLKTLTHSE.R.LVE.N..Y.........FPV..FQFLk.........kgA-Shkaflemrpatleaagddedard.......gddsdtemeeeadeegltkaerrsQEVEE..A...F....L.KAIFDFWK.HSR...Q...KTVLTVRH.FQRFD.VV.SKE.GVVRFV..FD......................................................SLT...PTD.R.D.D.S.R.V..MELFDL.LLQLSIQE..............-------F---ESKKETAl.......qlS-Q..............dCSDDa.........................................................................erNARG....KAVS.AAV.EALEAV.Q.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------tllhfivvgfmrellredqa.........................................................................
U6LS04_9EIME/792-994                   ...................................................................................gkqqfaaalsalercstdtegapwapd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................DLIKLFVF..CLL...SVGSKTQTHLH.R.VLS.N..Y.........AQT..FQLY............AAQteeqqq.........................................qqelqqqQQQQL..D...IhpavL.QAVQKYWT.TSQ...Q...RTALTLHA.FLKIG.IL.KRA.RVLQLL..CLa....................................................eAEA...RDS.W.S.Y.L.E.L..IETVFRgAVDECE--..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------tareaaaesgspfptgteaeegtadvkvgendariqnlltiieqvqrh.............................................
A0A0D8Y6M5_DICVI/129-382               .............................................................................................................c-KYD......DES...VPGYEIACKFVSLI.QS.RAD.......DSM....IISEIRDVDGNY..--.--.---....-DP--.....................-------E..VLM...KTSAKSFSHTF.V.ALT.R..Y.........NLT..LKTV...........aDTS......................................................DEMQE..I...L....L.RTLFQCWR.NNY...L...RIVILVDK.MLKMQ.IL.DCG.VVISWI..FG......................................................DSL...RGE.T.H.K.Q.W.K..WEVLNT.ALERLSRH..............IHKVAHDVQILQKRVKHQr.......igNDE...............EMEDld........................................................................vkSREQ....EELE.QQK.EKLENL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEY...................IVHC.E..T.EGTD.FR.T----...............................................PYFSWI..KG..RF..KQIFLMHGAD---lhe..........................................................................................
A0A1V6PMX9_9EURO/532-785               ..............................................................................................................FKYL......SNT...TPYSKEGQEIMQLI.RK.KAT.......DEE....IEPVINAIEEQA..KA.LG.V--....EDPKV.....................PSTDALVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KDR..LLAI...........gSAS......................................................QRARC..Q...I....I.TSVMEYWA.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sMAA...GTV.F.A.K.S.H.I..FEMISA.TVGKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLS.VLD.ETLARE.R.A...D.M.QALFQFIE.........D.............SIVSVAAGSnd...............elMERG.D..G.SGDL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-a............................................................................................
A0A1Q2YI43_9ASCO/802-1047              ..............................................................................................................YLFN......HDD...HPYNDICRDIYMNLeNV.DES.......TES....LVELTTKLKEKI..ES.DS.SGI...vENSDE.....................YIITLVVQ..SIC...LIGSRSFSVFE.E.SLN.K.vF.........GDK..LNMIv.........enTDN......................................................DRKKQ..W...I....I.DAVLRIWN.NEP...R...IGFMFIEK.LLRYG.TM.DEV.TVVESV..WNc....................................................sKRK...VLP.L.C.E.V.Y.A..DEFLGR.LLDYADES..............--DGEEELAKQ-------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------reivevylemsvsklngfyeeavaeaegnsgidlqhleglnetnseaewglknsiglivskvrkyk...........................
A0A0R3RDS9_9BILA/1-89                  ....................................................................................................mnndmetneh----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............DDMA............................................................................DPNA....MESF.VKE.SEFADL.H.E...C.L.KNLLLDVL.........H.............KFTVTLTEH...................IVNS.E..S.NGND.FQ.N----...............................................NWYLFV..TG..RF..KNVFLKYWR----dlfe.........................................................................................
A0A197KG16_9FUNG/563-821               ..............................................................................................................WKFE......SPD...HPYHAMASAVLNSL.RA.KNS.......IEQ....IEQTLESMKNAP..RL.ES.LTA....NERED.....................FIRELFTE..CVL...MLGSKSFSHVL.N.VIE.R..Y.........LTI..LQRM............NST......................................................PEARL..H...T....V.KIVAQFWK.NNT...Q...FMGILLDK.MLNYR.VV.DAI.AIVKWV..FE.....................................................pEVW...QNE.W.H.R.S.F.V..WDILKN.TLNKVISR..............VGQVKDKLSEVVKEFNAT..........---...............---P...........................................................................pTQTK....EVVE.GVE.NTLSIV.N.R...E.Q.KEVFLIMY.........Q.............KFVQVLQSQ...................LREI.E..A.SGED.VD.E----...............................................--SRWWqiGL..GW..FLELGRRYSKE--vt...........................................................................................
A0A1R1Y852_9FUNG/673-916               ..................................................................................kyviseideetknvsiavgkcmkangsa----......---...--------------.--.---.......-EM....IINILKE-----..--.HY.-QG....PDSGY.....................LKLEMLIE..HML...LSGSKGFSHMI.G.SIE.K..Y.........SSV..VEVV............CQEi...................................................hdGNQKQ..F...I....S.NIISRFWN.GNP...Q...FLSITIDK.YLNYK.II.DPI.SIINTM..MT......................................................D--...TFE.F.L.F.F.E.K..WDIIIN.LVNKLELR..............INQLNYRISHS-------..........---...............----............................................................................-QQS....NEIE.MLK.ELLVGL.E.L...D.M.QQAIIQIF.........E.............KFAMLFVLL...................-QSL.E..I.SESD.KR.-----...............................................QQEE--..--..--..-------------slvgrfiefnrrychhikktsse......................................................................
F7DG19_HORSE/473-748                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVATWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..S.DGTS.VL.T----...............................................PWYKNC..VE..RL..QQIFLQHHQIIQ-q............................................................................................
B4NU09_DROSI/1-276                     .............................................................................................................m----......-PS...LPGTTVAHQLVVAI.RQ.KCT.......PEE....VVNILKDIPNSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.L.Y.L..WEILHL.TIKKMNKH..............VIKLNSELSEAKDKLAKA.........dS-Ss............sdS--Eddsshkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0P1AD86_9STRA/607-861               ..................................................................vkdeaspasdfyqsvttklkghppalalrswlnealprleisra----......---...--------------.--.---.......---....------------..--.--.---....-----.....................EAVEIVWT..CIL...EAGAATFTHLR.L.LLE.K..Y.........GKR..NELFgsd.....nqpaDET......................................................DADEL..V...V....V.KTVASVWL.LSP...Q...HIGLILNA.MLRQN.LL.RPS.TIVAWA..VT......................................................SDA...VQQ.Y.S.W.P.Y.M..WEILND.TLQLVQDA..............ICTKTQQLEQASLP----..........RAS...............DDRD............................................................................NDEM....LDVA.ALE.DDCKRL.Q.D...E.L.QQLLVQLF.........R.............GLNRVITDH...................KSEC.D..S.EGLD.PR.D----...............................................NWFRSA..LA..QM..QALG---------lryrvpl......................................................................................
NCBP1_HUMAN/485-760                    ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
#=GR NCBP1_HUMAN/485-760         SS    ..............................................................................................................-TTSS...SS-TT...STTHHHHHHHHHHH.HT.T--.......HHH....HHHHHTSS----..--.--.---....--S---...................HHHHHHHHH..HHH...HHTTTSHHHHH.H.HHH.H..T.........HHH..HHHH............TSS......................................................HHHHH..H...H....H.HHHHHHHT.T-H...H...HHHHHHHH.HHHTT.SS.-HH.HHHHHH..TS......................................................GGG...STT.T.T.S.H.H.H..HHHHHH.HHHHHHHH..............HHHHHHHHHHHHHHHHHH.........----..............---------....................................................................--HHHHHH....HHHH.HHH.HHHHHH.H.H...H.H.HHHHHHHH.........H.............HHHHHHHHH...................HHHH.H..H.HT--.SS.-----...............................................HHHHHH..HH..HH..HHHHHHTHHHHG-G............................................................................................
A0A135LQB8_PENPA/531-784               ..............................................................................................................FKYS......SEL...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTES......................................................QRARC..Q...I....I.SSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................GLYE....PQLS.VID.ETLARE.R.A...D.M.QALFKYIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGTQ.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-a............................................................................................
A0A0N0V7F8_FUSLA/532-777               ..............................................................................................................FKFK......NPD...TPFSKEGMEIAGLL.RR.KAA.......DEE....FQPLIDSIQSQA..SE.QS.---....LDPLV.....................ASTDVFMT..AIC...WVGSKSLSHVL.A.CID.R..A.........KGR..LLEA...........gNAS......................................................EAARA..Q...I....I.SALMSYWH.AHP...G...IALSITEK.LLNYS.IL.TPM.TVVDWA..LVast...............................................pangANG...GES.L.A.E.P.H.I..FELVSN.TLTKVATR..............---SRQVI----SSP---..........---...............----............................................................................----....---D.TDE.ETRAKE.V.K...S.I.HDLFRATN.........D.............ALVSWAGGS...................KDEL.M..E.EGDG.S-.-SDRE...............................................AMIQRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
A0A0J8RXD1_COCIT/512-765               ..............................................................................................................FKYA......QET...TPYSKEGQEILQLI.RK.KAS.......DEE....IAPVIASIEEQA..KA.HG.--I....ADPSI.....................PSTDAFVT..SIC...CVGSKSLSHLL.S.SIE.R..C.........KER..LLAI...........gPRS......................................................AAARR..Q...I....I.TSVMEYWV.DQP...G...NAVNIVDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................nLAA...GSI.L.A.K.P.H.I..FEMISA.TMGKVTNR..............---IRQIVAARTQP----..........---...............----............................................................................TLVE....PQLS.VIQ.DALTRE.S.A...D.M.RAMFRLID.........D.............SIVPVASGTnd...............vmM---.-..E.RDDD.SA.-LAPE..............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A0S7DEN9_9EURO/529-782               ..............................................................................................................FKYS......SDT...TPYAKEGREIMQLI.RK.KAG.......DEE....IQPLITAIEEQA..KA.LG.V--....DDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................rLQA...GTI.L.S.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.A...D.M.QALFRVIE.........D.............SIVSVAGGSnd...............glMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
A0A0D2E9Y8_9EURO/540-792               ..............................................................................................................FKYN......EES...MPFSAEAKEIAQLI.RQ.KAP.......NDE....FTPVLEKIEQDA..AS.QG.--L....TDPKL.....................AAVDAFVT..SIC...WVGSKSLSHAL.A.CTE.R..C.........KDR..LLAF...........sASS......................................................SACRK..Q...I....I.TSVMDYWR.DQR...G...VGVILIDK.LLNYQ.IL.TPA.SVIEWA..LId....................................................hVNR...GSL.L.A.T.T.W.C..YEIVNN.TTSKVAGR..............---VRSLVAAIRTP----..........---...............----............................................................................GLTE....EQKS.ELQ.STLTRE.L.E...G.M.KSLFATIE.........D.............AVGSIRDGN...................QDEM.I..E.-SSD.AL.RAEDE...............................................ALLRSW..GG..RW..ARVFQRKGAVEE-s............................................................................................
I1BQW9_RHIO9/543-807                   ..............................................................................................................FKFS......DTS...DPLNAKSKEIIDSL.RT.KKS.......VEE....IRDLLAKYKDEL..AS.QG.VNE....GEQQS.....................LVRELFIQ..CLL...LVGSKSFSHVL.N.VVE.R..Y.........LEV..LRFL............NSA......................................................PEGRL..H...T....V.QILASFWK.NNT...Q...FLGILLDK.LLNYR.VI.DPT.CVITWV..FE......................................................EEQ...FKH.A.G.R.A.F.V..WEILKN.TLGKVNSR..............VAQVKSKLDNLQSIHEMN..........KAKrlet.......evteM--Sea........................................................................eeQQEL....DSIR.IVE.NSLATV.T.R...E.R.KEVFLLVC.........Q.............KFAQVLSAI...................D---.-..-.----.--.-SVSQ...............................................QWIYWW..IS..GW..YKEILRVNYKEC-k............................................................................................
E2AC77_CAMFO/488-764                   ..............................................................................................................YKYSs...egASS...LPGTAAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPR..EN.EE.TNN....YNP--.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...TSE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELSEAREKLRRA.........eS-Rsg..........sssD--Dednnk..................................................................eknreRPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A0R3X3V2_HYDTA/565-899               .............................................................................................krssrsnstasstsaas----......---...--------------.EK.ACP.......VKD....ELASSKRVRNEK..ME.EN.EDD....LDNCLvpg...............vtnRELELFMT..ALL...YRAHKTISHTC.S.LLN.R..Y.........SET..FKTL............AST......................................................VELQV..E...A....L.HILQAVWC.NQS...Q...MVVAISDY.MSRQS.ML.DPE.SIVGWA..FSpfmsafsg......................................plapppstVHV...CPR.M.L.Q.S.H.V..WECLMH.TLVRVGQR..............IAQITPKLEAVKDQAGVHr........rK-Sas..........gsrS--Dgsssdlddgdddgdlrakivr.................................grrrhqrhcrsrsrdsssggggGASP....DRLA.RLN.EERGEA.V.R...S.Q.CAVITLLL.........H.............RHVRLIATVes...............ktTEEM.E..T.SDNQ.SD.LVDLE...............................................SVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
A0A165DYG8_EXIGL/560-843               ..............................................................................................................FEYE......DPT...NPHHDVAQTILGLL.RD.RTK.......AEQ....VITETETLRNQL..QE.SG.DAR....A--DS.....................VVRAITLQ..ALL...NVGSRSFSHLL.N.AIE.R..Y.........LPV..LRSL...........vASG......................................................GEARA..E...V....L.KAVGAFWA.RSG...Q...MVAIVVDK.LMQYQ.IV.EPA.DVVSFA..FA......................................................S--...-SE.T.S.H.A.T.Q..WELVRA.ALDKANGR..............TRIASRRLAAIRKEEEDA.........rA-Kkm..........vaaM--Dvdasesa..............................................................apatdepTADS....EAVI.SAK.KACEVL.A.R...D.Q.RTALAKTL.........E.............CFIQRLTDPaap.............ravLEPS.S..W.D---.--.----Ares........................................wgapEWHTWQ..AW..CW..YRHFCRAYAPYL-r............................................................................................
A0A0L7LUP8_9NEOP/6-205                 ...........................................................................................................kct----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........--N..LQIL............AES......................................................EEAQM..C...I....L.RNVWELWQ.RHP...Q...MVCVLVDK.MLKTQ.IV.DCS.AVATWL..FS......................................................KEM...APY.F.T.H.G.Y.L..WELLHL.TVDKMNKH..............VSKLNAEDADSGLQRRGH..........LAL...............LQGDgallpvga............................................................avphrrpdEQAR....AELQ.EAR.EALARA.D.S...S.S.SDSEDETN.........N.............KKKKDQNKPte...............ehLVRC.D..T.DARE.YE.T----...............................................HWYNAT..VG..RL..RQVFL--------cvsit........................................................................................
W5MTK1_LEPOC/490-771                   ............................................................................................................fiYKYMd...esSSS...LPGYPMAMIISNAI.KN.HST.......NDE....ILALLKDVPNPN..QE.ED.DDE....GDSFN....................pLKIDAFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..LKNL............TDS......................................................DEGKL..H...I....L.RVVYDAWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PDM...AHD.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKEKLEKQh.......rrK-Ds............gdE--Defekn..................................................................sdeedGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGVD.FN.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
I1H5J0_BRADI/483-829                   ......................................................................................................fryhtdds----......KES...TEGHRLSKELVGMV.RG.RKT.......TRD....IISWVEEQIVPA..--.NG.---....---AK.....................FAIDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............VSDLRKEIQTLRKSIQVA.........kE-Asa..........kasR--Eleeaksvleivegqpapse......................................tpgrlrrlqgfadrakeeeVATE....ESLE.AKE.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTERlppis........angdvpN---.-..-.----.--.LRAGDqdvtfaaadpevatmeidne......ngadndsqlngkktkvgysigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
E0VJH5_PEDHC/460-735                   ..............................................................................................................YKYTl...deAGH...LPGSNVANQIIAKI.RA.KCA.......PEE....IIGLLKELPNPD..TE.DE.SGD....TRFNP.....................LKIEVFVQ..TLF...FLGSKSFSHSF.A.AIS.K..F.........HHV..FKIL............GES......................................................EEAQI..C...I....L.RNLYEVWH.QHP...Q...MICVLVEK.MLKTQ.II.ECS.AVANWI..FS......................................................KEM...SKE.F.T.R.M.Y.L..WEILHL.TIKKMNKH..............VTRVSRELSDARERLGRGes.....dsdS--...............---Dnenkn..................................................................ndekeKPTE....EMVD.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............VNYLNLSEH...................LVRC.D..T.DGKD.FD.T----...............................................HWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
E5SWE1_TRISP/494-764                   .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DG.NV.ELD....HQL-Nnplsnn........mdmpfnpLKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHE---.---...-...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A0F7VEW1_9EURO/535-788               ..............................................................................................................FKYS......SEA...TPYFKEGQELMQLI.RK.KAN.......DDE....LEPIIASIEEQA..QS.LG.V--....EDPKV.....................PSTDALVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KDR..LLAV...........gAAS......................................................EKARL..Q...I....I.TSVMEYWA.DQP...G...IAINIVDK.LLNYT.II.SPL.SVLEWA..LHe....................................................hIAA...GSI.L.S.K.P.H.I..YEMISA.TVGKVTNR..............---MRQIVAARTQK----..........---...............----............................................................................NLYE....PQLS.ILD.ETLSRE.R.V...E.M.KNLFKFIE.........D.............AIVSVAAGSnd...............elMERG.D..G.SGDM.PE.D----...............................................AILRQW..GR..RW..LRVFRRKAAVE--da...........................................................................................
A0A0D2FBL8_9EURO/536-788               ..............................................................................................................FKYN......DDS...APFAAEGKEIAQLI.RR.KAA.......DEE....FSPIMDKIEQEA..TA.S-.-NI....PDPQL.....................ASADAFVT..SIC...WVGSKSVSHVL.A.CIE.R..C.........KER..LLAI...........sSTS......................................................AACRK..Q...I....V.TSVMDYWK.DST...G...VGVVILDK.LLNYQ.IL.TPA.SIVEWA..LId....................................................hVAR...GTL.L.A.R.T.W.C..YELVDK.TTRKVASR..............---VRSIVHAIRQP----..........---...............----............................................................................GLAD....DQKS.ELQ.QALTEE.L.E...G.M.KALFAIIE.........D.............AVVSIRDGN...................QDEM.I..E.-SSD.AL.RAEDE...............................................DLLRSW..GA..KW..AKVFQRKYGVEE-s............................................................................................
A0A194SD53_RHOGW/1349-1632             ..............................................................................................................YAYE......DEQ...HTHYAAASAFLRLI.RA.KAP.......ISE....AEDELASFQKAL..ES.ER.GLS...tAEADK.....................VKRDLAVQ..TVL...NVGSRSFSHFL.N.ALE.R..Y.........LTL..LRGL............TSS......................................................ASARQ..D...L....L.TTVAAFWR.RHP...Q...FHLIVLDK.LLQYR.LV.DTR.DVTAWV..FApad................................................eqpGAR...TKT.W.S.D.I.D.L..WQMLQV.TLRTVQFR..............VDSARARLEGFRREDEAR.........gA-Eg............ggEELDaegd...................................................................vavrdAQDN....PEIA.SAA.SYLAES.E.A...E.Q.AQTLLEIL.........G.............HFAKLLPFK...................-NAD.E..A.KDEK.DG.EAGED...............................................EWERWW..TL..GW..VREFCRS------wlthk........................................................................................
A0A067SWU0_GALM3/537-857               ..............................................................................................................YEYD......DPI...NPHHDAAQAVLNLF.RG.RAK.......AED....VIAHLDSLKNNL..ET.SD.DGQ....VNVDS.....................LIRSIVVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNL............ASGgtsgs............................................sgtgnPEAKA..D...V....L.TAAASFWK.HNR...Q...MVAIVFDK.LMQYQ.IV.DPT.DVVAWT..FLngva.............................................vgqlaELG...GPM.N.L.S.A.F.E..WDLLRG.ALDKANGR..............VTIARRKVATLRKEDDDArg......rvKARad...........etM--Evdadakeet..........................................................eetaakeapQVDS....PTLI.TAL.KAFSSL.T.K...E.Q.KTALSRTL.........E.............GFVACLAPS...................S--T.D..P.HANP.HA.RTVITeeawdn..................................ranwgrdEWNAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
A0A0B1SE47_OESDE/4-235                 ...........................................................................................addnammaemretegrydp----......---...--------------.--.---.......---....------------..--.--.---....-----.....................DLFGIFFA..VLL...KTSAKSFSHTF.V.ALS.R..Y.........STT..LKTV...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................EGL...RSE.N.D.R.Q.W.I..WEVLNT.ALERLSRH..............IHKVAHDVKILRKRVDRQ..........KAEn............eeM--Een.......................................................................dqkTREQ....EELE.QQQ.EKLDNL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEF...................IVHC.E..T.EGTD.FR.T----...............................................PYFAWI..NG..RF..KQIFLM-------vgf..........................................................................................
S0DTB1_GIBF5/531-776                   ..............................................................................................................FKFQ......NPE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFDSIRTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KGR..LLEA...........gNSS......................................................DAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LVNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.L..FELVFN.TIFKVTRR..............---SRDVV-AA-------..........---...............----............................................................................----....--PE.TDE.ETRIKE.I.K...S.T.QDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
B4JE26_DROGR/498-712                   ..............................................................................................................YKYL......NEL...LPGSMLAKALLEVI.RA.KCT.......PEQ....LGGLMEATTELD..--.--.---....---DE.....................LKVNVLMQ..TFL...HLGCKTFTHIN.S.MFS.K..F.........NSV..LKML............ASS......................................................DANQL..S...M....L.RALFEVWA.NNE...Q...YKVVLADK.LMKMQ.VV.STK.VIVNWI..FD......................................................AAL...KQE.L.A.K.M.Y.M..WELLNL.TVRFTKTH..............-------L---RTC----..........---...............----............................................................................----....----.---.--KEDR.E.A...S.M.QNLLVHIV.........V.............SCVRVLSEH...................--QA.T..V.QDVD.TD.-----...............................................YWYNWV..QG..RF..QALL---------fkyiddvr.....................................................................................
A0A0E0D0E6_9ORYZ/419-744               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVCQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WETLRK.GLQAAKEA..............SEKAARELEEAKSIIEIVdgq...pvpsE--...............---Npgrlrrlqa..........................................................radkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisv.......dgdvpnL---.-..-.----.--.-RAGDpnvnsaardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A1L9S994_9EURO/535-788               ..............................................................................................................FKYA......SDA...TPYSKEGKEIMQLI.RK.KAI.......DEE....IQPLIDAIEEQA..KS.LG.V--....EDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ASARR..Q...I....I.TSTMEYWA.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LId....................................................nLAA...GTI.L.A.K.T.H.I..YEMVSA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLN.ETLTRE.Q.A...D.M.RSLFKLIE.........D.............TIISVASGSnd...............gmMERG.D..S.SGTL.PE.D----...............................................EVIRQW..GQ..RW..LRTFRRKAAVEE-s............................................................................................
H2QXJ3_PANTR/484-759                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0G2ETS1_9EURO/477-729               ..............................................................................................................FKFA......NEA...TAFAPEGNQLAALI.RS.KSS.......NDE....IEPIIQSIEAQA..KS.MN.TI-....-DPLL.....................ASTDAFVT..AIC...YIGSKSLSHLL.S.CIE.R..N.........KDR..LLSI...........gSQS......................................................PAARR..Q...I....I.TSVMDYWR.DQP...G...VGINIVDK.LLNYT.II.NPI.SVVEWA..LVy....................................................hSSH...GTN.L.S.V.S.H.I..YEMISS.TVGKVTNR..............---VRQIVFAYRRP----..........---...............----............................................................................GLPT....EQSV.LLQ.ETLERE.Q.K...D.M.RQLFAVID.........E.............ALLSITTGS...................T-NQ.E..M.QVDD.TL.NQGDQ...............................................ELLGRW..GQ..RW..VRVFSRKLLVEE-a............................................................................................
G8YCN1_PICSO/650-914                   ..............................................................................................................YVFS......NSG...LPLNEISKTVYDFIiAS.WKP.......NDE....FKNLYDQILESV..SE.HP.DIN....TDK--.....................FLINLIFQ..TYA...YIGSRSIYSVV.S.LFE.R..D.........IVK..LQFLsgv......einE-Ekysgtdfkf...................................tklelsetqiANRQR..W...I....V.DSIFRIWI.RQP...Q...VAFLILEY.LIEFG.IL.QPQ.YLIEKA..LD......................................................VNH...NLI.V.D.N.I.S.C..MESINR.VLSNQIKK..............-EGS--------------..........---...............---Dkl........................................................................ilNLFD....SIVK.NIN.QTLNSL.R.E...A.E.VDNPLKIV.........T.............EFSE-----...................----.-..-.----.--.----Eeiened..................................vmeridnQWLLFE..YK..GL..LKSYLRKFG----efna.........................................................................................
A0A094ECF2_9PEZI/534-785               ..............................................................................................................FKYN......DED...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTNR..............---LRQIV----ASRNAP..........---...............----............................................................................GLEH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
B0DK62_LACBS/550-863                   ..............................................................................................................FGYD......DPG...KAHHDAAQAVLNLF.RG.RAK.......AED....VISHLDTLKSTL..ES.SD.EGH....VNVDA.....................VVRSIAVQ..SLL...HIGSRSFSHLL.N.AIE.R..Y.........LPL..LRNL............ASSgvssv............................................ggggnAEAKA..D...I....L.SAAAAFWK.HNR...Q...MVGIVFDK.LMQYQ.IV.DPT.DVVGWT..FLngav.............................................igqfsELA...GPM.N.L.S.T.F.E..WDLLKG.ALDKANGR..............VMIARRKVTALRKEDDDTra......rvKASt.............dA--Dtmevda...............................................................eekpedtTSDN....PALV.TAL.KAFSSL.T.K...E.Q.KAALSKTL.........E.............GFVSCLAPS...................L--T.D..P.SPNP.HA.RTVISeeawen..................................ranwgrdEWSAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
A0A072PND4_9EURO/542-794               ..............................................................................................................FKYN......DDA...TPFAAHGREIAQLI.RK.KAA.......SED....FAPFLESIEQEA..SA.AG.--L....ADPVL.....................ASTDALVT..SIC...WVGSKSMSHVL.A.CIE.R..S.........KDR..LLET...........gNAS......................................................PTARK..Q...I....I.TSVMEYWK.FQQ...G...IGGVIVDK.LLNYQ.IL.TPA.SVVEWA..LId....................................................hVER...GTV.L.A.S.T.W.A..YELVDN.TTRKVANR..............---VKSLVDAIRQP----..........---...............----............................................................................GLDD....EQKT.QLQ.HALSQE.Q.E...G.T.KGLFAIIE.........D.............AVVSIRDGN...................QDQM.-..M.ESSD.SL.REEEE...............................................ALLKSW..GG..KW..ARVFQRRFAVDE-s............................................................................................
NCBP1_DROGR/488-770                    ..............................................................................................................YKYTs...eeAAN...LPGTTVALQLVGAI.RQ.KCT.......PEE....VVNILKEIPSSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HVV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNVELSDAKEKLSKA..........DSSs............sdT--Dedtphkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A094D5U6_9PEZI/549-800               ........................................................................................................ikltkl----......--D...TPFAAEGREIHTLL.KR.KAP.......EPE....IQTVIDQIHTQA..TT.IA.--I....HEPLL.....................SSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..LLSI...........gNTS......................................................ETARR..Q...I....I.TSVMAYWV.DQP...G...IGVNIVDK.LLNYT.IL.TPL.SVVEWA..LLd....................................................dTKA...GDK.L.A.E.P.F.V..FEMVAG.TVQKVTHR..............---LRQIV----ASRNAP..........---...............----............................................................................GLDH....EQRL.LLD.ETLLRE.R.V...A.M.KDMFKVME.........D.............ALFSWASGS...................KDQA.I..E.AGLG.ET.--TDE...............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
C1GGW1_PARBD/565-817                   ..............................................................................................................FKYS......LET...TPYATEAQEIMQLI.RK.KAT.......DAD....LQPHIQAIEQQA..AA.SG.V--....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLEYWA.DQP...G...IGVNIIDK.LLNYA.IL.TPL.SVIEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQL----..........---...............----............................................................................GLVE....PQLS.VID.ETLRKE.R.G...D.V.GVMFDVIE.........G.............ALVGVVGGAg.................aG--D.G..M.QGNG.AM.----Eg............................................egGIIPEW..GR..RW..LRVFRRMKAVEE-a............................................................................................
H3B1S7_LATCH/487-774                   ..............................................................................................................YKYGd...esNSS...LPGYNVALSISTAI.KN.KAT.......NEE....ILSILRDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFMQ..TLL...YLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVLYEVWK.NHP...Q...ICIIFFFF.LIKTS.LL.FCC.FSSQAV..FI......................................................KKK...KKK.K.K.K.K.T.D..YTLLRG.TRRDEKKR..............CKKLVSKEKARKEK---Kcfhi..lfsrA-Ksrsl.......krdsD--Dddddr.................................................................dsdeedGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.FS.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0D1DTA6_USTMA/651-975               ..............................................................................................................FTYA......DES...HPYAAQAGRLINSI.KA.KAS.......AEV....ILADFESFKASI..LD.NS.SAI....PSDDAveglva........dalqadvVVRDLTIQ..CVL...QVGSRSFSHFL.N.IVE.R..Y.........HSL..LRQL............SKS......................................................ARMRA..A...I....L.SGAVRFWH.RSQ...Q...WIHIVVDK.LLQYR.IV.EPA.DVVEFI..FSppmdepg........................................tisspngASG...REG.W.V.G.F.N.T..WTLLRL.TLEKVNGR..............VDQLKKRLEEIQRNEAEEve.....rreA-Aaa..........agfGEEDvgqgddeaeqasmplf...........................................ptsatlpirpatssakeEKSQ....LSST.EAL.ASLDAI.K.S...E.Q.RKVLVTTL.........V.............GFKTLIVRS...................Q---.-..-.----.--.TNEPD...............................................EWTLWW..IK..SW..YRQMVRFFNRQ--ll...........................................................................................
A0A0F7ZZG8_9HYPO/534-779               ..............................................................................................................FKFK......DPD...TPFSKEGQEIGALL.RR.KAP.......DEE....LQAVIDSIQSQA..SE.RA.---....LDPVV.....................TSTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLDA...........gSAS......................................................AAARA..Q...I....V.TAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.SIADWT..LGast...............................................psngTDG...GAS.L.G.Q.P.Y.I..FELVSN.TVAKVSGR..............---LRQVLTAAD------..........---...............----............................................................................----....----.TDE.ETREKE.I.Q...A.M.RDLFRAIN.........D.............ALVSWADGN...................KDEM.M..E.GGDR.SN.E--KE...............................................ALIRRW..GQ..RW..LRVFQRVAAIEE-a............................................................................................
A7EUS0_SCLS1/1-149                     ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.---MEYWK.DQP...G...IGVNIIDK.LLNYT.IL.SPQ.SVVQWA..LG......................................................S-E...GKK.L.S.Q.A.F.V..YEMVSA.TVGKVTGR..............IRQVQLSL-------RVP..........---...............----............................................................................GLLE....EQKA.LIN.QTVEME.R.V...N.M.RELGQEMD.........D.............LLSSWANGL...................KDQM.-..I.DADG.NG.MVGDD...............................................ELVRAW..GE..RW..LRVFRRKFAVEE-a............................................................................................
A0A182PJ47_9DIPT/2-285                 ............................................................................................................ln----......QAS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMTEAKEKLART.........vESSs.............sESEDeaspnvqkr..........................................................rkttegggeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A1V6QHL3_9EURO/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..QS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLAI...........gTES......................................................QHARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.SPL.SVLEWA..LSe....................................................sVAA...GTI.L.A.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIV----AARAQP..........---...............----............................................................................GLYE....PQLT.VID.ETLARE.R.T...D.M.QALFKYIE.........D.............SIVSIAAGSnd...............eqMERG.D..G.TGTL.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A1L9UC19_9EURO/548-801               ..............................................................................................................FKYS......SDS...TPYANEGREIMQLV.RK.KAS.......DEE....IQPFINAIEDQA..RS.LG.V--....EDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................AQARR..Q...I....I.TSVMEYWV.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.R.V...D.M.QSLFKVIE.........D.............SIVSVAGGSnd...............eqMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
A0A1Y9J003_ANOQN/488-777               ..............................................................................................................YKYSm...egAAS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaspnaqk.........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A287NYS4_HORVV/524-870               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MSAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................SAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak........aikeL--Eeakstleivegqpvpser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKE.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTER...................LPPV.S..A.DGDV.PN.LRAGDpnvtfpvsdpeaatmeidne......ngadnnsqvdcgntkagynigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0K0DWY0_STRER/507-791               .......................................................................................................kdvdddt----......---...---YKISHDLAESL.SK.RIT.......NDE....VLKYLTKSSDDD..EN.MD.GRQ....--FNVmtv...............ydkEKIKIFMA..TLL...DLAQNAYTHSV.T.FFL.R..Y.........RPA..FLEL...........vKQD......................................................RSIRE..I...I....L.ESIFTAWK.YNP...Q...LIELLTDK.LLKMQ.IL.DTY.SIVKYI..LE.....................................................sQDL...VEY.V.N.K.K.Y.F..YQVLYQ.SVNRLSTH..............VNNLTNDYEKLQSQIKSVer.....klvK-Teg..........danMDEDdtssisne...........................................................ididsienpE--Ew..iNSQK.AIL.KDKEGC.L.S...E.H.SSVLRNIL.........E.............EIITYYSSN...................IISI.-..-.----.--.-----...............................................------..--..--..-------------nkendaifysfisgrfkqfiivnlk....................................................................
G9NFI7_HYPAI/533-778                   ..............................................................................................................FKFD......NPD...TPFASEGQEISGLL.RK.KAP.......DEE....FQPIIDKIQSDA..SE.RA.---....LDPVV.....................ASTDVLMT..AIC...WVGSKSLSHVI.A.CIE.R..S.........KSR..LLDA...........aNSS......................................................PAAQN..Q...I....L.VAVMAYWS.AHP...G...IALSIVDK.LVNYS.IL.TPT.SIVRWA..LTadp...............................................vadgATA...GES.L.A.Q.P.H.I..FELVLN.TVTKASFK..............---TRQIV----SSPD--..........---...............----............................................................................----....----.ADE.ETRKAE.S.K...A.I.VDLFSTLN.........D.............LLVSWAGGS...................KDEL.M..E.TGDG.S-.-SERE...............................................ATIRQW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
A0A090LDE9_STRRB/494-767               .......................................................................................................kdcdedt----......---...---YKISHDLAESL.SK.RIT.......NDE....ILKYLTKSDDDE..NM.DG.GQL....-NVATvy.................dsEKIKMLMA..TLL...DLAQNAYTHSV.T.FFL.R..Y.........RPA..FLEL...........vRHD......................................................AGIRR..I...I....L.ESIFTAWK.FNP...Q...LIELLTDK.LLKMQ.IL.DTY.SIVKYI..LE.....................................................sQDL...ADY.V.N.K.K.Y.F..HHVLYQ.SIHRLSTH..............VRNLTNDYEKLKSQINSV..........ERKllk.........kedS--Nmdddgtvevc.......................................................deididslenpE--Ew..iNNQR.NVL.EEKEKC.L.S...E.N.SNVLKNIL.........E.............EIVTYYSSN...................LTSI.N..K.----.--.-----...............................................------..--..--..-------------esdeifynfvsdsf...............................................................................
A0A1D6K2X1_MAIZE/137-392               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvl...........................................................eivegqpapAERP....GRIR.RLE.SHVKNA.E.D...E.E.RTLEESLE.........A.............KGVLLARAH...................----.-..-.----.--.-----...............................................------..--..--..-------------eeskdrtclsys.................................................................................
W1PP24_AMBTC/486-817                   ..............................................................................................................FKYS......AGD...SEEHSLSENLCTMV.RG.RKT.......ARE....VISWLEEAIVPT..--.HG.P--....----K.....................VALEVVVQ..TLL...DIGSKSFTHLV.N.VLE.R..Y.........GQV..ISKL............CPD......................................................QEKQV..W...L....I.DEVSLYWK.NSA...Q...MTALTIDR.MMGYR.LV.SNL.SIISWV..FS......................................................PAN...VKQ.FhT.S.D.R.P..WEILRN.AVGKTYNR..............IRDLRKEISSLEKSIVSAe.......asA-Ae............aqAESDaaesrlevvdgepiqaep........................................psrlkrlkafaekakeeaVSLQ....ESLE.AKQ.ALLSRA.I.T...E.N.EAMFISLY.........K.............SLANVLMEClprvycdk...hndhiqldL---.-..-.----.--.----Ddeesskmdvdddenk................ksnrggeinghdtqeeE-----..--..--..-------------hwchctlgyvkalsrqyasei........................................................................
E9J6J3_SOLIN/475-751                   ..............................................................................................................YKYSs...egASS...LPGTSAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPR..EN.EE.TNN....YNP--.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HYV..FKIL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELTEAREKLRRA.........eS-Rsg...........ssS--Deedtn.................................................................kernreRPSE....DVVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DAID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A2B7Z7F1_9EURO/566-823               ..............................................................................................................FKYA......LET...TPYATEAQEIMHLI.RK.KAP.......DAE....IQPHILAIQQAA..AS.QP.D-T....TDPLI.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..S.........KER..LLSI...........gPQS......................................................PAARR..Q...I....I.TSVLAYWA.DQP...G...IGVNIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................hIDG...GAA.L.A.K.A.H.V..YEMVAA.TMGKVTNR..............---IRQIVAARVQG----..........---...............----............................................................................GIVE....PQLS.VID.ETLRRE.R.G...D.V.QVMFEVIE.........G.............ALEGVINGSdgn.............esgMEDV.G..-.----.--.----Egvgg.......................................eeekGIIREW..GR..RW..LRVFKRLRAVEE-a............................................................................................
A0A2H3ISB7_9EURO/551-805               ..............................................................................................................FKYT......LET...TPYNKQGSELMQLI.RK.KAT.......DEE....IAPVIAEIETQA..KE.HG.--I....EDPMV.....................PSTDAFVT..SVC...YVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................APARR..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LId....................................................hIDA...GKI.L.A.K.A.P.V..YEMLSA.TVGKVTNR..............---IRQIVAARTQR----..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QTLFTLIE.........D.............SIAPVAAGS..................nDELM.E..R.SEDD.PS.TRDEN...............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
U6N3Z9_9EIME/131-340                   ............................................................................................iletccrdtagapwsfee----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-ALKLFVF..CLL...SFGSKTQTHLN.R.ILS.N..Y.........LQT..FVCF............ATQs....................................................eVDIHP..A...V....L.QAVRKFWS.TSQ...Q...RTALTLHA.FLKTG.IL.QRI.RVLQEL..CG......................................................-ED...ADT.R.D.S.W.G.Q..LELVET.VLRGALDA..............CENAREEAAAAS------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------apmptdteaeqllhflmvhliedliketsparsrflflrciffgrkyaefinlkklkeevemvmsgtedr.......................
D8QLP8_SCHCM/488-803                   ............................................................................................................wa--WE......DPS...HPHHDAAQGILNLL.RG.RAK.......AED....VIAHLETVKGTL..EG.GD.V--....SDAEG.....................TVRDMATQ..ALL...NVGSRSFSHLL.N.AIE.R..Y.........LPL..LRTLa..........gQAG......................................................GNAHT..D...I....L.ASAASFWA.SSP...Q...LITIVFDK.LMQYQ.IV.DPK.DVVAWV..FArskqprqdgmvia............................kveggvktedgdaPDA...GAP.G.M.T.I.T.E..WDVLRA.AVDKANGR..............VIIARRKLAALRREDDER..........HARav...........agMEVDgdgek..................................................................evkeqSEEN....PAVQ.TAL.KAFESL.T.A...E.Q.KGALSRTL.........E.............GFVDLLIGA...................ESPV.G..P.AARA.II.S---Ekswhnr...................................anwseaEWAAWA..TW..GW..YKAFAREYAVYL-r............................................................................................
A0A165TRK3_9HOMO/535-838               ..............................................................................................................FEYD......EPS...NPHHNAAQSVLNLF.KG.RAK.......AED....VLAHLESLKTTI..GE.TA.DGD....VNVDA.....................VIRSVAVQ..SLL...NIGSRSFSHFL.N.AIE.R..Y.........LPV..LRSL...........aTGG......................................................LEAKT..D...I....L.TAVSLFWN.RNR...Q...MIAIVFDK.LMQYQ.IV.DPT.DVVGWT..FTngvg..............................................nergDSE...GPS.A.I.N.A.H.D..WDLLKG.ALDKANGR..............VLVARKKVTALRKEEDDTr.......arA-Kasg.........gdvTSMEvdte...................................................................tkldePPES....AALT.TAV.KAFTSL.T.S...Q.Q.KTALARAL.........D.............GFIACLAPL...................SSDR.R..A.NPHA.HE.--VLTekawhn..................................ranwsdeEWNAWE..TW..GW..YRHFCRAYSPYL-r............................................................................................
A0A0E0KDN3_ORYPU/464-810               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDGQIIPV..--.--.---....-NGAK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.QI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAAkv.....aseK-Aa............reL--Eeaksiieivdgqpvpsen........................................pvrlrrlqvradktkaeeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnsaardpeattmeidne......ngadndsqlngqnkkighnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A0M4EZ67_DROBS/488-770               ..............................................................................................................YKYAn...edAAN...LPGTAVAHQLVVAI.RQ.KCT.......PEE....VVNILKEIPNSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HVV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.THQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TSE.F.T.K.M.Y.L..WEILHL.TVKKMNKH..............VIKLNTELADAKDKLSKA.........dS-Ss............sdT--Dedsshkr.............................................................kkpithsdKPSE....ELVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGLD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A151GNH5_9HYPO/534-587               ..............................................................................................................FKFN......NPE...TPFSKEGQQVAALL.RR.KAP.......EEE....LQAVIDSVHSQA..SE.RG.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------ldpliastd....................................................................................
A0A1Y3NCQ6_PIRSE/448-640               .......................................................................................................shhlnqt----......---...--LYEYAQEVYNAF.RS.KTP.......PQE....INVILEKINNYV..SE.KK.ENA....ASMDVdeqd............lnpesVVLEIVVQ..SAM...MVGSKSFSHIL.N.VVE.S..-.........--I..LTSL............NVT......................................................NEAKD..K...T....V.RFVADFWK.YNP...Q...FLEIILDK.LVNYR.VV.DPS.NIITWI..LS.....................................................dIIL...SDQ.Y.T.H.L.Y.V..WSILRN.TLKKVVLR..............VQQIKAKLEYTKKSYKEQ..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------eekamvd......................................................................................
A0A1R3R9C5_ASPC5/555-808               ..............................................................................................................FKYS......SDI...TPYANEGREIMQLV.RK.KAG.......DEE....IQPVINAIEEQA..SS.LG.V--....DDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................SQARR..Q...I....I.TSVMEYWV.DQP...G...VGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.V...D.M.QALFRVIE.........D.............SIVSVAGGSnd...............elMERG.D..G.SGSL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
I3IZ41_ORENI/483-765                   ...........................................................................................................fty-KYVd...esASS...LPGYPMSITVSNAI.KN.RAS.......NEE....ILTVLKEVPNPN..QE.DD.DDE...gESFNP.....................LKIDVFLQ..TLL...NLAAKSFSHSF.S.ALG.K..F.........HEI..LKTL............ANS......................................................DEGKL..H...L....L.KVLYEVWR.NHP...Q...MIAVLVDK.LIRTQ.VV.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.F.I..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLEKQq........hK-Rrds.........gddE--Dmdkn...................................................................sedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVD.IS.T----...............................................PWYKNC..ID..RL..QQIFLMHHATIQ-q............................................................................................
A0A231M019_9EURO/529-782               ..............................................................................................................FKYS......SDT...TPYAKEGREIMQLI.RK.KAS.......DEE....IQPLITAIEEQA..KA.LG.V--....EDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVVEWA..LVe....................................................kLEA...GTI.L.S.R.T.Y.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.K.A...D.M.QALFKVIE.........D.............SIVSVAGGSnd...............glMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
G4NH07_MAGO7/543-787                   ..............................................................................................................FKYK......NDD...VPFASQGREIANLL.KK.KEP.......DEA....IQPLIEEIQNGA..VD.QG.---....LDPLV.....................TSTDVFMT..AVL...AVGSKSLSHVL.A.CIE.R..V.........KDR..LLDA...........gAAS......................................................VAARI..Q...V....I.EAVMAYWS.AHQ...G...VALSIVEK.LLNYA.IL.TPA.VVVEWA..VGagrg.............................................avtaiEDD...ESR.L.A.Q.D.H.I..YELVLN.TVRKVTGR..............---VRQVA--LTKA----..........---...............----............................................................................QNLD....GDVS.MTE.DQDGPE.V.K...E.M.RELFQLIE.........H.............ALAARASSL...................A---.-..-.----.SN.K----...............................................LLARLW..VD..RW..QRAFKRCAAIEE-n............................................................................................
W5LAI3_ASTMX/483-767                   ............................................................................................................fqYKYDd...esKSS...LPGYPMAITVSNAI.KN.RAS.......NEE....LLTILKEVPNPN..QE.DD.DDE....GDGFN....................pLKIDVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..LKAL............TET......................................................DEGKL..H...I....L.KVVYEAWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PDM...AHD.F.T.R.F.Y.M..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLEKQq.......hkK-Qkds.........gdeE--Dmeknn..................................................................sededGQLE....EQIE.KLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.ASMD.IN.T----...............................................CWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A075B041_9FUNG/473-612               ..........................................................................................................dgde----......---...--------TLIGML.KE.KKS.......KEE....INEYLSNCENSL..E-.--.---....-----.....................----KLIH..SIW...KFGSKSFTFIL.I.AIE.R..S.........LPI..LKDL............VST......................................................DQDQI..E...I....L.KLTLEFFQ.NNH...Q...--------.LISYN.LV.HPK.VLMDFI..FS......................................................--N...QQP.L.N.Q.Y.W.I..WRIIDA.ALSKSVDR..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------niylekekgmkvd................................................................................
A0A0M3IY46_ANISI/456-735               .............................................................................................................tYDIE......NED...TPVGRLAIHLNEAI.RN.KIT.......NEE....LTEIFSDLDVWS..VS.EE.---....-----.....................EALSTCVA..VLL...NLSQKTISHSF.A.ALT.R..Y.........FKT..FKQY............AAS......................................................EESQL..I...I....L.KALYMVWK.HNQ...Q...MMSVVANK.MVTMT.II.DAS.TIVAWI..FS......................................................DEM...KSE.F.E.R.M.W.T..WELLCG.SVEHVIGH..............LRRCRKKLENAQRKSAGK.........nK-Ssh..........qnsE--Nmdtdkidndd.......................................................askdeeefdddEQND....EDLG.SLE.SEFEDL.R.E...Y.L.QNLLLDVL.........H.............KFTVKLTEH...................IVNC.D..T.KGED.VN.T----...............................................SWYKYF..TA..RF..RGFFLKHWKE---lfe..........................................................................................
A0A1D5XT72_WHEAT/464-810               ......................................................................................................fryhtdes----......KES...TEGHRLSKELVSMV.RG.RKT.......TRD....IILWVEEQIVPA..--.NG.---....---AK.....................FAVDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPD......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.TVSKTYNR..............ISDLRKEIQTLRKSIQVA.........kE-Asak........aikeL--Eeaksileivegqpvsser........................................pgrlrrlqgfadkakeeeVTIE....ESLE.AKQ.ALLARG.L.E...E.G.KELLRLLF.........K.............SFVDVLTEC...................LPPV.S..A.DGDV.PN.LRAGDpnvtfpasdpeavtmeidne......ngadnnsqvngentevgytigELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A1I7SAE3_BURXY/485-757               ...........................................................................................................yvm---D......DSD...HPLFEQATLFSNAI.KA.RKT.......SED....ILLDLQK--ERL..AS.GD.NVL....YDP--.....................EAVSVFTS..VVL...NIASKTFSHTF.A.AFT.K..Y.........VEL..FRTV...........cYNN......................................................REMQG..V...V....L.RTVYDAWI.RHK...Q...MLSVLGDK.LLKMR.IV.EPI.SLVTWI..FS......................................................EDL...REE.F.Y.R.N.W.T..WELVNL.AVYRLFCQ..............LKVLKNEIELLKQQSERQ..........-KK..............fQMVDea.......................................................................gefEDVD....SVIE.ERK.QELQDL.D.K...G.I.NEVILLIT.........H.............RFTDSLSEL...................INES.N..Q.GMDD.GS.-DDFQ...............................................LKLDFV..LG..RF..KQFF---------lnnleiiwershfl...............................................................................
A0A177DJ54_ALTAL/563-816               ..............................................................................................................FKYD......NQQ...TPYATEGQTLLSQL.RK.KAT.......AEE....IQVTIDTIHEKA..LE.QG.V--....TEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEL............SQN......................................................EVARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLPQ....EQIE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............SMRGVAEGS...................ADTL.V..E.KSSN.GAlTEE-E..............................................vELIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
Q6FN07_CANGA/580-828                   ..............................................................................................................FYFK......HES...SPLRDVVVELLDYI.HK.PNN.......TRE....VSELEQLLEKIK..AN.HG.SII....KNFDR.....................FIIVLIVQ..ALL...ESGSRSLSHAN.K.YIS.D..L.........KDD..FKYVld.......kieLDQ......................................................DQKEF..I...I....I.EAVIRFWN.SNS...Q...NGYLIVDA.FKFAE.LV.SSR.SIINFA..LNe....................................................eLAN...NYG.L.V.D.S.T.A..IEAIFR.TLSHEITL..............------------------..........---...............----............................................................................----....----.---.------.E.I...E.H.ADDFEFVL.........E.............KLCIIINNT...................VSQL.N..I.QLDE.DI.D-VPQifeltdgdn.............................asdlaaydlKWKYYT..SI..VF..IKSLLRKYSLKY-k............................................................................................
M3Y4U2_MUSPF/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QE.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A165YTR7_9HOMO/520-810               ..............................................................................................................YDYE......LPS...APHYEHAQSVLNQL.RA.RAK.......PDE....VTAVLDTIRDQL..NE.EG.EAN....ADQ--.....................VVRTITVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........IAL..LRGLa.........agGER......................................................AGAKG..D...V....L.NAAARFWH.RNP...Q...MVSIVFDK.FMQYQ.IV.DPT.DCVRWV..FA......................................................H--...---.A.E.H.G.L.D..WVILKG.AIDKANGR..............VIVARKRIAALRKEEDET.........rA-Rela.........tdsT--Nmeatnmev...........................................................daevktaepTSES....PALS.AAL.KAVSTL.S.R...E.Q.KSTLSLVI.........E.............GFVDLLHPSdasl..........pvysvF---.-..-.----.SQ.SAW-Deraa.......................................wtdnHWVAWS..AW..GW..YKHFCRAYAPYL-r............................................................................................
W5PNL4_SHEEP/485-760                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQTI--hq...........................................................................................
A0A1B7SZ66_9ASCO/366-543               ............................................................................................................fv--LS......NEK...LPIHESINKILEFF.KK.SSNt....ddETT....LNSLIEVLANLE..SE.HG.SII....VNFDR.....................FIITIMVQ..AIL...HTGDRSISHLQ.T.CLL.S..N.........KNN..LMNLyg........avSDD......................................................THINE..W...I....I.DAIQKYWH.RNL...K...TSLLIIEL.FYKND.LImDKS.KVIDFL..FKe...................................................eeNSA...NYI.L.I.D.M.C.Y..YEFLIK.ILHR----..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------taisgdns.....................................................................................
A0A2C9K216_BIOGL/491-764               ..............................................................................................................YKYEq...egAGS...LPGTMHAHKLMSAI.KS.KCT.......PEE....AAVLLKDLPNAY.pNG.QE.NEN....SSFNP.....................LKIDVFFS..TLL...HLGSKSISHSF.A.ALA.K..F.........HPN..LKSL............AEF......................................................DDGKI..C...L....L.KVLYETWK.NNQ...Q...MMVVLVDK.LLRTE.VV.ECS.SVANWL..FS......................................................FEM...QHD.F.T.S.F.Y.V..WEIMHS.TIKKMSRH..............VDQLQQEVDSAHDKQEAAk........rK-Eadg.........levGDDD............................................................................IPSD....EAIE.RME.EKLEAA.T.S...A.Q.KNLFLVIF.........Q.............RFIIVLTEH...................LARC.E..S.AGVD.YN.T----...............................................PWYKWV..IE..RL..QQVFLMHHELV--fr...........................................................................................
A0A1J1GKZ1_PLARL/758-1012              ............................................................lnkippffenikksidklhgisrdnldenifdnnifekdfdvdsicwsry----......---...--------------.--.---.......---....------------..--.--.---....-----.....................DILILFFK..SLI...FFDSSNVSSLK.K.VFN.N..H.........AVI..FLNY............KDSgcfq.............................................sendkKQFDI..E...I....I.NTVYSYFN.-NS...V...LLNVIVNI.LIENQ.IV.DEL.SVIHFI..FN......................................................KLD...DSN.L.D.E.Y.Y.V..LRLMYE.CIDNLITK..............-----KEFNDMEKNKLKR..........---...............----............................................................................KQNK....NENE.VLI.KQLEDK.K.N...QlV.QKIFHLTN.........E.............TVIMLCHKM...................MK-L.K..N.ESNS.--.-----...............................................------..--..--..-------------ymskellkeslvflrtyleyvdvdq....................................................................
G7KX77_MEDTR/493-829                   .....................................................................................................kennehlls----......---...-------GQLNDMV.KG.KVP.......VRE....IISWIDESVFSN..--.-N.---....--SLE.....................VTLRVVVQ..TLL...NIGSKSFTHLI.T.VLE.R..Y.........GQV..ISKI............CPD......................................................EDKQI..M...L....I.AEVSSFWK.SNT...Q...MTAIAIDR.MMSYR.LV.SNL.AIVRWV..FS......................................................EEN...VEQ.F.H.T.TdR.P..WEVLRN.AVSKTYNR..............ISDLRKEITSLKRNISSAev.....aanE-A..............kAEVDaaesklalvdgepvigen........................................parlnrlklraekakdelVSIQ....ESVE.AKE.ALLARA.T.D...E.N.EALFLLLF.........K.............SFSNVLTDRlpkgsgar..tlrewkstqVEEM.A..V.DP--.--.----Eesstmeldnenqipq................nsqsnggkksaaynvgEKEQWC..IT..TLsyVKAFSRQYATE--i............................................................................................
R0KSP6_NOSB1/298-432                   .................................................fpfskdqdlnkikefvddltldvlskfcnlenliqflpefkekieiplikpipkekfvihk----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-DREKFFK..DFC...LLGSPSVSHFL.S.YLE.I..Y.........KKE..FK--............-LS......................................................EEDQR..L...F....L.EVFSRIFI.KRK...S...FTGIILGK.MVKFG.II.K--.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------reli.........................................................................................
NCBP1_SCHPO/514-779                    ..............................................................................................................FVYE......NET...HPLYQQSSQIIEAL.RL.HKP.......LEE....LDIILQSEEIQN..SE.--.---....----T.....................SAVRLVMS..CAY...SLGSRSFSHAL.N.VFE.K..H.........LNT..LKHF...........sRKS......................................................LDSEI..E...V....V.DELFSFWK.LQP...F...NAVMWLDK.MLNYS.II.SIT.SIIEWL..IK......................................................Q-D...VTI.W.S.R.S.Y.T..WSLVNT.TFNKLAAR..............---LRRSVSNKEDSSLIN..........EAN...............EEKEivtnlllsalralisenae.....................................niwvshwlnlmlkyvesnflSVKK....DTIE.EAN.EPVQEN.T.S...E.E.Q-------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------edtkmqpvdavdeqpsennqtaadatnee................................................................
G3WTF4_SARHA/476-708                   ................................................................................................ifftvkhfsdegfs----......---...--------------.--.---.......---....------------..--.--.---....--FNP.....................LKIEVFVQ..TLL...HLASKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.I..WEILHS.TIRKMNKH..............VVKIQKELEETKEKLARQ.........hKRRdd...........rsS--Dr.........................................................................ddGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTN.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
I0Z3N8_COCSC/528-857                   ......................................................................................................hederdae----......---...---TVRAYQLLQMV.RH.KVV.......SEG....VLEWVEE-EQLR..QE.LG.GGL....-----.....................GVLRMLLR..GYL...VAGAKSFTHMI.T.ALE.R..Y.........CTT..LQALl..........hE-Tghearspast..................................sfvcnnsggiLQGEV..A...L....V.DVTAKVWA.NAP...Q...RAAQVIDR.LMALR.LV.SGA.AIVAWV..FGcp..................................................gvRTL...ADE.L.S.T.G.L.A..WEVFYN.AVNKMLAR..............TQDARDDLSEAQAESDAAga.....rarE-Aae..........afsR--Agegedtpqdlae...................................................rlaqeeaaagsvlAETQ....AQVE.GRQ.ADLDEA.V.Q...L.Q.EALLLQVF.........T.............NFRDILLEG...................HAEL.G..A.SAAE.PA.SGEEPdpsaiga................................teqqdakhAWYAFM..LA..TL..Q-SFTRRYYK---ava..........................................................................................
H9IWE9_BOMMO/2-278                     ............................................................................................................yt--FS......-AA...LPGTEAAHQLVVFV.RN.KCT.......PEE....ALNVLRDLPNPL..KE.GE.QTA....NQPTAy..................npLKIDVFVQ..TLL...NLGSKSISHSF.A.AIS.K..F.........HYV..FKIL............AES......................................................EEAQI..C...I....L.RNVWELWQ.RHP...Q...MVCVLIDK.MLKTQ.IV.ECS.AVATWL..FS......................................................KEM...APY.F.T.H.G.C.L..WEMLHL.TIDKMNKH..............VSKLSAELQEAREALARAdss...ssdsE--...............---Denskk..................................................................kkdqdKPTE....EAVE.RME.ERLEAA.H.M...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRC.D..T.DARD.PH.T----...............................................HWYRAT..LH..RL..TQVFLIHHEQVQK.............................................................................................
R8BBG4_TOGMI/542-796                   ..............................................................................................................FKFK......DDQ...TPFAAEGRELAQLL.RR.KAP.......DEE....IQPVIERIHSLA..LD.QG.---....IDPLV.....................ASTDVFTT..AVL...WVGSKSLSHVL.A.AIE.R..T.........KDR..FLDA...........gAAS......................................................EPARA..Q...I....I.SAVMAYWS.PHP...G...VAVSIVEK.LLNYS.IL.SPA.AVIQWA..LIty..................................................agKTR...GDA.L.A.Q.A.H.V..YELVFN.TVIKVTGR..............---VRQVVQNPIPQA---..........-AN...............----............................................................................---G....QDVDmDAE.DIKQRE.I.K...A.M.RELFKIME.........D.............ALVAWAAGS...................KDEM.M..E.DGQE.GA.-EQRN...............................................KLIQRW..GN..RW..ARVFRRRSAIEE-a............................................................................................
T1JMW3_STRMM/488-758                   ..............................................................................................................YKYNm...dgAGS...LPGTIAAHQLMTSI.KN.KCT.......PGE....VLTIIKDLPNPL..QD.AE.DT-....YN--P.....................LKIDVFVQ..TLL...FLGNKSISHTF.A.AVA.K..F.........HYI..FKTL............AVN......................................................EEAQI..C...I....L.RNAFEVWR.QHQ...Q...MMTILVDK.MLKTQ.IV.ECI.AVANWI..FS......................................................KEM...MPE.F.T.K.I.Y.V..WEILHL.TIRKMSTH..............VQKLQKELNDARDKFGRD..........DQTme...........ldD--Dens......................................................................eieRPTE....EMIE.RME.ERLEAA.Q.A...D.Q.KNLFLVIF.........Q.............RFIMILTEH...................IAKC.E..F.DGKD.GN.T----...............................................FWYRWT..IG..RL..QQVFHTHHDQVF-r............................................................................................
A0A0K0F7J2_9BILA/489-774               ........................................................................................................fnnvlk----......DSD...DSTYKLSQDLAESL.SK.RIT.......NDE....LLAYLAKSSDNG..DA.MD.DGQlrllPSYDK.....................EKIKLLMA..TLL...DLAQNAYTHNV.T.FFL.R..Y.........RPA..FLEI...........vKQD......................................................SSIRE..I...I....L.ESIFTAWK.YNP...Q...LIELLTDK.LLKMQ.IL.DTY.SIVKYI..LE.....................................................sRDL...GDY.V.D.K.K.Y.F..YHVLYQ.SVHRLSTH..............ANNLFNDYEKLKSQIKSV..........ERKfv..........kkeE--Dsnmeecsttnledei.............................................didslgnydewlinqkKNLE....EKER.CMF.ESSNAL.K.D...I.L.ERIFTFYF.........S.............KVISIDREH...................----.-..-.----.--.-----...............................................------..--..--..-------------eeifynfvngrlkqfvi............................................................................
F4RMF2_MELLP/640-988                   ..........................................................................................................fedk----......---...-----ASSDIVQLL.KR.KEP.......VSR....LLEYLKKMVERF..EG.EE.GMN...gSEALS.....................IQHQLTIE..AIL...FVGSRSFSHFL.N.VLE.R..Y.........TEL..LKKM............TES......................................................KESRR..L...T....L.KSVTRVWK.NNP...Q...FELIVYEK.LMEYR.LI.DPI.DLIQHF..FDheet..............................................geeeEKN...GKK.R.R.E.I.K.F..WDGIRL.SIGMVKNR..............VGIARVRVNRMKKEDEDEmd.....lvrA-Aagn........gdngN--DpdgnmtgdkemedipkaeemskegetlkesdaskdgevpkegeglkegqetkeeneseitkesevlkeeemkklkrIERE....KSLE.SKI.SELNSE.I.K...E.L.IEVFLEVV.........K.............LFGKELEDI...................SKEE.E..E.EEMN.GK.E----...............................................DWGKWW..VE..GW..TREFCRLFGNE--iv...........................................................................................
A0A0J0XWS4_9TREE/506-798               ..........................................................................................................tnna----......-PS...HERLAEADSLLKLM.KN.KAP.......SHE....IKNYITALPDAF..TR.DA.KPS....L--RT.....................DVVAMVAS..TIL...KLGDRSFSHFL.N.ATE.R..Y.........LEV..LRFI............GSE......................................................ARLRA..V...I....L.GAIGDFWK.RSS...Q...MRLITIDK.YLQYG.IL.EPV.DVVEWV..FSwd.................................................qwrDSM...ADG.W.T.E.G.T.H..WEVLRM.TLDKVVGR..............VVRERRRLRAVDKADEVAra......rrA-Aerlerg...egvgmdD--Ee.........................................................................ddAPRS....REAA.EVQ.ANLDAV.T.A...R.L.GDVFESVV.........D.............GFIRIFSPShrsqeg.......iyavlaF---.-..-.----.--.----Veegsa....................................degfegGWPMRA..RW..GW..WREFLRRYRQYL-e............................................................................................
J9DTD6_WUCBA/1-85                      ...............................................................................................metnehnnmgdpntv----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....-ESF.VKE.SEFADL.H.E...C.L.KNLLLDVL.........H.............KFTVTLAEH...................IVNS.E..S.NGND.FQ.N----...............................................NWYLYV..TG..RF..KNVFLKHWRD---lfe..........................................................................................
A0A2I3HWH4_NOMLE/418-693               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2I3MJB0_PAPAN/418-693               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2K5KPD1_CERAT/399-674               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2K3D496_CHLRE/803-948               ......................................................................................skaldwvhdhtreladthgplapa----......---...--------------.--.---.......---....------------..--.--.---....-----.....................---QVVST..LLL...AMGAKSPSHLH.V.AVE.R..Y.........AEA..VRAVl..........aE-Adgdaaalgalpp..............................gswrgaaaalgaSPGQV..A...M....L.EVLWRYHA.CEP...Q...RLLLVTDR.LLALH.VL.DGP.ALVAAL..FA......................................................DL-...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------eapagrrqaaaggr...............................................................................
E7QJB4_YEASZ/578-825                   .............................................................................................................l-YFR......QEG...VPMENTVRKILDYT.HK.ANN.......SRE....VTELESILGELK..NE.YG.SII....SDFNR.....................FVIILLVQ..AVT...DSGSRSLSHAN.K.YIN.D..L.........KED..LKTI............FAKie.................................................ldiETKEY..I...I....I.EAVLTFWN.ANP...Q...TGFLVADA.FKYAG.LL.TSR.TIFTFI..FNe....................................................tGLK...NNG.L.I.E.A.T.A..IEAVFR.NLSQQISE..............------------------..........---...............----............................................................................----....----.---.------.E.N...E.S.GNNFEFVF.........E.............RLCTIANST...................IDLL.D..V.NADE.DI.E-IPKvngemdid..............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
A0A084W0C9_ANOSI/488-776               ..............................................................................................................YKYSm...egAAS...LPGTATAHKLVVAI.RQ.KCN.......ADD....VLNELNDLPNLG..DS.SE.TDM....TETTYn...................pLKIDVFVQ..TLL...NLGSKSFSHTF.A.AIS.K..F.........HTV..FKAL............ADT......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLART.........aE-Ss............ssES-Edesssnpqr.........................................................rrknadgsaeKPTE....EQVE.RME.EKLEAA.Y.V...E.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A0D2H838_9EURO/542-794               ..............................................................................................................FKYD......DES...TPFAAEGKEVAQMI.RR.KAT.......SEE....FGPILEKVEQEA..AA.SG.--L....PDPSV.....................ASTDVFVT..SMC...WIGSKSLSHAL.A.CIE.R..C.........KER..LLAI...........sASS......................................................PACRK..Q...I....I.TSVVDYWR.DQR...G...VGIILVDK.LLNYQ.IL.TPD.SVVEWA..LId....................................................hVSR...GTL.L.A.T.T.W.C..YELVSN.TARKVSGR..............---VRSIVAAIRSP----..........---...............----............................................................................GLSE....EQRS.ELQ.QTLTRE.L.E...G.M.KSLFALLE.........D.............AVVSIRDGN...................QDEM.-..M.ESSD.AL.RAEEE...............................................ELLKAW..GG..RW..ARVFQRKYAVEE-s............................................................................................
A0A1D6K2V5_MAIZE/427-773               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
A0A0L7QUG2_9HYME/438-639               ..................................................................................................sclhenyisihn----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..--VL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MIVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKKNKH..............VTKLSTELAEAREKLRRA.........eS-Rsg..........sssE--Dednnk..................................................................drnreKPSE....DVVE.RME.EKLETA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LGRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
E2BW56_HARSA/488-760                   ..............................................................................................................YKYTs...egASS...LPGTAAAHELVVSI.RR.KCT.......PEE....VLNVLNTLPGPK..EN.EE.T--....NNFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIV.K..F.........HHV..FKA-............---......................................................KEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VMKLSTELTEAREKLRRA.........eS-Rsg..........sssE--Dednnk..................................................................ernreRPSE....DVVE.RME.ERLEAA.Q.G...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A168HDL9_CORDF/550-802               ..............................................................................................................FKYK......NPD...TPFSAEGQELGALL.RR.KAT.......DEE....IQPTIDAIQAQA..KE.RA.---....LDPVA.....................TSTDVFVT..AMC...WVGSKSMSHVL.A.CID.R..S.........KVR..LIDA...........gATS......................................................PAARA..Q...I....I.SSVMAYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.SVADWA..ILads...............................................ashrGSP...GAA.L.A.Q.P.H.I..YEAIFN.TVSKVTAR..............---VRQILAVPS------..........---...............----............................................................................-GSG....EDVA.VDE.ETRQKE.I.A...D.M.TELFRTIN.........D.............ALESWASGS...................KDEL.M..E.QDA-.-G.SETDE...............................................TLIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
Q6CJM2_KLULA/577-822                   .............................................................................................................l-YFR......SPS...FPFHENVTQLLDFF.HK.QPD.......TRS....VAELEGILKDIA..VN.HG.SII....EDFNR.....................FTVTLLIQ..TIV...FCGSRSLSHAN.K.YID.D..S.........REE..LKAI............MAQve.................................................vspQIKDQ..W...I....C.EAVVRYWN.SNS...Q...TGYLILDS.LRYNG.LI.SNE.SVLNFS..LTe....................................................qCGV...NMS.L.V.D.S.T.S..IESIFR.ILNELAMA..............------------------..........---...............----............................................................................----....----.---.------.A.D...K.D.VGSFEYVF.........N.............RLVGAANEV...................LSQL.-..-.NTID.PI.-VVPDldqdiqat..............................deelpsldlAWKYEA..IM..GF..LKSVLRKYSDEF-s............................................................................................
Q7RSR4_PLAYO/824-987                   .............................................................sililffkslmffdssnvsslkrvfknhaviflsyknsgifktedeqiq----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................--FEV..E...L....L.NIVYTYFN.-NC...A...LLNVIVNI.LIENK.IV.KEM.SVIYFI..FH......................................................KLS...DSN.L.D.E.Y.Y.I..VQLLYE.GVNNLIIK..............KENNENERNKLRRR----..........---...............----............................................................................-KAE....SENE.NLI.KELEDE.K.N...E.I.V-------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------nkifhltnqti..................................................................................
A0A060SP03_PYCCI/543-845               ..............................................................................................................FEYD......EPT...NPYHESAQSILNLI.RG.RAK.......PDD....VMAHLESLRNSL..ME.TT.---....ENVDA.....................VLRAITVQ..SLL...HIGSRSFSHFL.N.AIE.R..Y.........LPL..LRNL............AAGrist.............................................ggnanVEART..D...I....M.SAVATFWR.HSR...H...MINIVFDK.LMQYQ.IV.DPT.DVVGWT..FThcs................................................qvtYGK...AKT.T.F.G.A.F.Q..WDLLKA.ALDKANGR..............VMMQRRKVAALRKEADEK..........AAKaiag.......esatM--Evdaea.................................................................rpdvipTGES....PQLT.SAI.KAFTIL.A.R...E.Q.KSALTRTL.........Q.............GFVGYLASEsv..............npkVEEV.I..T.ENA-.--.----Whnra......................................nwedeDWEAWE..TW..CW..YRHWGRMYSPYL-r............................................................................................
S9X512_SCHCR/515-731                   ............................................................................................................ip--YE......NES...HPLHASFKEITDHL.RI.HKP.......IEV....ISSALSSVEENK..AS.ET.---....-----.....................SGVRFLMA..CNY...SLGSKSLSHAL.N.AFE.K..H.........LDV..IKHF...........sRKS......................................................LSTEM..E...T....I.DELFLCWR.LQP...S...IAVIWLGK.MLNYS.IV.SLT.SVFRWL..LD......................................................QKD...PSI.W.A.K.S.W.T..WSLMHM.SLKKMDAR..............LENVNSDDENLKELIRES..........---...............----............................................................................----....----.---.------.K.E...E.K.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------eavlnllftelpkrksenesipwlshwiqliqndlesvy......................................................
M7SBY9_EUTLA/537-793                   ..............................................................................................................FKFN......DDH...TPFAAEGKELAALL.KR.KAP.......DEE....IQPVIDRIHSEA..LD.QK.---....LDPLV.....................HSTDVFMT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDA...........gAAS......................................................EAVRS..Q...I....I.TAVMTYWS.AHP...G...VAISIVEK.LLNYS.II.TPG.SVIDWA..LVgd..................................................kaGPY...GEA.L.S.K.A.W.V..FELVFN.TVVKVTGR..............---LRQVVSTTSSSGNSG..........---...............---V............................................................................DADA....GAEE.SQQ.QDQEGE.I.A...A.M.RDLFKAME.........D.............ALFSWAQGT..................kDQIM.D..P.VVSD.GG.E----...............................................DLIKRW..GQ..RW..LRVFRRRSAIEE-a............................................................................................
A0A1F7ZQ36_9EURO/554-805               ..........................................................................................................sssi----......--A...TPYANEGTEIMQLI.RK.KAA.......DDD....IQPIISSIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWN.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISS.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.M.A...D.M.QALFKVIE.........D.............SIVSVAGGNnd...............elMERG.D..G.SGEL.PE.D----...............................................EIIRLW..GC..RW..LRAFRRKAGVEE-s............................................................................................
A0A1J8QCH2_9HOMO/541-867               ..............................................................................................................FEYE......DPA...NPHYDAAQSILDLL.RG.RSK.......AEE....VLSHIESLKTTL..EA.SG.-TH....VHVDS.....................TIRSISIH..CLL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRGL............AGT.....................................................dTESKQ..D...I....L.SAVASFWR.LNR...Q...MVNIVFDK.LMQYQ.IV.DPT.DVVGWT..FEnvtg..............................................dahlSGM...RPM.S.L.S.A.F.E..WDLLRG.ALDKANGR..............VMVARRKVAALRKEHDDSva......rvKASgg..........advGSMEidtemkpfkqgtvqhi............................................ivlapsltelflpddsASEN....PQLT.VAL.KAFASL.T.R...E.Q.KGALARTI.........E.............GFVSCLAPP...................PSAG.R..Q.NPHA.-Q.TVVTEqawenr...................................sewqadEWNTWE..TW..GW..YRHFCRTYSPYL-r............................................................................................
A0A0N4TRQ3_BRUPA/517-776               .........................................................................................................qeeke----......---...-----LVAEIERAF.RN.KAE.......PKE....ITEMLREFDKEG..NS.L-.---....-----.....................ATLSTFFS..VML...NAAQKSFSHNF.V.ALT.R..Y.........HET..LKEL...........sGVD......................................................DESST..A...L....L.RTLYDVWK.HNR...Q...MMVVLITK.MFRMT.LL.NAN.AVVSWL..LS......................................................SYV...DQE.L.H.R.F.W.L..WEALFI.IVKHVCGH..............MYRCKTKLQQMQEKRIKM..........ERSsgnic.....qvfcsNK-Ddg........................................................................lgMILD....DDIE.IKK.KELKEL.Q.D...M.L.KNLFLNIL.........H.............KLVLFLSEH...................LIKS.E..M.TEKN.HD.T----...............................................YWYRYM..MG..RF..KEMLLRY------wcelf........................................................................................
E3S7J3_PYRTT/731-984                   ..............................................................................................................FKYD......NQD...TPYAAEGQMLLTQL.RK.KAT.......SEE....IQATIDSIHEKA..LE.QG.--I....TEVLV.....................PSTDAFVT..AIC...RLGAKSLSHVL.S.CIE.R..G.........KDR..LLEI............SQN......................................................EGARR..Q...I....V.ASVVEYWK.DQP...G...VAVRIIDI.LLNYT.IL.APM.TVVQWV..FGs....................................................hMGA...GEA.L.T.E.S.W.V..FEMVSN.TVAKVTNR..............---NRQIA----SARLQK..........---...............----............................................................................GLQQ....EQTE.MVE.ATLAKD.R.D...N.A.RELFKYIE.........D.............SMRGVAEGSa................dtLVEK.S..T.NGNL.TD.E---E..............................................vQLIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A1C7NQ92_9FUNG/537-799               ..............................................................................................................FAFK......DVQ...DPLHPKAKHLIENL.RT.KKT.......TDE....IRAILDGYKEEL..VD.ED.DAG....--QQQ.....................KVRFMFVQ..CLL...LVGSKSFSHIL.N.VVE.R..Y.........LDI..LRMI............NST......................................................PEARL..H...T....V.HIVASFWK.NNT...Q...FLGILLDK.LLNYR.II.DPT.SVITWA..FE......................................................IDQ...SES.A.G.R.A.Y.V..WEILKN.TLNKVNSR..............VVQVKGKLDALQSLHDTNkq......lrA-Tae..........tneM--Tea........................................................................eeQQEL....DTIR.IAE.NSLASV.S.R...E.Q.KEVFMVVY.........Q.............KFVGVLKEQ...................K---.-..-.---P.NE.A----...............................................SWTYKW..IL..GW..LKEMLRVHHKE--cg...........................................................................................
A0A179FGW8_METCM/534-779               ..............................................................................................................FKFS......NPD...TPFSKEGQEIGALL.RR.KAP.......DED....FQPTIDSIQAQA..AE.HA.---....LDPII.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDV...........gTAH......................................................PAARS..Q...I....I.SSVMNYWA.AHP...G...VAITIIEK.LLNYS.IL.TPF.SIVDWT..LVast...............................................psngTQG...GEA.L.G.H.S.H.I..FELVSN.TVAKVSGR..............---VRQLLTSP-------..........---...............----............................................................................----....---E.ADD.ETRQKE.V.S...S.M.RDLFRAIN.........D.............ALASWAAGS...................KDQL.M..E.DGDG.S-.-SARE...............................................AMIRRW..GQ..RW..LRVFNRLAAIEE-t............................................................................................
G1T696_RABIT/486-761                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.I.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrgs....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
W6UR31_ECHGR/540-866                   .................................................................................................assasatseksrp----......---...--------------.--.---.......---....VKNELTSSKRAR..NK.EK.MED....N---Eddfdnc........lvpgvtnRELELFMT..ALL...YRAHKTISHTC.S.LLN.R..Y.........SEA..FKTL............AST......................................................VELQV..E...A....L.HILQAVWC.NQS...Q...MVVAISDY.MSRQG.ML.DPE.SVVGWA..FSpfmsafcg......................................plapppstVHV...CPR.M.L.Q.S.H.V..WECLMH.TLVRVGQR..............IAQITPRLEAVKDQAGVHh........rK-Sas..........gsrS--Dgsssdldndygdgdlrtkivr.................................vrrrhqrhcrvgshgsssggggGTSP....DRLA.RLK.EERGEA.V.R...S.Q.CAVITLLL.........H.............RHVRLVATVea...............kaTEEM.G..A.PDNP.SD.LVDLA...............................................SVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
A0A1A6FT60_NEOLE/464-752               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.NDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................NEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........QklespsnaastwqRFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
E4UYW2_ARTGP/547-800                   ..............................................................................................................FKFS......QET...TPYSKEGQELMKLI.RQ.KSS.......DEE....IQAVITSIEEQA..QT.HG.--L....TDPLI.....................ASTDVYMT..SIC...YVGSKSLSHFL.S.CIE.R..C.........KDR..LLAI...........gPKS......................................................GAARR..Q...M....I.NSVMEYWA.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVLEWA..LVd....................................................nLAA...GST.L.A.K.P.H.I..FEMIAA.TMRKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................TLYE....PQLS.ILD.ETLKKE.K.A...D.M.LSMFQLIE.........D.............TLVPVAGGYsd...............giMERT.E..D.DAL-.--.-QTEN...............................................VMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
A0A1S2ZT80_ERIEU/485-759               ..............................................................................................................YKYGd...esSNA...LPGHSAALCLSVAF.KS.KAT.......NDE....IFSILKDVPNPN..QE.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.I.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRRs.............dD--Drss.....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.IL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A2I4CS12_9TELE/485-765               ..............................................................................................................FKYEd...esAAS...LPGYPVSIMVANAI.KN.RAS.......NEE....ILTALKEVPNPN..QE.DD.DDE...gESFNP.....................LKIDVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEI..LKTL............TDS......................................................DDGKL..H...I....L.KVVYEVWR.KHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VQKIQKELEESKDKLEKQq........hK-Rrds.........gddE--Dmekn...................................................................sedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVD.IS.I----...............................................PWYKNC..IE..RL..QQVFLMHHGTI--qq...........................................................................................
NCBP1_ANOGA/488-777                    ..............................................................................................................YKYSm...egAAS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaspnaqk.........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
B8ND12_ASPFN/529-782                   ..............................................................................................................FKYS......LDT...TPYANEGTEIMQLI.RK.KAT.......DDD....ILPIINAIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWT.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QALFKVIE.........D.............SIMSVAEGHnd...............elMERG.D..G.SGEL.PE.D----...............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
V5G4F2_BYSSN/534-787                   ..............................................................................................................FKYA......VDT...TPYAKEGRELMQLI.RQ.KAS.......DEE....IQPVIEAIEQQA..KE.HG.V--....EDPMI.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................PIARR..Q...I....I.TSVMEYWA.DQP...G...IAINIVDK.LLNYT.IL.TPL.SVIEWA..LLd....................................................rLSA...GTI.L.A.Q.C.H.I..YEVVAA.TIRKVTNR..............---IRQIV----IARIQP..........---...............----............................................................................GLYE....PQLS.VVD.ETLNRE.K.A...D.M.QTLFKLLE.........D.............SLVPVAGGN...................NDQL.M..E.RGDG.SG.TLPED...............................................EIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A195EM70_9HYME/485-759               ..............................................................................................................YKYTp...kgASS...LPGSDAALKLIDSI.KN.KGT.......SED....VLGILNTLPREN..EE.TN.NYN....----P.....................LKIDVFVQ..SLL...NLGSKSFSHSF.A.AIV.K..F.........HDI..FKIL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKMNKH..............VTKLSTELTDAREKLRRA.........eS-Rsg..........sssD--Eednnk..................................................................ernreRPSE....DEVE.RKE.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVRC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A194W4V9_9PEZI/574-831               ..............................................................................................................FKFE......NDD...VPFAQEGRELAQLL.KR.KAP.......DEE....IQPVIERIHSSA..ID.QS.---....LDPLV.....................TSTDVFTT..AVL...AVGSKSLSHVL.A.AIE.R..T.........KER..LMDA...........gIAS......................................................EPARA..Q...I....I.TAVMDFWS.AHP...G...VAITIIEK.LLNYS.II.TPT.AVVQWA..LTgy..................................................agKTK...GEA.L.A.R.S.Y.M..YEMVFN.TVAKVTKR..............---TREVISAPQPEP---..........---...............----............................................................................QEDV....DMSS.EAE.ETKKRE.I.A...T.M.KELFKTME.........D.............SLYAWASGT...................KDEI.M..E.DGSL.DD.ASRDEr.............................................dALVKRW..GN..RW..LRVVRRKSAIEE-a............................................................................................
A0A022QJ29_ERYGU/485-802               ..............................................................................................................FRYSa....eDED...QTEHGLSSELNVMV.KE.RVT.......SRD....IISWIEDQVLPS..--.HG.---....---LE.....................VTLRVVVQ..TLL...NIGSKSFTHLI.T.VLE.R..Y.........GQV..IARI............CSD......................................................QDKQV..M...L....I.SEVSSFWK.NSA...Q...MTALSIDR.MMGYR.LI.S--.NVLRNA..VS......................................................KTF...SRI.T.D.L.R.K.E..IASLKK.SVQSVTEA..............ASKAQAELDDAKSKPTLAlvdg..epvlA-Enpvk......mkrlnS--Kvekt....................................................................keeeVSTR....DSLE.AKE.ALFARA.V.D...E.I.EALFLFLY.........K.............SFSNVLAAP...................LQET.E..G.SLHL.SG.-----...............................................------..--..--..-------------kademaidpedtstmeldkegeisekshsnggkttkgynvgekeqwclstlgyvkaltrqyasei............................
B3MVZ8_DROAN/524-753                   ..............................................................................................................FKYI......DEL...VPGAKLSQLLLEAMrGR.RAE.......PTE....ISTILTGSTDLH..--.--.---....----L.....................LKINVMTQ..VCL...HIGSKSFTHTF.A.TLT.R..Y.........QTV..FKQL............IHS......................................................ESEQH..A...I....L.KGVFELWA.GNE...Q...FKYVVVEK.LIRMQ.IV.EAK.YVVTWI..FA......................................................PQL...RVE.L.T.K.M.Y.I..WELLHA.TVRTVKHP..............----SRLLP---R-----..........---...............----............................................................................-KRS....PETV.KAL.EEMDDT.E.V...A.V.KGILLEII.........H.............RFVKVLAGS...................TEGP.-..-.EGSN.T-.----H...............................................YWCQWV..QG..RM..QEFLFVYS-----edykk........................................................................................
A0A1U7TER2_TARSY/485-599               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEIFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........YEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------.............................................................................................
A0A0D9NJH6_METAN/534-779               ..............................................................................................................FKYT......NPD...TPFAKEGQEISALL.RR.KAP.......DEE....MQPLIDSIQAQA..KE.QA.---....LDPVV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LIDV...........gTAH......................................................PAARS..Q...I....I.SSIMNYWA.AHP...G...VAITIIEK.LLNYS.IL.TPF.SIVDWT..LVass...............................................psngTQG...GEA.L.G.R.S.H.I..FELVAN.TVAKVSGR..............---VRQLLTSPDA-----..........---...............----............................................................................----....----.-DA.DTRDKE.V.S...S.M.RDLFAAIN.........D.............ALASWASGS...................KDQL.M..E.DGDG.S-.-SERE...............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
A0A0L7LU78_9NEOP/1-42                  ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---MILSEH...................LVRC.D..T.DARE.YE.T----...............................................HWYNAT..VG..RL..RQVFLCHHEQVQK.............................................................................................
A0A165U6U3_9APHY/542-849               ..............................................................................................................YEYD......DPS...KPYHDAAQSLLSLL.RG.RTK.......AED....VVTHLDSLKNTI..SE.TA.EGD....VNVST.....................VVRTIAVQ..SLL...HIGNRSFSHFL.N.AIE.R..Y.........LPL..LRNIas.......gggA-Sttg................................................ssnIDARM..D...I....L.NAVSGYWK.RVR...N...MVVIVFDK.LMQYQ.IV.DPT.DVVAWT..FVyge................................................astSAV...GKT.T.F.D.S.F.Q..WDVLKG.ALDKANGR..............VTIARKKVTALRKEADDN..........AAKaiat.......egaaM--Dvdaea.................................................................kadvmpVAES....PALT.TAL.KAFSTL.T.R...E.Q.KAALSRAL.........D.............GFVGYLAAA...................D---.-..-.KPNP.TA.AEVITedawhn..................................rvnwnekQWETWE..TW..CW..FRHFCRAYSPYL-r............................................................................................
A0A095CIX4_CRYGR/593-871               .............................................................................................................g----......---...--------------.KQ.KLP.......STE....IIKHITEMPNAS..SG.P-.GEP....LYP--.....................AVRQMVFE..TIS...HLGSRSFSHFL.N.ATE.R..Y.........SDV..LRFL............TPD......................................................FASRR..I...L....L.DAVKSYWR.RSS...E...MRLVTLDK.YLQYG.IL.EGI.DIVEWI..FAdd.................................................eaeGEE...GDG.W.T.D.G.D.K..WEVLSM.CLEKHLGR..............VKAISRRLKVIEREDEAA.........rA-Rkag........eqleR--Gedvnvdd..............................................................dtnedprPETS....KEAR.DAQ.TSLDIQ.S.T...R.L.EKVLLATF.........K.............HFIFALLPW...................TAER.E..E.GIST.SN.----Eglkgvlt................................lldsneegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
A0A1Y2FNJ7_9ASCO/516-860               ..............................................................................................................FTYT......-EG...HPLAEQATALSTFL.QQ.PQT.......PET....LQQAEPIFKAIS..EA.SA.DGQ....EE--A.....................TLIRVLVE..CAL...QLGHQSFSHAL.N.TIE.Q..T.........LLL..LKQR...........cSVS......................................................REKQR..Q...T....V.TCVMRFWR.ERP...A...VGLALLSK.MVNYG.II.EGS.ALVDWL..LAmanqeasla...................................tdtiawetsvLGN...RSI.L.A.Q.S.A.A..WELLQL.VFAKQATQ..............TGQLQQRQAVLTKNIARQekl....lsdA-Aar..........aeaA--Raeadkvaaakveadkvaaa......................................kadageaatngdgqapsaeTAAD....TTMT.EAT.PVVKAE.E.D...L.Q.TAALARAK.........D.............TLAENVAELa................kvEQRI.A..T.VAQE.KV.----Evvarlcsg..............................laglireseGLQAWW..AR..GL..LRTVARRQR----dil..........................................................................................
A0A2H2JN60_CAEJA/1-205                 ...............................................................................................mfqerqpadafvsel----......---...--------------.--.---.......---....-----KIGDNEE..LP.YS.---....----A.....................HDFGVFVA..VML...KMAAKTYSHNF.S.ALS.R..Y.........QIT..LKTV...........cDAS......................................................DQYQE..K...L....L.DTLYNCWK.TNQ...Q...MMMILIDK.LLKMQ.VL.DCS.VVVAWL..FD......................................................EKM...WQE.H.D.R.Q.W.L..FEVLNQ.ALEKLTRQ..............IVIVEKDIKELAENIENEd........kQ-Ee............neA--Dekmtd..................................................................deskpQKQQ....EDLE.AHK.QKLEAM.V.Q...F.Q.KGLFID--.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------fll..........................................................................................
A0A0V0ZPG9_9BILA/662-782               ..........................................................................................................yfyi----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.R.H.Y.V..WQIVYS.MTTRLSRS..............IKQIQEELDKKQAEEGTM..........-SS...............ASSD............................................................................GERS....SEVS.AIQ.LKLSAA.Q.E...L.Q.KAVIFTLL.........Q.............KVIILLSEH...................LLQS.D..A.EDRD.SH.T----...............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A2I2UKG0_FELCA/487-756               ............................................................................................................cl----......-DS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
E2QD75_DROME/488-770                   ..............................................................................................................YKYAn...eeAAN...LPGTTVAHQLVVAI.RQ.KCT.......PEE....VVNILKDIPNSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.L.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSEAKEKLAKA.........dS-Ss............sdS--Eddsshkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
G8BW33_TETPH/543-781                   .............................................................................................................i--FN......HED...MPMNDIVSGIIDYF.HE.DIK.......TKN....VSSLETLLETLR..KD.HM.SII....KDYDE.....................FVTILLTH..CLL...YSGRRSLSHTN.K.YIS.D..F.........YDD..FTHIfn.......trnTDK......................................................SKTEF..W...I....I.KSTLMFWN.SNS...Q...TAFLTLDG.FRQYG.LV.SSN.ALIRFC..LKd....................................................eDGK...IPA.I.I.D.S.T.A..TEATLR.VLHQDVSH..............------------------..........---...............----............................................................................----....----.---.------.T.E...D.I.FDELLGIF.........D.............ELCKIIKNSfdkkg.........dihglK---.-..-.----.D-.----Tglmtld...................................enienmYWKYSM..SL..RF..LKTILRMFTEEY-k............................................................................................
A0A232EZH0_9HYME/488-761               ..............................................................................................................YKYSs...egASS...LPGTTVAHELVVAI.RR.KCT.......PEE....ALNVLNSLPGPG..EN.EE.NY-....-SFNP.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIG.K..F.........HYV..FKVL............AET......................................................EEAQI..C...I....L.RNMYALWK.NHY...Q...MMVVLTDK.FLKTG.II.ECS.AIANWI..FS......................................................KEM...ASE.F.T.K.L.Y.I..WEILHL.TIRKKNKH..............VIKLSKELTEAREKLRRA..........ESRsg...........ssS--Ddddk....................................................................dkgeRPSE....DAVE.RME.EKLEAA.Q.A...D.Q.KNLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGID.YN.T----...............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
A0A0F9ZCP9_9MICR/295-389               ...................................................................................iyevgsinsikkedldfnknkkdfyrd----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..-FC...LLGSPSVSHFL.S.YLE.I..Y.........KNE..MKM-............--D......................................................EEQQK..I...F....L.EIFCEIFS.NRT...S...FKKIVIDK.MVKFN.FI.KSE.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lllk.........................................................................................
A0A091URB6_NIPNI/474-754               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A0V0ZPG9_9BILA/495-658               .......................................................................................................nkfsgsg----......ADR...LPGASIAQHLTQAL.KE.KCT.......PED....VHAILMDCPYPD..DD.MD.---....MPFNP.....................LKIEVLTT..AVL...VSGSRSISHTV.A.ILI.K..Y.........MSV..FKEF...........aADS......................................................KEAQI..H...L....L.QTLHEVWF.ANE...Q...RIMIVVDK.MLKMQ.II.QSL.AVIEWI..FS......................................................EKM...RGN.L.M.R.F.T.L..I-----.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------clfiysvqksvec................................................................................
F7HCL0_CALJA/418-693                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0CRM1_PARTE/469-689                   ..........................................................................................................dieq----......---...---HSLAEKINSYL.QQ.KLN.......GVD....MLEQLKQITNPN..PD.--.---....-----.....................AVIQTFIE..CLF...QCISKSITHLN.V.LSK.R..Y.........LSF..LLQPn..........iIKP......................................................EKLGE..I...M....L.NTIFRMWN.HSV...F...HLKVYLKE.FLNLE.VI.SNL.QVVNWL..NDl....................................................iKQK...PEV.F.K.I.Y.N.V..LIAIND.VFRKQTKL..............-DQVQDCTYESVKEINTI..........LTKm............idQEQDvviqsslen.........................................................iqlqiliafkQTNG....TQLE.KLL.KE----.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------iksnnvkqivm..................................................................................
Q1K7E2_NEUCR/533-786                   ..............................................................................................................FKFA......DDK...TPFAAEGKEIAALL.RR.KAP.......EEE....IEPVIERIHSLA..LD.NN.---....LDPLV.....................ASTDVFVT..SVL...HVGSKSLSHVL.A.AIE.R..T.........KER..LTDA...........gATS......................................................EAART..Q...I....I.SSVMEYWS.AHP...G...VAIAIIEK.LLNYS.IL.TPQ.AVINWA..ITty..................................................agATR...GEA.L.A.K.G.F.V..YEMVFN.TVVKVTSR..............---LRQVLQK--------..........---...............----............................................................................-ATL....PEAM.IDD.ETIEAE.I.N...G.M.RSLFRAIE.........D.............ALFAWASGSkd...............emLEAS.D..G.LGEG.DG.TSETE...............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
A0A091VHI6_PHORB/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFGILKDVPNPN..QD.DD.DDE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1E3I5P4_9TREE/591-893               ..............................................................................................................WAYE......KED...HPLHTEATNLLSQI.RQ.KSP.......GAD....VIRYIIEMPNAS..SS.P-.---....AEPLY....................pNIRSMAFE..TIL...HLGSRSFSHFL.N.ATE.R..Y.........SEV..LRFL............TPD......................................................YESRR..L...L....L.EAVKSYWR.RSS...E...MRLITLDK.YLQYG.IL.EGI.DVVEWV..FVedes..............................................vsegEEG...SNG.W.T.D.G.D.K..WEVLLM.CLEKHVGR..............VKALQRRLKAIEREDEAVra......rrA-Aerf.........ekgE--Dvsdgdd................................................................ivedsrPESS....KEAR.DAQ.TSLDIN.T.T...R.L.EKVLLSTF.........K.............NFVLSLLPW...................MASE.K..E.DNTT.GA.SSEGLkavltl..................................ldngeeaLWNVRA..KW..GW..YREFIRRYQRH--l............................................................................................
A0A074SCM4_9HOMO/536-816               ..............................................................................................................YAYE......NPD...HPHYQEAAELLTMI.KD.RAK.......ADE....VAAHCLKLPRSV..--.--.---....-----.....................PIQHMVMQ..SLL...HVGSRSFSHFL.N.AVE.R..Y.........LSL..LRGE............SGSgslr..............................................geknAEKAR..P...I....L.CAAGEYWA.NNQ...Q...MIGIVFDK.LMQYQ.II.DPS.DVIEYA..FEs...................................................giKEG...ETP.D.L.S.S.E.R..WLLVQA.ALNKANGR..............VVGAKRKVVTLNKDEEER..........RARaian......aggigMDVDvdaq...................................................................paepdMPTS....QSLV.SAQ.KALETL.T.K...E.Q.KKVFQSAI.........T.............GFINALTKA..................gVPAL.A..P.VGTW.GR.A----...............................................EWSAWE..TW..CW..YRQFCRAVS----stht.........................................................................................
A0A1G4MA39_LACFM/581-829               .............................................................................................................l-YFR......QDC...FPFHEKVQRLLDYF.HK.QPL.......DRN....VNEIESILKELQ..AD.HG.EII....VDFNR.....................FAVTLLTQ..TLV...YCGNRSISHAN.K.YIS.D..S.........RNE..LEEL............FSKme.................................................laqDLKEL..W...I....I.EAVIRYWN.CNS...Q...NGFLIIDT.FKNGD.MV.SIK.SVLNFS..FLd....................................................vNDK...NWG.L.V.D.A.T.S..IESTIR.NLTELSLR..............------------------..........---...............----............................................................................----....----.---.------.K.D...I.S.VETFEFIF.........E.............RLVSIVGDV...................ITKL.E..V.SLEE.EI.-VAPDidegsmidv.............................saelprldlTWKYEI..SM..SF..IKSILRKYSDEY-l............................................................................................
A0A1G4B1X6_9PEZI/539-785               ..............................................................................................................FKFN......DES...TPFSAEGREIAALL.RR.KAP.......DEE....FQPIIERIHSLA..IE.RS.---....LDPLV.....................TSTDVFVT..AVC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................EAAKA..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYS.IL.LPI.SVIEWA..LAggs...............................................hvpgQSS...GDS.L.G.Q.P.H.V..FELVFG.TVSKVTGR..............---VRQLLT----K----..........---...............----............................................................................----....-EAE.ADE.DAKERE.T.K...A.M.RDLFKAME.........D.............ALVSWASGS...................KDEM.-..M.EEID.GA.-GQRD...............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A251PU76_PRUPE/380-725               ......................................................................................................fkfsveet----......SEG...NGQHALSVDLRTMV.KG.RAS.......ARE....MIVWIEESVFPV..HG.ME.---....-----.....................GTLNVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CGD......................................................QDKQV..M...L....I.TEIDSYWR.NNS...Q...MSAVAIDR.MMGYR.LL.SNL.AIVRWV..FS......................................................PAN...IEQ.F.H.L.SdR.P..WEILRN.TVSKTYNR..............VCDLRKEILSLKKSIVSAe........eA-Aatak......aelvaA--Esklslmdgepvlgenp...........................................vrlkrlksyaekakeeeLSVR....ESLE.AKE.ALLARA.L.D...E.F.EALFLSLY.........K.............NFLNVLTERlpsastc....vtlqglksI---.-..-.----.--.----Hadsmavdveessamevdden.......grpkksqlnggrmssvynvgE-----..--..--..-------------keqwclstlgylkafsrqyasei......................................................................
A0A1B8ADM9_FUSPO/532-777               ..............................................................................................................FKFK......NPD...TPFSKEGMEIAGLL.RK.KAA.......DEE....FQPFIDSIQSQA..SE.RS.---....LDPLV.....................ASTDVFMT..AIC...WVGSKSLSHVL.A.CID.R..A.........KGR..LLEA...........gNAS......................................................EAARA..Q...I....I.SALMSYWH.AHP...G...IALSITEK.LLNYS.IL.TPM.TVVDWA..LVast...............................................pangANG...GES.L.A.E.P.H.I..FELVSN.TLTKVATR..............---SRQVI----SSP---..........---...............----............................................................................----....---D.TDD.ETRAKE.V.K...S.I.RDLFRATN.........D.............ALISWAGGS...................KDEL.M..E.EGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
A0A166KBE3_9HOMO/543-862               ..............................................................................................................FDYE......EPT...SPHHDAAQSILNLL.RG.RAK.......PEE....VITQVDSIRTSL..ES.S-.DMD....LNIDA.....................VVRSIAVQ..SLL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRNL............AGTgss...............................................gsadAQAKA..D...I....L.TAAAAFWK.RNK...Q...MVNIVFDK.LMQYQ.IV.DPS.DVVAWT..FVnvag..............................................dghlSGM...GPL.S.L.S.A.F.E..WDLLKG.ALDKVNGR..............VMIARRKVAALRKEEDDTr........aKAKakgg......vdvssM--Evdedtkada.........................................................dedmapaaddAADS....PQLV.TAL.KAFASL.T.R...E.Q.KAALSRTL.........D.............GFVACLAPL...................--PS.D..S.NPNP.HA.AVVITesawhn..................................rsnwsgdEWNAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
H2YUE8_CIOSA/1-163                     ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...MMGVLVDK.MIRMQ.VV.DCA.SVAKWI..FS......................................................PNM...ADD.F.T.R.L.Y.V..WEIMHS.TIRKMNKH..............VIKIEAELGEMRSKAQVS.........eK-Ks.............eD-EEddlmn..................................................................tynifAPNQ....DDLQ.RMQ.DQLETA.N.G...E.Q.KKLFLIIF.........Q.............RFIMILSDH...................LVRC.D..A.GHTN.FN.T----...............................................PWYRNA..IQ..RL..QEIFLLHKDTV--kk...........................................................................................
Q2U9I0_ASPOR/529-782                   ..............................................................................................................FKYS......LDT...TPYANEGTEIMQLI.RK.KAT.......DDD....ILPIINAIEEQA..RA.MG.V--....EDPML.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................TRARR..Q...I....I.TSVMEYWT.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTI.L.A.R.T.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QALFKVIE.........D.............SIMSVAEGHnd...............elMERG.D..G.SGEL.PE.D----...............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
A0A0C3P6R7_PISTI/545-849               ..............................................................................................................-EYE......EPL...HPYHEAYQSILSLL.RG.RSR.......ADE....VIAQVDTLKTTL..DT.SH.-TD....MHIDS.....................IIRSLAIQ..SLL...SIGSRSFSHFL.N.AIE.R..Y.........LPL..LRGLa..........tPTD......................................................FEAKR..D...I....L.AATAAFWK.RNK...H...MIGIVFDK.LMQYQ.IV.DPT.DIVAWI..FNmv.................................................sgdGIT...GPV.Y.V.Q.A.F.E..WELLKG.ALDKANGR..............VTIARKKVLALRKEQDDSia......raKASgga........dvgnM--Evdgevk...............................................................plkqdesATEN....PQLT.TAL.KAFTSL.T.R...E.Q.RSVLAKTL.........E.............GFVSCLSPV...................P--G.D..A.YQNM.HS.KTVIDehswer..................................raswtndEWMTWE..TW..GW..YRHFCRLYSPYL-r............................................................................................
A0A2H3EXF6_9HELO/479-563               ..............................................................................................................FKYA......LAE...TPFSQEGQEILDLL.KK.KSP.......EDA....IQPVIDRIHLQA..RA.LA.--L....PDELV.....................CSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KER..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------qqg..........................................................................................
A0A2H3XWT8_PHODC/483-827               .............................................................................................................f-KYIie..dsQEG...MEGHTLSKELNSMI.RA.RKT.......ARE....ITLWVEENIIPL..HG.F-.---....----N.....................VALEVVVQ..TFL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKL............CTD......................................................QDKQI..L...L....L.EEVSSYWK.NNT...Q...MTAIAIDR.MMGYR.LI.SNL.SIVRWV..LS.....................................................pSNI...NQF.H.T.S.D.R.P..WEILRN.SLNKTYNR..............VTDLRKEIQSLKKSVLLA.........eE-Atv..........kamK--Eyeaaeskldvvddqpvqse......................................kpgrlkrlkgyvekakddeTSIQ....ESLE.AKE.ALLARA.L.E...E.N.KALFFSLY.........K.............SFKDVLMERlppv..........sadgkLPKL.R..T.ANVD.SV.TIDSEpstmdvdhddgktdn.................sqsngervfhsyttgEQEQWClcTL..GY..VKAFSRQYA----sei..........................................................................................
A0A1I7VPM8_LOALO/529-796               ..............................................................................................................YDLN......DDE...HPDRDFAITLEKAF.RE.KIS.......ADE....MIDLLRSKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDGQL..T...I....L.RTLYETWK.LHG...Q...MVIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................EEM...KPE.F.E.R.L.W.I..WEVLNR.ALEHVSGH..............VHRSRQAIENAKLKKEQKe.......ldH-Ekd..........dfdM--Etde.....................................................................hdmtDPNT....VEPT.VKE.SEFADL.H.E...C.L.KNLLLDVL.........H.............KFIVTLAEH...................IVNS.E..S.SGSD.FQ.N----...............................................NWYLYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
A0A1S4D9Z6_TOBAC/485-828               ................................................................................................fkysaedgtdpter----......---...----ALSVELKDMV.KG.RKS.......ARE....MISWVEENVFPA..HG.F-.---....----D.....................ITLRVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CTD......................................................DDQQV..K...L....I.SEVSSYWQ.NSA...Q...MTAISIDR.MMSYR.LI.SNL.AIVRWV..FS......................................................SSN...LDR.F.H.V.SdS.P..WEILRN.AVSKTYNR..............ISDLRKEISSLERSVVLAe........eA-Asr...........arD--Qldsaesklsimdgepvlge......................................npvrikrlksyaekakeeeVSVR....ESLE.AKE.ALLARA.V.D...E.I.KVLILSLY.........K.............GFLTALAEP...................LNDA.F..R.DGTL.RP.SGQADdmkidledssvmdldkddggr.....pkkshpngsrerngynldgkqQWCLST..L-..GY..LKAFTRQYAS---ei...........................................................................................
A0A0D7BGY7_9AGAR/554-869               ..............................................................................................................FPYE......DPE...HPFYEGSQAVLGLI.RG.RAK.......PEE....AIEYLETLKGIV..ET.-A.DPA....ANVQD.....................VVLTIVVQ..SLL...SVGSRSFSHLL.N.AIE.R..Y.........LPL..LRHL............VAS......................................................GGRKD..A...V....L.TAVASFWQ.ENS...Q...MVVIVFDK.LMQYQ.IV.DTT.EVIGWV..FTdgaag............................................ggeepLGR...TKG.T.I.G.E.L.G..WSLVHA.ALSKANGR..............VNVARKRMAALRKEDDDT..........RARaiavdapegpgfgdgA--Dvkneesad...........................................................mdvdgikkeNLEN....PALA.TAT.KAFDSL.V.K...E.Q.RGGLARAL.........E.............GFGSILVPS...................GEDE.G..S.QAMK.KV.SRDEEweqrg.....................................swgkaEWHAWE..SW..GW..YRHFCRVYSPYL-r............................................................................................
A0A132AE10_SARSC/492-606               ....................................................................................................ftmtnettkt----......---...--IKDNVESVRDIL.GQ.KCS.......VED....CLELLKDITDES..DE.SD.---....--SNK.....................LRIEIFVN..VLL...NVSSKSMTHAF.A.YIA.K..Y.........RDV..LKQL............NTD......................................................EEAQL..Q...M....M.NTMLEVCS.SHQ...Q...VAN-----.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------lncts........................................................................................
A0A0L0CL87_LUCCU/488-771               ..............................................................................................................YKYAs...eeAAS...LAGTQVAHQLVVAI.RQ.KCT.......PEE....VINILKELPNSG..EN.AD.QEM....SETSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKTQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNNELTDAKDKLAKA..........DSSs.............sDS-Edeaapkr.............................................................kkpvvvvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
C5FRD0_ARTOC/547-798                   ......................................................................................................dtpdfkfs----......---...---QEKGQELMKLI.RQ.KSS.......DEE....IETVITSIEEQA..KT.HG.--L....VDPLI.....................ASTDVYMT..SIC...YVGSKSLSHFL.S.CIE.R..C.........KDR..LLAI...........gPKS......................................................DAARR..Q...I....I.NSVMEYWA.DQP...G...IGINIIDK.LLNYT.IL.TPL.SVLEWA..LVd....................................................nLAA...GST.L.A.K.P.H.I..FEMIAA.TMRKVTNR..............---MRQIVAARTQP----..........---...............----............................................................................TLYE....PQLS.ILE.ETLKKE.K.A...E.M.LSMFQLIE.........D.............TLVPVAGGYsd...............gmMERT.E..D.DA--.--.-LQPE..............................................nVMIQQW..GS..RW..LNVFRRRVAVE--ra...........................................................................................
A0A081CLN2_PSEA2/689-985               ..............................................................................................................FTYA......GAE...HPYHAAATALLSSI.RA.KAS.......ADV....ILADFESFKASI..IS.QM.PED....--GMVgsme.............eaevVVRDLVVQ..CVL...QVGSRSFSHLL.N.IVE.R..Y.........HGL..LRTL............SRS......................................................ARMRA..A...M....L.AAAVRFWI.RSP...Q...WLHIVVDK.LLQYR.IV.EPA.DVVEFI..FNpprdep.........................................asiltagVSE...VGS.W.A.G.F.N.T..WGLLKL.TLDKVNGR..............VDQLRRRLEQSQRLEAEEle......rqE-Aaaa.........agfEQEDakaepgmplf........................................................pttatlpvrpEEKA....PSAD.DAR.ASLDAI.R.T...E.Q.RKVLLTVV.........Q.............GFLALKAEG...................----.-..-.----.--.-----...............................................-WNKWW..VD..GW..YTAFVRTFNRQ--ll...........................................................................................
A8PGT3_COPC7/535-854                   ..............................................................................................................FEYD......-AS...HPHHDAAEAILNLF.RG.RAK.......AED....VISHLDELRTKL..ES.SE.EGH....VNVDT.....................LVRSIAVQ..SLL...QIGSRSFSHLL.N.AIE.R..Y.........LPL..LRNL...........aG-Asapgattt.....................................gatatagsnPEART..E...I....L.SAAAAFWK.HNR...Q...MVGIVFDK.LMQYQ.IV.DPT.DIVAWT..FLngas.............................................vgqlsELG...GPM.N.L.S.A.F.E..WDLLRA.AIDKANGR..............VVAARRRVMQLRKEADERra......lsKAKaen.........gndM--Dmdve...................................................................nkeeeKDDD....PQLV.TAL.KAYSSL.T.K...E.Q.RMVLSRTL.........E.............GFVESLAPA...................--PT.A..R.NPNP.HA.RTVIDeaawen..................................raswgrdEWNAWE..TW..GW..YKQFCRAYAPYL-r............................................................................................
A0A093D5Y2_TAUER/444-724               ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIQKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................ssdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.SGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
H2SJV6_TAKRU/485-765                   ..............................................................................................................YKYGe...esSSS...LPGYPVAITMGNAI.KN.RAT.......NEE....ILAILKELPNPN..QD.DD.DDE...gETFNP.....................LKVDVFLQ..TLL...SVASKSFSHSF.S.ALG.K..F.........HEI..LKTL............TES......................................................DEGKL..H...I....L.KVVYDVWR.NHP...Q...MIAVLVDK.MIRTQ.IT.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.Y.I..WEILHS.TIRKMDKH..............VQKIQQELEEAKDKLEKQq........hK-Rrds.........gddE--Dmdka...................................................................sedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVD.IS.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A0N5DLP0_TRIMR/524-779               .............................................................................................................n-KFE......LDG...EPLCELALQVHGAI.KA.RKH.......PEE....LLSILSK-DGQG..NE.DG.SNF....AETVE.....................FKTELLIS..QLL...VVGQKVMSQTM.M.LLT.K..Y.........SHV..LDQL...........vRNN......................................................ENAQL..C...L....L.NGIVDAWP.NFE...Q...RVAVVVDK.LFRLE.IV.QGP.TIIKWI..FS......................................................EKM...KDY.F.L.K.Q.Y.V..WEILFS.TFDKLCTN..............YRVLSDKLSTFAEDTVSP..........---...............--SQ............................................................................GENS....PALL.ELQ.QGLDAC.L.G...A.Q.KAYIFTLF.........Q.............HFIITLSEH...................LLAV.D..E.GGDN.VS.-----...............................................DWYRIV..FG..RM..CQFFTT-------rcieih.......................................................................................
B8MTN8_TALSN/547-801                   ..............................................................................................................FKYT......LET...TPYCKQGSELMQLI.RK.KAA.......DEE....IEPVIAEIETQA..KD.HG.V--....EDPMV.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................APARR..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LLd....................................................hIDA...GKI.L.A.K.A.H.I..YEMLSA.TVGKVTNR..............---IRQIVAARTQL----..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QTLFTLIE.........D.............SITPVAAGS..................nDELM.E..R.SEDD.PS.TRDEN...............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
A0A085NGJ1_9BILA/2175-2430             ...................................................................................................kfsmegaepsg----......---...-----LALELQEAI.KA.RKE.......PEK....VLSILLQQGEGS..-E.NG.DGP....VESVE.....................YKTEVVIS..QLL...VIGQRTMSQTL.S.LLT.R..F.........APV..LDQL...........vKNN......................................................ENAQL..S...L....L.NAVRETWP.TFE...Q...RIGVVVDK.LFRLE.IV.PAP.VIVKWV..FS......................................................KEM...KNE.F.L.K.Q.Y.V..WEIVSS.TFDKLCIN..............FCVLSDKLKAVMGEDMSP..........---...............--EE............................................................................SGDP....AQAL.ELQ.EGLEAC.L.G...A.Q.KAFIFTLF.........Q.............HFIITLSEH...................LLTA.D..E.SGDR.VS.-----...............................................DWYRIV..FG..RM..CQFFTTQ------cvevqr.......................................................................................
A0A1E3PI47_9ASCO/533-757               ..............................................................................................................FKYL......EAE...SLFQNEVHGLISCL.RE.KKS.......SEE....FYNTLNQISEKT..EL.EP.AQ-....----K.....................EVTDVVVS..SVC...YLGNRSLSHAN.S.WIG.R..A.........MEY..LKSV............CDD......................................................EVSMG..Y...A....V.ASVMEYWK.EQQ...F...IGVLILDQ.MLKQN.VI.SAL.SIVNWL..FE......................................................DEQ...RII.F.T.T.N.H.G..WEALLR.TLTHVKES..............ANELT-------------..........---...............----............................................................................----....--IE.ADT.TSENNS.L.D...A.R.DKIFGLVI.........D.............KLVAIQGID...................L---.-..-.--DE.ES.N----...............................................KWIEWW..KR..GG..IKAIMRKFHDVF-s............................................................................................
A0A182VW37_9DIPT/12-295                ............................................................................................................sn----......RPS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.MEM....AEEPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HTV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWA.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLART.........vESSs.............sESEDeaspnpqkh..........................................................rkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRE.YD.T----...............................................DWYRWT..VG..RL..QQVFMMHHEQVQK.............................................................................................
B4R0Z6_DROSI/496-717                   ..............................................................................................................FKFV......DET...LFGAILSKDLLEAM.RGpRAS.......PEI....ISEIIKSSKGIG..--.--.---....P---L.....................LKINVFTQ..NCL...HLGSKSFSHTF.A.ILA.K..Y.........QSV..FKDL...........vEGD......................................................SEGQI..A...V....L.NGVFDVWV.ASD...H...YKFVVAEK.LVKVF.II.EPI.NIVTWI..FG......................................................PSM...RKE.L.T.K.M.Y.I..WELLHS.AVRHLKRV..............----QHDVEVVDV-----..........---...............----............................................................................----....----.---.DNPSAC.D.P...V.V.KSVLYTVV.........E.............RLVKILCSA...................P--F.A..D.EGTE.EH.-----...............................................YWFQWV..LG..RL..-------------eetlfiyadd...................................................................................
A0A2K5JE53_COLAP/418-693               ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGVLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A087XF49_POEFO/485-769               ..............................................................................................................FKYGd...esGTS...LPGYPVSITVSNAI.KN.RAS.......NEE....ILAILKEVPNPN..QE.DD.DDE...gESFNP.....................LKIDVFLQ..TLL...HLAAKSFSHSF.S.ALG.K..F.........HEI..LKNL............TES......................................................DDGKL..H...I....L.KVVYEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWL..FS......................................................QDM...AHE.F.T.R.L.F.I..WEILHS.TIRKMNKH..............VQKIQNELEEAKDKLEKQ.........qH-Krvapr.....dsgddE--Dmekns..................................................................eedeeGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GSVD.IS.T----...............................................PWYKNC..IE..RL..QQIFLMHHGTI--qq...........................................................................................
A0A1V6UX36_9EURO/531-784               ..............................................................................................................FKYS......SEM...APYSKEGQELMQLI.RK.KAS.......DEE....IQPVITAIEDQA..KS.QG.VD-....-DPKI.....................PSTDAFVT..SLC...FVGSKSLSHVL.S.CIE.R..S.........KDR..LLTI...........gAES......................................................ERARC..Q...I....I.TSVMDYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVLEWA..LSe....................................................sVAA...GTI.L.S.K.P.H.V..FEMISA.TVGKVTNR..............---MRQIVAARGQH----..........---...............----............................................................................GLYE....PQLS.VID.ETLTRE.R.A...E.M.QALFKYIE.........D.............SIVSVAAGSnd...............eqMERG.D..G.SGTQ.PE.D----...............................................AIIRQW..GR..RW..LRVFRRKAAVEE-a............................................................................................
V4U5T8_9ROSI/271-616                   ..............................................................................................................FKYSme..dgRER...SEEHALSAELTNKV.KG.RQT.......ARE....IIVWVEESVYPI..HG.L-.---....----G.....................VTIKVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..ISKI............CPD......................................................HDKQL..M...L....I.DEVSLFWK.NNT...Q...NAAIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IDQ.F.H.A.S.DrP..WEVLRN.AVSKTYNR..............ICDLRKEIISLKKGVTLAee.....aaaKAKa............elE--Aaesklslvdgepvlggn.........................................parlsrlklhaekakneeISAK....ESLE.AKE.ALFARA.V.E...E.N.EALYLSLY.........R.............NFSNVLMERl................pdASRA.G..T.LQDL.KS.T---Hadamavdleepsameldned.......grpkksqsnggssgnvynigE-----..--..--..-------------keqwclstlgyvkafsrqyasei......................................................................
A0A1V8SZY2_9PEZI/557-808               ..............................................................................................................FKYA......DDK...MPYASEARALLKLL.KE.KAS.......EEQ....IQAILDDVRDQA..TS.HG.V--....PDPLV.....................PSTDVYMT..CIL...NVGSKSMSHVI.S.NID.R..L.........KDK..LSAL...........aTQS......................................................EAARR..Q...I....I.SSVVDFWS.LHP...G...NAANIVDK.LLNYT.II.TPM.SVIEWA..LHe....................................................rMDR...GRA.L.A.S.A.Q.M..YELVSH.TVAKVSAR..............---VRQVLQQRANT----..........---...............----............................................................................SLPF....DQRQ.VID.AVLPRE.R.Q...T.L.RDLYATIE.........D.............AVASVANGSqd...............emMERY.-..-.EGE-.--.-EEER...............................................AIIMQW..GE..RW..ARVWRRKAAVEE-a............................................................................................
NCBP1_DROSE/488-770                    ..............................................................................................................YKYAn...eeAAS...LPGTTVAHQLVVAI.RQ.KCT.......PEE....VVNILKDIPNSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.SHQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.L.Y.L..WEILHL.TIKKMNKH..............VIKLNSELSEAKDKLAKA.........dS-Ss............sdS--Eddsshkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
G3XXC7_ASPNA/548-801                   ..............................................................................................................FKYS......SDT...TPYANEGREIMQLV.RK.KAS.......DEE....IQPLINAIEEQA..RS.LG.V--....EDPLL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................AQARR..Q...I....I.TSVMEYWV.DQP...G...VGINIIDK.LLNYT.IL.TPL.SVIEWA..LVd....................................................kLEA...GTV.L.A.K.S.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLSRE.R.V...D.M.QSLFRVIE.........D.............SIVSVAGGSnd...............eqMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
X6MHP4_RETFI/46-337                    ..................................................................................lllhevismkqvdqmlnseiqggndsss----......---...--------------.--.---.......---....------------..--.--.SNS....TNQLFqvstt...........erikiRQMQLLFA..CLL...HVGKSSCSHVV.T.FLK.M..Y.........GSG..LLKSy..........mVCF......................................................ELSQM..K...L....M.SILLEYWY.KSC...F...RCEILCDK.LHAQN.YI.STQ.AIIKFI..FLeenscqit.....................................sviyiyiyiSTY...TYI.YmY.M.P.V.Y..WKILLN.SIDRTVKTavg.......mlrtVSRYQKDLKDLEKEMTADf........aDADa.............iAAQQ............................................................................SMKQ....QQLE.GLI.RRHNQT.L.A...S.I.REIFFLLF.........S.............EFKRVLTVL...................HQKI.Q..S.SSDA.VD.S----...............................................------..--..--..-------------ndkssnsrsnknstqdaniskldvheie.................................................................
A0A151GNH5_9HYPO/580-739               .........................................................................................................dplia----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................---ST..D...I....I.SAIMAYWH.PHP...G...VAVAIVEK.LLNYS.IL.TPN.AIADWA..LVasa...............................................psngTNG...GKS.L.G.Q.A.Y.V..FELVSN.TVAKVSGR..............VRQVHTNP---GAD----..........---...............----............................................................................----....----.--P.EVREKD.V.K...A.M.RDLFGTIN.........K.............ALSSWAGGN...................-EDA.K..M.DDGD.SS.SGQEE...............................................AMIRRW..GQ..RW..LRAFQRKAAIEE-a............................................................................................
A0A1D6K2X0_MAIZE/138-484               ..............................................................................................................FKFHsd..esNES...TDGLKLSKELIGLI.RG.KKS.......TYD....IILWVEEQIIPK..--.NG.---....---TE.....................FALDVVSQ..TLL...DMGSKSFTHLV.T.ILE.R..Y.........NKI..ISKL............CPN......................................................EEMQL..L...L....M.NGVSAYWK.NST...Q...MTAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VEQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............ISDLRKEIQSLKKGLQVA.........kE-Asa..........knrK--Eleeaksvleivegqpapae......................................rpgrirrleshvknaedeeRTLE....ESLE.AKG.VLLARA.H.E...E.S.KDLLKLLF.........K.............SFVDVLTERlppvsvdge.ipnlrsgdqN---.-..-.----.--.----Vnfaaqnseaatmeidneng.........adnnsepnerntknaynvgELEQWClcTL..GY..LKSFSRQYASE--i............................................................................................
K3WAB2_PYTUL/691-934                   ..................................................................................nnqesgvtqitrnlyqavtaklkghppa----......---...--------------.--.---.......---....-SALQSWIEEEI..AT.LG.DID....R---R.....................DVAEVVWT..CIL...EAGAATFTHMR.L.LLE.K..Y.........GHA..-ESL............FGG......................................................EDKEL..V...L....V.KTVGFVWL.KSP...Q...HIGLILNM.MLRQE.II.RAT.TIAKWI..FT......................................................PDA...VQQ.Y.S.W.P.Y.V..WEILNE.TLAFVQAS..............IARKTQQL---ETQATAK.........sGER...............RDTD............................................................................ETEM....VDVV.AVE.DARKAL.Q.D...E.L.KQILILLF.........E.............GFNRVISEH...................KSNC.D..A.EGIS.YK.D----...............................................NWFV--..--..--..-------------salaqmka.....................................................................................
A0A1J7IPW5_9PEZI/536-793               ..............................................................................................................FKFA......SDD...VPFAAEGRELASML.RK.KVA.......EED....IQPIIDRIQSEA..LD.RN.---....LDPLV.....................TSTDVLVT..AVL...HMGSKTLSHVL.A.AIE.R..N.........KDR..LLDI...........gAAS......................................................DAARE..Q...I....L.DSVANYWA.AHP...G...VAVTIVEK.LLNYS.IL.QPL.TVIRWA..LVts..................................................agRTT...GDA.L.A.R.A.H.V..YEVVFN.TVVKVSAR..............---VRQLVSAPPAAKTDG..........---...............----............................................................................---D....TAMG.GAG.AEEEAE.V.K...A.M.RDLFRGIE.........D.............ALVAWADGSkd...............emI-EA.A..Y.-GEG.DG.NSQRD...............................................RLVRRW..GS..RW..LRVFRRRAAIEE-a............................................................................................
A0A183NDY7_9TREM/110-484               ................................................pepakqeirarlkarrrmlresamkrnlktssegnadeqvgvrsdsieklpfttaaqvsels----......---...--------------.--.---.......---....------------..--.--.---....PGVTN.....................LAIELFYS..AML...IAGHKTISHTF.A.FIK.K..Y.........AAV..IRTL............TST......................................................VETQV..E...A....L.HVIQAVWA.NNP...Q...MIVIITEH.MCRVG.LI.DPE.AVVRWA..YSpimttlt.......................................ddtvnlnsANA...RPK.I.L.D.F.Y.V..WECLSR.TLVRVGRR..............VTRITSRLELAKETMEIN.........rR-Sspys.......tpdrE--Dadqggdgdsfprtgvdsdsffkkpkdsis.................grikvsdrrklmagcelvsssddeaygggkDNVG....GRVA.RLE.EARCEA.V.R...S.Q.CAVITLLL.........H.............RHARLTAEL...................ASEM.SgfT.QNHS.FN.TD--Spfflheptq............................pkslsdealrNIMFWL..KG..RL..VQVVL--------evs..........................................................................................
D8LFZ4_ECTSI/632-863                   .......................................................................................................redvedl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................-------Q..VLL...RGGQASPTHTF.V.YLD.R..Y.........RSY..LRTL............RRDea..................................................lgEANQV..A...M....L.DGVAQLWE.HSP...Q...WFCLVCKY.LLDIG.VL.SPT.TVVYYV..FR.....................................................eDNN...NAI.A.L.S.P.F.L..WEVMSK.AISLYTDR..............VTLSLGELRDLEKSAKALde......aiD-Erlkn......rspvpS--Teegddnapp..........................................................adpqdveekQRMS....NDIE.DQR.DVVREA.V.Q...Q.A.RALCTATV.........S.............SFVQALANA...................LPQY.A..A.NGMT.D-.-----...............................................------..--..--..-------------fsadpwwvsmtsyl...............................................................................
X0K335_FUSOX/531-775                   ..............................................................................................................FKFQ......NSE...TPFSKEGQEIASLL.RR.KAP.......DEE....FQPLFESIQTQA..SE.QS.---....LDPIV.....................ASTDVFMT..AVC...WVGSKSLSHVL.A.CID.R..T.........KGR..LLEA...........gNSS......................................................EAARA..Q...I....I.SAVMSYWH.AHP...G...VALSIIEK.LLNYS.IL.TPF.TVVDWA..LVast...............................................pangTDG...GDS.L.T.E.P.H.I..FELVFN.TIFKVTRR..............---SRDVV-AAPE-----..........---...............----............................................................................----....----.-TD.ETRIKE.I.K...S.T.RDLFRAMN.........D.............ALVSWAGGS...................KDEL.M..E.GGDG.S-.-SDRE...............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
A0A183TMB5_SCHSO/236-421               .............................................................................................................l----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.L.K.R.L.H.V..WECLLH.TLIRVGRR..............VAQINPKLEAAKESLEIQr........hK-Sds..........essE--Sedeedrggrsksislrrdrdpgg..............................hrrgrsrssdesadgherdsrrsVAVA....DKVA.SLE.QERCEA.V.R...S.Q.CAVITLLL.........H.............RHVRLIDSV...................EEAA.E..E.AAAS.GA.SAVEReaagdm...................................sseelgFVSYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
A0A183I1Y9_9BILA/503-744               ..............................................................................................................YDLN......DDE...HPDRDFAIILEKAF.RD.KIS.......ADE....MIDLLRSKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDAQL..T...I....L.RTLYETWK.LHG...Q...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KHE.F.E.R.L.W.I..WEILNR.ALEHVSGH..............VHRSRQAVENRKLKKERK..........---...............----............................................................................----....---E.SDH.EKDDFD.M.E...A.N.EHDITDSN.........A.............KFAITLAEH...................IVNS.E..S.SGRD.FQ.N----...............................................NWYLYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
A0A182HK84_ANOAR/6-292                 ..........................................................................................................flcl----......SAS...LPGTATAHKLVVAI.RQ.KCN.......AED....VLNELNDLPNSR..DA.SD.TDM....AEAPFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HAV..FKAL............AET......................................................EEAQI..C...I....L.HNMFELWV.DHQ...Q...MMVVIVDK.LLKVQ.IV.ECS.AVATWV..FS......................................................KEM...VGE.F.T.K.M.Y.L..WEILHL.TIKKMNQH..............VTKLSREMNEAKEKLARTv........eS-Ss.............sESEDeaaspnaqk.........................................................rrkntegsgeKPTE....EQVE.RME.EKLEAA.Y.V...D.Q.KRLFLIIF.........Q.............RFIMILSEH...................LVKC.D..T.DGRD.YD.T----...............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
A0A1E4TEV2_9ASCO/527-706               ..............................................................................................................FKYG......KDD...YKYHEQGQKVLQGI.KE.RKE.......AAE....MKEVFEEVKQQL..VD.ET.S--....--PET.....................LLIQILVC..SVC...FLGSRSLSHAS.R.CIE.R..S.........LSS..LMAV...........iGTG......................................................KESRV..T...A....I.DSIMKFWK.DSP...G...VGVQIVEK.FAAFN.LI.DAV.DIFYWI..FGhsssdyq.......................................ydevrhaqLYE...SML.I.G.S.L.N.I..WELIVR.LLNAVIRT..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------gkegq........................................................................................
C1E0M0_MICCC/524-801                   ..................................................................................................letlngssgalr----......---...--------DLQAFM.KE.KKP.......AAE....VMEWLKTSGKLD..AL.GR.A--....-----.....................GAAKVLTV..AAL...QHGQKCITHHN.V.LLK.R..Y.........EGA..LTEL...........tQES......................................................SEEQG..CadvM....V.AAAAGIWAgTHP...H...MAVTAVSR.LLELG.LV.KPA.DVARWL..ETsisdeta........................................agtdedgASR...GVA.W.G.T.A.D.A..WDIACL.AVETVAAD..............--RVNREWKASAARRKVEa........aEAQaa..........ratA--Dadraas...............................................................qgrhvdaGRAK....EAAG.RIE.GKIARL.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------raelddaslpvehagaqladaagalclalvkalapkladaaadaagpt.............................................
A0A1E3BHL4_9EURO/533-786               ..............................................................................................................FKYS......VDT...TPYANEGRELMQLI.RK.KAG.......DEE....IQPIITSIEEQA..KE.HG.V--....EDPML.....................PSTDAFVT..SIC...FVGAKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPQS......................................................SRARN..Q...I....V.TSVMEYWA.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................nLNA...GNI.L.A.R.T.E.I..YEMVAA.TIGKVTNR..............---LRQIV----AARVQP..........---...............----............................................................................GLYE....PQLS.VID.DTLHRE.K.A...D.M.QALFKVTE.........D.............SLVSIASGSnd...............eqMERG.D..G.SGGL.PE.D----...............................................GILRQW..GR..RW..LRVFRRKAAVEE-a............................................................................................
A0A0N5B8K9_STREA/489-776               ........................................................................................................fnnvlk----......DSD...DSTYKLSQDLAESL.SK.RIT.......NDE....LLAYLTKSSDNG..DA.MD.DGQlrllPSYDK.....................EKIKLLMA..TLL...DLAQNAYTHNV.T.FFL.R..Y.........RPA..FLEI...........vKQD......................................................SSIRE..I...I....L.ESIFTAWK.YNP...Q...LIELLTDK.LLKMQ.IL.DTY.SIVKYI..LE.....................................................sRDV...GDY.V.D.K.K.Y.F..YHVLYQ.SVHRLSTH..............ANNLFNDYEKLKSQIKSV..........ERKf............vkKEEDcgmeecsttnl.....................................................edeididslgncD---....EWLT.NQK.RNLEEK.E.RymcE.S.SNVLKDIL.........E.............KIITFYFSK...................VASI.-..-.----.--.-----...............................................------..--..--..-------------dreheeifynfvngrlkqfiivn......................................................................
A0A061GUF2_THECC/484-829               ..............................................................................................................FKYSve..dgGER...TEQHAISAEISNKV.KG.RQT.......AHE....IISLIEENIYPA..--.HG.---....---LE.....................ITLSVVVQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQV..IAKI............CPD......................................................QDKQV..M...L....I.AEVSSYWK.NNA...Q...MTSIAIDR.MMGYR.LI.SNL.AIVRWV..FS......................................................PEN...IGQ.F.HiS.D.R.P..WEILRN.AVSKTYNR..............ITDLRKEISSLKKGVISAee.....aasKAKa............alE--Aaeskltlvegepvlgen.........................................parlkslktqaekakeeeVSIH....DSLQ.AKE.ALLARA.L.D...E.N.EVLFLSLY.........K.............NFSNVLVERl................pdA---.-..-.----.--.-----...............................................------..--..--..-------------sragtlqalksihgdsmavdleesstmevddengrpkksqpngskatniynvgekeqwclstlgyvkafsrqyasei................
U3JEQ1_FICAL/473-756                   ..............................................................................................................YKYGd...esNRS...LPGYTVALCLTIAI.KN.KAS.......NDE....IFSILKDVPNPN..QD.DD.DGE....G-FTFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...QkiqMIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VLKIHKELEETKARLARQ.........hKRRd............sdD--Ddddddr................................................................stdredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMLLTEH...................LVRC.E..T.GGID.VF.T----...............................................PWYKSC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
I1PB96_ORYGL/483-830                   ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVAMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVSQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LL.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisad....gdvpnlraG---.-..-.----.--.----Dpnvnssardpeattmeidnen.....ggdndssqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
A0A077TQU0_PLACH/798-1021              ................................................................................edflnnsncwdsysililflkslmffdssn----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...------VSSLK.K.AFK.N..H.........AVI..FLSY............KNSgifk.............................................tedeqMQFEV..E...L....L.NIVYTYFN.-NS...A...LLNVIVNI.LIENK.IV.KEM.SVLYFI..FH......................................................KLD...DSN.L.D.E.Y.Y.I..VQLLYE.GVNNLIIK..............KENNENERNKL-------..........---...............--RR............................................................................RKTE....SENE.NLI.NELEGE.K.N...E.I.VNKIFHLT.........N.............QTIIMISEK...................MMKL.K..N.DNNS.YM.S----...............................................------..--..--..-------------kellkeslvflrtyieyididqflqqch.................................................................
H2YUE9_CIOSA/492-771                   .........................................................................................................fkydf---KlgpdhsQEE...RAAYNASQRVITAI.KT.KCK.......EDE....LIIMLEDIHQEE..SN.ID.G--....STFSL.....................PRLEVFLQ..SLL...FLAQKSFSHSF.S.AIF.K..F.........HKV..LKWA............GDG......................................................EEGKV..A...I....L.GITKDVWK.NHP...Q...MMGVLVDK.MIRMQ.VV.DCA.SVAKWI..FS......................................................PNM...ADD.F.T.R.L.Y.V..WEIMHS.TIRKMNKH..............VIKIEAELGEMRSKAQVS.........eK-Ks.............eD-EEddlmn..................................................................tynifAPNQ....DDLQ.RMQ.DQLETA.N.G...E.Q.KKLFLIIF.........Q.............RFIMILSDH...................LVRC.D..A.GHTN.FN.T----...............................................PWYRNA..IQ..RL..QEIFLLHKDTV--kk...........................................................................................
A0A095AF41_SCHHA/477-821               .....................................................................................eqvgvrsdsieklpfttaaqvsels----......---...--------------.--.---.......---....------------..--.--.---....PGVTN.....................LAIELFYS..AML...IAGHKTISHTF.A.FIK.K..Y.........AAV..IRTL............TST......................................................VETQV..E...A....L.HVIQTVWA.NNP...Q...MIVIITEH.MCRVG.LI.DPE.AVVRWA..YSpimttltdd....................................tvnlnsanaRPK...IFL.Q.R.Y.F.Y.V..WECLSR.TLVRVGRR..............VTRITSRLELAKETMEIN.........rR-Sspys.......tpdrE--Dadqggdgdsfprtgvdsdsffkkpkdsis.................grikvsdrrklmagcelvsssddeaygggkDNVG....GRVA.RLE.EARCEA.V.R...S.Q.CAVITLLL.........H.............RHARLTAEL...................ASEM.S..G.STQN.HS.FN--Tdspfflhept..........................qpkslsdealrNIMFWL..KG..RL..VQVVLEHCD----qli..........................................................................................
NCBP1_DROAN/488-770                    ..............................................................................................................YKYAn...eeAAN...LPGTTVAHQLVVAI.RQ.KCL.......PEE....VVNILKEIPSSG..YS.GE.EMS...dGSFNA.....................LKIDVFVQ..TLL...NLGSKSFSHSF.A.AIS.K..F.........HSV..FRAL............AET......................................................EEAQI..C...I....L.HNIFELWS.THQ...Q...MMVVLIDK.LLKLQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLNTELSEAKDKLSKA..........DSSs............sdS--Dddtphkr.............................................................kkpithadKPSE....EVVE.RME.EKLEAA.N.V...N.Q.KRLFLIVF.........Q.............RFIMILSEH...................LLRS.D..T.DGRD.PD.T----...............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
Q4V551_DROME/498-719                   ..............................................................................................................FKFV......DET...LPGAILSKDLLEAM.RSpQAS.......PEM....ISEIIKSSTGIG..--.--.---....P---L.....................LKINVFTQ..NCL...HLGSKSFSHTF.G.ILR.K..Y.........HSV..FKDL...........vAGD......................................................PERQA..A...V....L.NGIFDVWV.ASD...Q...YKFVVTEK.LVTGL.II.EPI.SVVRWI..FG......................................................PSM...RKE.L.T.K.I.Y.I..WELLHS.ALRHLK-R..............---VQQKIE---------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------vvdvddpsacdpvvkgilftivqrfvktlcgapfadegteehywfqwvlgrleetlfiyadd...............................
X1WQ84_ACYPI/491-791                   ..............................................................................................................FKYAi....eKSS...LPGQFLSNTLLTKI.RN.KTT.......PED....IIEILKE---PL..MS.EN.GEI....LEPADigi...............snpTKVDAFVQ..TLL...FIASKSFSHAF.A.AIT.K..F.........ISV..FKAL............GET......................................................DDGQL..Q...I....L.RSTFDLWS.ADQ...Q...MLTVLIDK.MLKTQ.II.ECS.SVANWI..FS......................................................KDM...IPE.F.T.K.L.Y.I..WEILSL.TINKMSRH..............VDRLTRELNEAREKLRTTaa......isN-S..............sD--Dsdtetekaeakprqs.............................................ttttfggqgvpmdvddNVTE....EMVE.RME.EKLEMA.Q.A...D.Q.KNLFLIVF.........Q.............RFIMILSEH...................LVKC.D..T.DDRP.FD.T----...............................................YWYKYT..VG..RL..QQVFLAHHEQVQK.............................................................................................
A0A0B2UIA8_9MICR/305-412               ................................................................................vnclmnkiskeefeakvlnrdysngdvkdg----......---...--------------.--.---.......---....------------..--.--.---....----V.....................ENKEFFFR..NFC...YLGSPSISHFL.T.YLE.M..Y.........KSY..FRL-............--E......................................................ADDQQ..L...F....I.DVFLDVFK.SSE...S...FRRIVLEK.MVLFG.IV.Q--.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................----....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------kdvvdc.......................................................................................
B4KJA1_DROMO/497-712                   ..............................................................................................................FKYI......DGL...LPGATLAKHLLDAI.RS.KCA.......PEL....LGGLLEATTELD..--.D-.---....----G.....................LKINVLMQ..SLL...HLGCKSFSHIF.S.LLS.K..F.........QPV..LKVL............VNN......................................................DAHQL..A...M....L.RALFEVWS.NNE...H...VKLVVADK.LLKMH.IV.SNH.AVVAWV..FN......................................................PSL...KSE.L.V.K.M.Y.L..WELLNL.TVRYTKYH..............-----M------------..........---...............----............................................................................----....----.--R.VTEENQ.S.T...D.L.NCLLLNIA.........Q.............TCVKVLLDH...................RKSE.-..-.----.-Q.SSEVD...............................................YWFQWI..QG..RL..LQLLF--------nyiddvrk.....................................................................................
A0A1V8U9T9_9PEZI/557-808               ..............................................................................................................FKYA......NDE...LPFATEARALLKLL.KE.KAS.......EEQ....VQAILDDIRDQA..AS.HG.V--....ADPLV.....................SSTDVYMT..CIL...NVGSKSMSHVI.S.NID.R..L.........KDK..LSAL...........aTQS......................................................EAARR..Q...I....I.SSVVDFWS.LHP...G...NAANIVDK.LLNYT.II.TPM.SVIEWA..LHe....................................................rIDR...GRA.L.A.S.A.Q.M..YELVSH.TVAKVSAR..............---VRQVLQQRANT----..........---...............----............................................................................SLPF....DQRQ.VID.AVLPRE.R.Q...T.L.RDLYATIE.........D.............AVASVANGSqd...............emMERY.-..-.EGE-.--.-EEER...............................................AIIMQW..GE..RW..ARVWRRKAAVEE-a............................................................................................
A0A1I7XEC4_HETBA/639-723               ....................................................................................................vikmedpenl----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...--------.-----.--.---.------..--......................................................---...---.-.-.-.-.-.-..------.--------..............------------------..........---...............----............................................................................SREE....EDAA.QQQ.EKLDSL.R.D...F.Q.KNLFLDVL.........H.............KFTILLTEF...................IVNC.E..T.DGTD.FR.T----...............................................SWFAWI..SG..RF..KQVFLLHCEE---lhq..........................................................................................
NCBP1_SALSA/485-766                    ..............................................................................................................YKYQd...eaNSA...LPGYAVAIAVGNAI.KN.RAS.......NEE....ILTVLKDVPNPN..QE.DD.DDE...gEGFNP.....................LKIEVFLQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEI..LKAL............TDC......................................................DEGKL..H...I....L.RVVYEVWK.NHP...Q...MVSVLVDK.LIRTQ.IV.DCA.AVANWL..FS......................................................PSM...AHE.F.T.R.F.Y.V..WEILHS.TIRKMNKH..............VQKIQKELEEAKDKLERQq.......hkK-Qkds.........gdeE--Dmekn...................................................................sededGQLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMMLTEH...................LVRC.E..T.GSVD.FS.T----...............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
F7VZ09_SORMK/533-786                   ..............................................................................................................FKFA......DEK...TPFAAEGKEIAALL.RR.KAP.......EEE....IEPVIERIHSLA..LD.NN.---....LDPLV.....................ASTDVFVT..SVL...HVGSKSLSHVL.A.AIE.R..T.........KER..LTDA...........gATS......................................................EAART..Q...I....I.SSVMEYWS.AHP...G...VAIAIIEK.LLNYS.IL.TPQ.AVINWA..ITty..................................................agATR...GEA.L.A.R.G.F.V..YEMIFN.TVVKVTSR..............---LRQVLQK--------..........---...............----............................................................................-ATL....PEAM.IDD.ETIEAE.I.N...G.M.RSLFRAIE.........D.............ALVAWATGSkd...............emIEAS.D..S.LGEG.DG.NSETE...............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
A0A183GD92_HELBK/1-115                 ..............................................................................................................----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................-----..-...-....-.--------.---...-...-MIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ENL...RSE.T.D.R.Q.W.V..WEVLNT.ALERLSRH..............IHKVAHDVQILRRRVEKR..........KNDggd.........evtD--Dnd........................................................................gkPREQ....DELE.QQQ.KKLDNL.K.D...F.Q.KSLFLDVL.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------hv...........................................................................................
A0A1E5R0G2_9ASCO/600-854               ..........................................................................................................fvll----......NEK...LPFSKETQSVVNYF.RK.K--.......ERT....IQELHGIIGKLE..SE.YG.QYI....SNVDK.....................LIVTLLTQ..AVI...HAGSRSISHAS.N.CVR.D..F.........KED..LAEVfg........vvPNA......................................................QEKDK..W...V....I.EAIMRYWN.FDS...K...TGLTIVSY.FFKNN.LI.SAKnSLVDFL..FNe...................................................yeTNQ...SIG.L.V.D.S.T.F..IESLLD.LLQNEETE..............------------------..........---...............----............................................................................----....----.---.------.-.-...T.D.LSLYQYVF.........E.............KISLLANDS...................ISKL.N..L.SASE.SL.PSIPNfdyydfedpetpk.....................pdisaedlakydlVWKMES..SV..SL..IKSIIRKYGK---kys..........................................................................................
M7BPB3_CHEMY/114-292                   .............................................................................................................g----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.R..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVVYEVWK.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...AHD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VVKIQKELEETKARLARQ.........hKRRds...........ddE--Dedddr.................................................................ssgredGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............HHQII----...................----.-..-.----.--.-----...............................................------..--..--..-------------qqymltlenllftaeldhhi.........................................................................
A0A1B0AEE3_GLOPL/519-800               .......................................................................................................ykaipnc----......--S...LAGTQVAHQLVVAI.RQ.KCS.......PEE....VINILKELPNSG..EN.SD.QEM....SDSSFn...................pLKIDVFVQ..TLL...NLGSKSFSHSF.A.AVS.K..F.........HLV..FKAL............AES......................................................EEAQI..C...I....L.HNVFELWQ.NHQ...Q...MMVVIIDK.LLKIQ.IV.DCS.AVATWI..FS......................................................KEM...TGE.F.T.K.M.Y.L..WEILHL.TIKKMNKH..............VIKLSNELNDAKEKFAKA..........DSSs.............sDS-Edeatpkr.............................................................kkpvtvvdKPTE....EMVE.RME.EKLEAA.N.V...D.Q.KRLFLIVF.........Q.............RFIMILSEH...................LVRS.D..T.DGRD.PD.T----...............................................DWYRWT..VG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0R3QZB8_9BILA/166-424               .........................................................................................................qeeke----......---...-----LVAEIERAF.RN.KAE.......PKE....ITEMLREFDKEG..NS.L-.---....-----.....................ATLSTFFS..VML...NAAQKSFSHNF.V.ALT.R..Y.........HET..LKEL...........sGVD......................................................DESST..A...L....L.RTLYDVWK.HNR...Q...MMVVLITK.MFRMT.LL.NAN.AVVSWL..LS......................................................SYV...DQE.L.H.R.F.W.L..WEALFI.IVKHVCGH..............MNRCKTKLQQMQEKRIKM..........ERSsgnvc.....qlfcsNK-Ddg........................................................................lwMILD....DDIE.MKK.KELKEL.Q.D...M.L.KNLFLNIL.........H.............KLVLFLSEH...................LVKS.E..M.TEKN.HD.T----...............................................YWYRYM..MG..RF..KEMLLK-------ywcel........................................................................................
U6NYV9_HAECO/687-947                   .............................................................................................................c-KFD......DEN...QPGYEAASKFLALI.QS.RSD.......DNA....IMAEIRDEENRY..--.-D.---....P----.....................DLFGIFFA..VLL...KTSAKSFSHTF.V.ALS.R..Y.........STT..LKTI...........aDTS......................................................DEMQE..V...L....L.CCLFQCWR.NNH...L...RIIILVDK.MLKMQ.IL.DCG.VVISWI..FS......................................................ESL...KSE.T.D.R.Q.W.V..WEVLNT.ALERLSRH..............IHKVAHDVDILQKRVERQr........iEAGe............emE--Dsd........................................................................vkTREQ....EELE.QQQ.EKLENL.K.D...F.Q.KSLFLDVL.........H.............KFTVLLTEF...................IVNC.E..T.EGTD.FR.T----...............................................PYYAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
A0A044SD50_ONCVO/527-809               ..............................................................................................................YDLN......DDE...HPDRDFAIILEKAF.RD.KIS.......ADE....MIDLLRSKTGNR..MD.IN.---....-----.....................SRLSIFFK..VLL...YLARKTFSHNF.A.ALT.R..Y.........YST..LKEF...........iGGR......................................................EDAQL..T...I....L.RTLYETWK.LNG...Q...MIIVLVTK.LLKMS.LV.DAS.AVVAWL..FS......................................................DEM...KHE.F.E.R.L.W.I..WEILNR.ALEHVSGH..............VHRSRQAVENRKLKNERKd.......sdH-Ek............ddF--Dmead...................................................................ehhitDPNA....VELF.VKE.SEFADL.H.E...C.L.KNLLLDVL.........H.............AIFSSLIEYnglcfqk....faitlaehIVNS.E..S.SGRD.FQ.N----...............................................NWYSYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
N4VJM2_COLOR/521-766                   ..............................................................................................................FKFN......DDH...TPFSAEGREIAALL.KR.KAA.......DEE....FQPVIERVHSLA..IE.RG.---....LDPLV.....................TSTDIFVT..AIC...WVGSKSLSHVL.A.CIE.R..T.........KDR..LLDV...........gAAS......................................................ETAKA..Q...I....I.TAVMSYWA.AQP...G...VAISIVEK.LLNYT.IL.LPI.NVIEWA..LVgss...............................................hvdgASS...GDS.L.A.Q.T.H.V..FELVFG.TVAKVTGR..............VRQLHTEAGADA------..........---...............----............................................................................----....----.---.EAKTVE.I.E...A.M.RVLFKAME.........D.............ALVSWATGT...................KDEM.M..E.EVDG.A-.-GQRD...............................................ALIRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
B3L6S4_PLAKH/822-1086                  iqtffnylneksclnkvppyfdniekniqqldnpsstnldgtffnryispgdftdseacwnsysililffkaliffdssnvsslkknfknhavifsnyknsgvftsdeer----......---...--------------.--.---.......---....------------..--.--.---....-----.....................--------..---...-----------.-.---.-..-.........---..----............---......................................................LQFEI..E...L....L.SIVYAYFN.-NS...I...LLNAVVAI.LLENE.IV.QEL.SVMHFI..FA......................................................KLE...DTS.L.D.E.Y.Y.V..LKLIYE.SIDNLIIR..............-----KECMDVEKSKLKR..........---...............----............................................................................KQTK....NENE.MLM.KELEDK.K.N...E.LiQKVFLLTN.........-.............KTIFMLSEK...................MIKL.K..N.ENNA.YM.-----...............................................------..--..--..-------------skellkeslvflrtyadyid.........................................................................
C4XYV4_CLAL4/259-527                   ..............................................................................................................YEFS......NPA...LPLNEVANKLYDFIiAN.WRS.......NEQ....FNDMVNETLEAI..KS.S-.VVN....VDSDK.....................VLINLLFQ..TYA...YIGSRSIYSVV.S.ILN.R..D.........IAK..LKFVsgv......evtE-Edyklsgtefq.................................fpdlhltpeqlGNRQK..W...I....I.ESILRIWI.QQP...Q...VAFLILEY.LIEFG.IL.NPQ.YLIRKA..LD......................................................PDS...NLI.I.N.N.V.S.C..MESINR.VLSTCAVG..............------------------..........---...............----............................................................................----....----.---.------.-.E...S.S.KEVILLLF.........N.............LIVENLNYT...................LGKI.G..V.ENPE.TE.EVKIItefsdedkn............................dtelmakidlQWLFYE..YR..GL..LKTYLRKFNLQ--hs...........................................................................................
A0A1Y1XG42_9FUNG/517-807               ....................................................................................................ykyqnndfgd----......---...QILYEYAQEIYNAF.RT.KTP.......PQE....INIILEKINNYV..TE.KK.QNA....ASMEVddqd............ldpesVVLEIVIQ..SAM...MVGSKSFSHIL.N.VVE.R..Y.........ITI..LTSL............NVS......................................................NQAKD..K...T....V.RFVADFWK.YNP...Q...FLEIILDK.LVNYR.VV.DPK.NIITWI..LS.....................................................dVIL...SDQ.Y.T.H.L.Y.V..WSILRN.TLKKVVLR..............VQQVKAKLEYTKKLYMEQ..........EEQ..............kKSDDiddpmkt..............................................................shnesiaNIDE....DSIA.IIE.KTQEAV.I.R...D.Q.KEAFICVF.........Q.............RFAETTEIK...................IKEF.E..T.QNID.PI.K---T...............................................PWWRWV..I-..GF..IRDVGRTYSTE--vq...........................................................................................
A0A1B7MUG0_9HOMO/542-868               ..............................................................................................................FEYE......DPA...NPHYDAAQSILDLL.RG.RSK.......AEE....VLSHIESLKTTL..EA.SG.-TH....VHVDS.....................TIRSISIH..CLL...SIGSRSFSHLL.N.AIE.R..Y.........LPL..LRGL............AGT.....................................................dTESKQ..D...I....L.SAVASFWR.LNR...Q...MVNIVFDK.LMQYQ.IV.DPT.DVVGWT..FEnvtg..............................................dahlSGM...RPM.S.L.S.A.F.E..WDLLRG.ALDKANGR..............VMVARRKVAALRKEHDDSva......rvKASgg..........advGSMEidtemkpfkqgavqqi............................................iilaapltglflpddsASEN....PQLT.VAL.KAFASL.T.R...E.Q.KGALARTI.........E.............GFVSCLAPP...................PSAG.R..Q.NPHA.-Q.TVVTEqawenr...................................sewqadEWNTWE..TW..GW..YRHFCRTYSPYL-r............................................................................................
A0A0U5FQ40_9EURO/529-782               ..............................................................................................................FKYS......LDT...TPYANEGRELMQLI.RR.KAA.......DEE....IQPLITAIEEQA..TS.LG.VES....--PIL.....................PSTDAFVT..AIC...FVGSKSLSHVL.S.CIE.R..N.........KDR..LLAI...........gPKS......................................................PAARR..Q...I....I.TSVMEYWV.DQP...G...IGINIIDK.LLNYT.II.TPL.SVIEWA..LVd....................................................kLEA...GAI.L.A.K.T.H.V..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLTRE.K.K...D.M.HSLFQVIE.........D.............SVVSVAGGSnd...............qlMERG.D..G.SGDL.PE.D----...............................................EIIRQW..GK..RW..LRVFRRKAAVEE-a............................................................................................
F7H7F0_CALJA/487-762                   ..............................................................................................................YKYGd...esSNS...LPGHSVALCLAVAF.KS.KAT.......NDE....IFSILKDVPNPN..QD.DD.DDE....G-FSFn...................pLKIEVFVQ..TLL...HLAAKSFSHSF.S.ALA.K..F.........HEV..FKTL............AES......................................................DEGKL..H...V....L.RVMFEVWR.NHP...Q...MIAVLVDK.MIRTQ.IV.DCA.AVANWI..FS......................................................SEL...SRD.F.T.R.L.F.V..WEILHS.TIRKMNKH..............VLKIQKELEEAKEKLARQ.........hKRR..............sD-DDdrss....................................................................drkdGALE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.DGTS.VL.T----...............................................PWYKNC..IE..RL..QQIFLQHHQIIQ-q............................................................................................
A0A1I7UXL3_9PELO/490-694               ...........................................................................................................yli---D......QED...TALFQRSETFTQMF.QE.RQP.......ADA....FLNELKSSDDND..EL.P-.---....--YNI.....................NEFGLFVM..VML...KMASKTFSHNF.S.ALF.R..Y.........QAV..LKTI...........cDIS......................................................EQYQE..K...L....L.ETLYSCWK.TNQ...Q...MLMILTDK.LLKMQ.II.DCS.SVVAWL..FD......................................................EKM...WQE.H.D.R.Q.W.S..FEVLNQ.ALEKLTRQ..............INVVEKDIKELTEKVENK.........gKET..............mKD-Qkpk......................................................................wkrK---....----.---.------.-.-...-.-.--------.........-.............---------...................----.-..-.----.--.-----...............................................------..--..--..-------------krqtkvrekiwknw...............................................................................
M7TI29_BOTF1/577-824                   ..............................................................................................................FKFD......DPS...TPFSAEGQEILALL.RK.KAT.......EEE....IQPVVDRIHALA..VE.QA.--L....PDPLV.....................PSTDAYVT..SIC...YIGSKSLSHVL.S.CIE.R..C.........KDR..LLAI...........gPVS......................................................PVARR..Q...I....I.TSVMQYWK.DQP...G...IGVNIIDK.LLNYT.IL.SPQ.SVVQWA..IG......................................................S-E...GKR.L.S.Q.S.F.V..YEMVEA.TVGKVTGR..............IRQVQLSL-------RVP..........---...............----............................................................................GLLE....EQKQ.LIE.KTVEME.R.I...N.M.RELGREMD.........E.............LLTAWANGS..................kDQEI.E..M.DGRE.ED.R----...............................................ALVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
A0A1L8HNS1_XENLA/486-761               ........................................................................................................kygdes----......NSA...LPGYSVAVILTNAI.KN.KAS.......DKE....IFNILKDIPNPN..QD.DD.DDE...gIGFNP.....................LKIEVFVQ..TLL...NLASKSFSHSF.S.ALA.K..F.........HDI..FKAL............SES......................................................DEGKL..H...I....L.RVVYDVWK.NHP...Q...MIAVLLDK.MIRTQ.IV.DCA.AVANWI..FS......................................................PEL...SPD.F.T.R.F.Y.I..WEILHS.TIRKMNKH..............VQKIQKELEDTKQRLAKQ.........hKHRds...........ddN--Deds.....................................................................grkdGPLE....EQIE.RLQ.EKVESA.Q.S...E.Q.KNLFLVIF.........Q.............RFIMILTEH...................LVRC.E..T.GGID.VN.T----...............................................AWYKNC..RE..RL..QQIFLQHHQTIQ-q............................................................................................
A0A0E0D0E5_9ORYZ/483-829               ......................................................................................................fryhsdeg----......KES...TDGHRLSKELVGMV.RG.RKT.......QGD....IISWVDEKIIPV..--.NG.---....---AK.....................FALDVVCQ..TLL...DIGSKSFTHLI.T.VLE.R..Y.........GQI..ISKL............CPN......................................................EEMQL..L...L....M.DEVSAYWK.NST...Q...MIAIAIDR.MMGYR.LI.SNL.AIVKWV..FS......................................................PAN...VDQ.F.H.V.SdR.P..WEILRN.AVSKTYNR..............IFDLRKEIQTLRKGLQAA.........kE-Ase..........kaaR--Eleeaksiieivdgqpvpse......................................npgrlrrlqaradkakegeVTTE....ESLE.AKE.ALLARG.L.E...E.S.KELLRLLF.........K.............SFVEVLTERlppisv.......dgdvpnL---.-..-.----.--.-RAGDpnvnsaardpeattmeidne......nggdndsqlngqnkkishnvgELEQWClcTL..GY..LKSFSRQYATE--i............................................................................................
S2JP86_MUCC1/537-805                   ..............................................................................................................FAYK......DIK...DPLHAQAKVVIESL.RT.KKT.......ADE....VRTILDKYKEEV..RA.TG.VDE....QEQNQ.....................RVREMFVQ..CLL...LVGSKSFSHIL.N.VVE.R..Y.........LDV..LRFV............NAT......................................................PDGRL..H...T....V.QIVASFWE.HNT...Q...FLGILLDK.LLNYR.VI.DPA.SVINWI..FE......................................................TNQ...LQF.A.G.R.A.F.I..WEILKN.TLSKVNSR..............VVQVKAKLDSFQSLHSANk.......lkR-Ae.............sE--Hnela....................................................................eaeeQQEL....DSLR.IVE.NSLASV.S.R...E.Q.KEVFMAVY.........Q.............KFTQVLQEL...................I---.K..T.NAQP.EA.-----...............................................NWTYRW..VF..GW..FREMLRVHYKE--cg...........................................................................................
A0A229WY43_9EURO/528-781               ..............................................................................................................FKYS......SDT...TPYAKEGREIMQLI.RK.KAA.......DEE....IQPLITAIEEQA..KA.LG.V--....DDPML.....................PSTDAFVT..SIC...FVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPKS......................................................ARARC..Q...I....I.TSVMEYWV.DQP...G...VAINIIDK.LLNYT.IL.TPL.SVIEWA..LVe....................................................rLQA...GTI.L.S.R.T.H.I..FEMISA.TVGKVTNR..............---LRQIVAARTQ----P..........---...............----............................................................................GLYE....PQLS.VLD.ETLRRE.K.A...D.M.QALFKVIE.........D.............SIVSVAGGSnd...............glMERG.D..G.SGNL.PE.D----...............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
D8SFU6_SELML/513-831                   ..........................................................................................................etgf----......---...------ASELLAQI.KT.KKG.......MKD....IESWFESKIVPA..AG.Q-.---....----K.....................VAIEILLQ..TLL...NLGSKSFTHMV.T.VLE.R..Y.........GQL..IATL............APD......................................................ETLQV..H...V....I.DEVARFWQ.NSS...Q...MIAIVVDR.MMGYR.LV.SNL.AVIRWS..FK......................................................DEN...VQT.FhT.S.G.R.V..WELLGN.AINKAGNR..............TADLQRDVVNAKRALDEAdg.....avsKAEr............nrS--Nvqelidsaetddarkqa.........................................tskmewvkttvvkargrqTAAQ....DLLE.TKE.ALLSGA.L.R...E.Q.DTLVCLVF.........Q.............NLVSTISSK...................LSKS.D..A.DGAD.TA.EPEPMdvdadpsaaategn..................nnennenqnerykksHW-QRC..TM..GH..LEAFCRQYAAE--v............................................................................................
A0A093UPX8_TALMA/550-804               ..............................................................................................................FKYT......LET...TPYSKQGLELMQLI.RK.KAS.......DEE....IEPVIAEIETQA..KE.HG.--I....EDPIV.....................PSTDAFVT..SIC...YVGSKSLSHVL.S.CIE.R..N.........KER..LLAI...........gPRS......................................................APGRR..Q...I....I.TSVMEYWV.DQP...G...IAINIIDK.LLNYT.IL.TPL.SVIEWA..LLd....................................................hIDA...GRI.L.A.K.A.H.I..YEMLSS.TVGKVTNR..............---IRQIVAARTQR----..........---...............----............................................................................GLYE....PQLS.VLD.ETLNRE.K.A...D.M.QTLFTLIE.........D.............SIAPVAAGS..................nDELM.E..R.SEDD.PS.TRDEN...............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
A0A091N9U0_9PASS/444-631               ...................................................................................