GenomeNet

Database: Pfam
Entry: PF01570
LinkDB: PF01570
Original site: PF01570 
#=GF ID   Flavi_propep
#=GF AC   PF01570.17
#=GF DE   Flavivirus polyprotein propeptide
#=GF AU   Bashton M;0000-0002-6847-1525
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_304 (release 4.1)
#=GF GA   27.60 27.60;
#=GF TC   35.00 91.40;
#=GF NC   21.60 18.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2174669
#=GF RT   Flavivirus genome organization, expression, and replication. 
#=GF RA   Chambers TJ, Hahn CS, Galler R, Rice CM; 
#=GF RL   Annu Rev Microbiol 1990;44:649-688.
#=GF DR   INTERPRO; IPR002535;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The flaviviruses are small enveloped animal viruses containing a
#=GF CC   single positive strand genomic RNA [1].  The genome encodes one
#=GF CC   large ORF a polyprotein which undergos proteolytic processing
#=GF CC   into mature viral  peptide chains. This family consists of a
#=GF CC   propeptide region of approximately 90 amino acid length.
#=GF SQ   3
#=GS POLG_DEN1W/120-204  AC P17763.2
#=GS POLG_YEFV1/126-209  AC P03314.1
#=GS POLG_ZIKV/128-214   AC Q32ZE1.1
POLG_DEN1W/120-204             RGGEPHMI.VSKQERGKSLLFKTSAGVNMCTLIAMDLGELCEDTMTYKCPRIT.ETEPDDVDCWCNATE.TWVTYGTCS.QTGEHRRDK
POLG_YEFV1/126-209             RKNRWLLLnVTSEDLGKTF----SVGTGNCTTNILEAKYWCPDSMEYNCPNLSpREEPDDIDCWCYGVEnVRVAYGKCD.SAGRSRRSR
POLG_ZIKV/128-214              RGSAYYMY.LDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMSYECPMLDeGVEPDDVDCWCNTTS.TWVVYGTCHhKKGEARRSR
#=GC seq_cons                  RGucaaMl.Vo+pDtGKol.FtTSlGVNpCTlpIMDLGahC-DTMoYcCPpLo.csEPDDVDCWCNuTE.TWVsYGTCc.psGEuRRSR
//
DBGET integrated database retrieval system