GenomeNet

Database: Pfam
Entry: PF02832
LinkDB: PF02832
Original site: PF02832 
#=GF ID   Flavi_glycop_C
#=GF AC   PF02832.16
#=GF DE   Flavivirus glycoprotein, immunoglobulin-like domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Griffiths-Jones SR;0000-0001-6043-807X
#=GF SE   Pfam-B_146 (release 3.0)
#=GF GA   20.80 20.80;
#=GF TC   21.40 105.00;
#=GF NC   19.90 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   7753193
#=GF RT   The envelope glycoprotein from tick-borne encephalitis virus at
#=GF RT   2 A resolution. 
#=GF RA   Rey FA, Heinz FX, Mandl C, Kunz C, Harrison SC; 
#=GF RL   Nature 1995;375:291-298.
#=GF DR   INTERPRO; IPR027287;
#=GF DR   SCOP; 1svb; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF SQ   3
#=GS POLG_YEFV1/581-676  AC P03314.1
#=GS POLG_ZIKV/590-688   AC Q32ZE1.1
#=GS POLG_DEN1W/578-673  AC P17763.2
#=GS POLG_DEN1W/578-673  DR PDB; 4AL8 C; 298-393;
#=GS POLG_DEN1W/578-673  DR PDB; 4GSX B; 298-393;
#=GS POLG_DEN1W/578-673  DR PDB; 4GSX A; 298-393;
#=GS POLG_DEN1W/578-673  DR PDB; 4GT0 A; 298-393;
#=GS POLG_DEN1W/578-673  DR PDB; 4GT0 B; 298-393;
POLG_YEFV1/581-676             SYKICTDKMFFVKNPTDTGHGTVVMQVKV-SKGAPCRIPVIVADDLTAAINKGILVTVNPIAS..TNDDEVLIEVNPPFGDSYIIVGRGDSRLTYQWHK
POLG_ZIKV/590-688              SYSLCTAAFTFTKVPAETLHGTVTVEVQYAGTDGPCKIPVQMAVDMQTLTPVGRLITANPVITesTENSKMMLELDPPFGDSYIVIGVGDKKITHHWHR
POLG_DEN1W/578-673             SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIP-FSSQDEKGVTQNGRLITANPIVT..DKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFK
#=GR POLG_DEN1W/578-673  SS    ---B--S-EEESS--EE-SSS-EEEEEEE-SS--SEE---EEEEETTS-BESS-B-SSS-EES..-TTS-EEEEE---SEEEEEEESSSTT-EEEEEEE
#=GC SS_cons                   ---B--S-EEESS--EE-SSS-EEEEEEE-SS--SEE---EEEEETTS-BESS-B-SSS-EES..-TTS-EEEEE---SEEEEEEESSSTT-EEEEEEE
#=GC seq_cons                  SYslCTuuFpFsKsPAETtHGTVlVQVKYtGTDAPCKIPVhsAsDhpulTssGRLITANPIlT..Tc-ccVhIEl-PPFGDSYIVVGsGDK+LTapWHK
//
DBGET integrated database retrieval system