GenomeNet

Database: Pfam
Entry: PF01349
LinkDB: PF01349
Original site: PF01349 
#=GF ID   Flavi_NS4B
#=GF AC   PF01349.17
#=GF DE   Flavivirus non-structural protein NS4B
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_211 (release 3.0)
#=GF GA   25.00 25.00;
#=GF TC   259.10 257.90;
#=GF NC   22.70 22.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2174669
#=GF RT   Flavivirus genome organization, expression, and replication. 
#=GF RA   Chambers TJ, Hahn CS, Galler R, Rice CM; 
#=GF RL   Annu Rev Microbiol 1990;44:649-688.
#=GF DR   INTERPRO; IPR001528;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Flaviviruses encode a single polyprotein.                 This
#=GF CC   is cleaved into three structural and seven non-structural
#=GF CC   proteins. The NS4B protein is small and poorly conserved among
#=GF CC   the Flaviviruses. NS4B contains multiple hydrophobic potential
#=GF CC   membrane spanning regions [1].  NS4B may form membrane
#=GF CC   components of the viral replication complex and could be
#=GF CC   involved in membrane localisation of NS3 and Pfam:PF00972 [1].
#=GF SQ   3
#=GS POLG_YEFV1/2257-2500  AC P03314.1
#=GS POLG_YEFV1/2257-2500  DR PDB; 5N6B C; 1-9;
#=GS POLG_YEFV1/2257-2500  DR PDB; 5N6B F; 1-9;
#=GS POLG_DEN1W/2245-2486  AC P17763.2
#=GS POLG_ZIKV/2266-2508   AC Q32ZE1.1
POLG_YEFV1/2257-2500             NELGMLEKTKEDLFGKKNLIPSSASPWSWPDLDLKPGAAWTVYVGIVTMLSPMLHHWIKVEYGNLSLSGIAQSASVLSFMDKGIPFMKMNISVIMLLVSGWNSITVMPLLCGIGCAMLHWSLILPGIKAQQSKLAQRRVFHGVAENPVVDGNPTVDIEEAPEMPALY....EKKLALYLLLALSLASVAMCRTPFSLAEGIVLASAALGPLIEGNTSLLWNGPMAVSMTGVMRGNHYAFVGVMYNLWK..
#=GR POLG_YEFV1/2257-2500  SS    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---S-----XXXXXXXXXXXXXXXXXXXXXX..
POLG_DEN1W/2245-2486             NEMGLLETTKKDL-GIGHAAAENHHHAAMLDVDLHPASAWTLYAVATTIITPMMRHTIENTTANISLTAIANQAAILMGLDKGWPISKMDIGVPLLALGCYSQVNPLTLTAAVFMLVAHYAIIGPGLQAKATREAQKRTAAGIMKNPTVDGIVAIDLD-----PVVYdakfEKQLGQIMLLILCTSQILLMRTTWALCESITLATGPLTTLWEGSPGKFWNTTIAVSMANIFRGSYLAGAGLAFSLMK..
POLG_ZIKV/2266-2508              NELGWLERTKNDIAHLMGRREEGATMGFSMDIDLRPASAWAIYAALTTLITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFMHGDLGVPLLMMGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIVVTDIDTMTIDPQV-....EKKMGQVLLIAVAISSAVLLRTAWGWGEAGALITAATSTLWEGSPNKYWNSSTATSLCNIFRGSYLAGASLIYTV--tr
#=GC SS_cons                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---S-----XXXXXXXXXXXXXXXXXXXXXX..
#=GC seq_cons                    NELGhLE+TKcDLhGltsttsEuAohuuhhDlDL+PASAWTlYAulTTlITPMl+HsIcsoYuNlSLoAIAsQAuVLhGMDKGhPFMKMDIGVPLLhlGCYSQlTPLTLlsAIhhLVAHYulIlPGLQApAoRtAQKRTAAGIMKNPVVDGIVslDIDphs..PsVY....EKKLGQlLLLALulSSllLhRTsWuLuEuIsLATAALoTLWEGSPuKaWNoohAVSMsNIFRGSYLAGAGLhYoLhK..
//
DBGET integrated database retrieval system