GenomeNet

Database: Pfam
Entry: MIX
LinkDB: MIX
Original site: MIX 
#=GF ID   MIX
#=GF AC   PF18529.2
#=GF DE   Mitochondrial membrane-anchored proteins
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF04769
#=GF GA   43.80 43.80;
#=GF TC   319.10 318.90;
#=GF NC   41.70 27.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   21465610
#=GF RT   Crystal structure of the Leishmania major MIX protein: a
#=GF RT   scaffold protein that mediates protein-protein interactions.
#=GF RA   Gorman MA, Uboldi AD, Walsh PJ, Tan KS, Hansen G, Huyton T, Ji
#=GF RA   H, Curtis J, Kedzierski L, Papenfuss AT, Dogovski C, Perugini
#=GF RA   MA, Simpson RJ, Handman E, Parker MW;
#=GF RL   Protein Sci. 2011;20:1060-1068.
#=GF DR   INTERPRO; IPR040571;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   MIX forms an all alpha-helical fold comprising seven
#=GF CC   alpha-helices that fold into a single domain. The distribution
#=GF CC   of helices is similar to a number of scaffold proteins, namely
#=GF CC   HEAT repeats, 14-3-3, and tetratricopeptide repeat proteins,
#=GF CC   suggesting that MIX mediates protein-protein interactions [1].
#=GF SQ   7
#=GS Q57ZY0_TRYB2/47-198      AC Q57ZY0.1
#=GS A4HTQ3_LEIIN/44-195      AC A4HTQ3.1
#=GS Q4QI49_LEIMA/44-195      AC Q4QI49.1
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 F; 55-183;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 C; 71-183;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 B; 65-184;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 G; 70-182;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 A; 58-184;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 E; 70-180;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 H; 72-180;
#=GS Q4QI49_LEIMA/44-195      DR PDB; 3HA4 D; 71-184;
#=GS A4H5F8_LEIBR/44-195      AC A4H5F8.1
#=GS Q4DB35_TRYCC/47-198      AC Q4DB35.1
#=GS Q4D1I4_TRYCC/47-198      AC Q4D1I4.1
#=GS A0A1X0NFN6_9TRYP/47-198  AC A0A1X0NFN6.1
Q57ZY0_TRYB2/47-198                 TVKETKKAGPLELPDELEDERRRRNDPRRPPWPLLHQRSVLLREGKAPHDDLLLLWEQTRHYYPADWLVPLEITQVLKYTSGAYLQNYVPDPDQLRKEVLMQLLNIQYGRVRDPNGGRLNRDVKEIIAMAIEDLENMDLSPGTEPALVPTHT
A4HTQ3_LEIIN/44-195                 SVKETKKAGPIELPEELEAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQTKHYYPADWLIPLELTQVLKYSSGKYLQTYVADPDEMRKEVLMQLLNVKYGRVSDPKGGRVNKDVEEIISMAVDDLENMDLNPSADAVLIPTHT
Q4QI49_LEIMA/44-195                 SVKETKKAGPIELPEELEAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQTKHYYPADWLIPLELTQVLKYSSGKYLQTYVADPDEMRKEVLMQLLNVKYGRVSDPNGGRVNKDVEEIISMAVDDLENMDLNPAADAVLIPTHT
#=GR Q4QI49_LEIMA/44-195      SS    XXXXXXXXXXXXXHHHHHHHHHHHHXTT---HHHHHHHHHHHHTTSSSGGGHHHHHHHHHHH-TT-SHHHHHHHHHHHHS-HHHHHHH-SSHHHHHHHHHHHHHHHHTTSS--STT----HHHHHHHHHHHHHHHT-----XXXXXXXXXXX
A4H5F8_LEIBR/44-195                 SVKETKKAGPIELPEELQAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQTKHYYPADWLIPLELTQVLKYSSGKYLQTYVADPDEMRKEVLMQLLNVKYGRVSDPNGGRVNKDVEEIISMAIDSLENMDLNPAADTVLVPTHT
Q4DB35_TRYCC/47-198                 SVKETKKAGPIELPDELEAEKRRRNDPRRPPWPLLHQRIVLLREGKAPHDDLPLLWEQTRHYYPADWLVPLEVTQVLKYTSGAYLQNYVADPDKLRKDVLMQLLNIKYGRVKDPNGGRINRDVEEIISMAIEDLENMDLSPSADAALVPTHT
Q4D1I4_TRYCC/47-198                 SVKETKKAGPIELPDELEAEKRRRNDPRRPPWPLLHQRIVLLREGKAPHDDLALLWEQTRHYYPADWLVPLEVTQVLKYTSGAYLQNYVADPDKLRKDVLMQLLNIKYGRVKDPNGGRINRDVEEIISMAIEDLENMDLSPSADAALVPTHT
A0A1X0NFN6_9TRYP/47-198             TVQETKKAGPLELPDELEAERRRKNDPRRPPWPLLHQRAVLLREGKAPHDDLPLLWEQTRHYYPADWLVPLEITQVLKYTSGAYLQNYVADPDQLRKEVLLQLLNIKYGRVKDPNGGRVNRDVEEIIAMAIEDLENMSLSPSADVVLVPTHT
#=GC SS_cons                        XXXXXXXXXXXXXHHHHHHHHHHHHXTT---HHHHHHHHHHHHTTSSSGGGHHHHHHHHHHH-TT-SHHHHHHHHHHHHS-HHHHHHH-SSHHHHHHHHHHHHHHHHTTSS--STT----HHHHHHHHHHHHHHHT-----XXXXXXXXXXX
#=GC seq_cons                       SVKETKKAGPIELP-ELEApRpR+NDPRRPPWPLLHQRlVLLREGKus.-DlsLhWEQT+HYYPADWLlPLElTQVLKYoSGtYLQsYVADPDchRKEVLMQLLNlKYGRVpDPNGGRlN+DVEEIISMAI-DLENMDLsPuADssLVPTHT
//
DBGET integrated database retrieval system