GenomeNet

Database: Pfam
Entry: Peptidase_C107
LinkDB: Peptidase_C107
Original site: Peptidase_C107 
#=GF ID   Peptidase_C107
#=GF AC   PF17222.4
#=GF DE   Viral cysteine endopeptidase C107
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   Manual
#=GF GA   25.00 25.00;
#=GF TC   26.10 267.80;
#=GF NC   24.20 21.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   25231310
#=GF RT   Characterization of an alphamesonivirus 3C-like protease defines
#=GF RT   a special group  of nidovirus main proteases.
#=GF RA   Blanck S, Stinn A, Tsiklauri L, Zirkel F, Junglen S, Ziebuhr J;
#=GF RL   J Virol. 2014;88:13747-13758.
#=GF DR   INTERPRO; IPR033777;
#=GF DR   MEROPS; C107;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is a family of viral cysteine endopeptidases that process
#=GF CC   RNA  polyproteins. Site directed mutagenesis suggest that H1434
#=GF CC   and C1539 form the catalytic dyad [1].
#=GF SQ   9
#=GS F8RL29_AMV79/1387-1700      AC F8RL29.1
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAC B; 1-305;
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAK A; 1-305;
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAK D; 1-305;
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAC A; 1-314;
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAK B; 1-305;
#=GS F8RL29_AMV79/1387-1700      DR PDB; 5LAK C; 1-305;
#=GS F8RL30_AMV79/1387-1700      AC F8RL30.1
#=GS A0A2H4NG12_9NIDO/1620-1918  AC A0A2H4NG12.1
#=GS A0A1B1X402_9NIDO/1339-1651  AC A0A1B1X402.1
#=GS A0A1B1X3Z6_9NIDO/1375-1688  AC A0A1B1X3Z6.1
#=GS A0A1B1X400_9NIDO/1339-1651  AC A0A1B1X400.1
#=GS A0A3G1LCF0_9NIDO/1389-1702  AC A0A3G1LCF0.1
#=GS A0A2H4NG39_9NIDO/1620-1918  AC A0A2H4NG39.1
#=GS A0A1B1X401_9NIDO/1375-1688  AC A0A1B1X401.1
F8RL29_AMV79/1387-1700                 ...SAASNPSISHIVLEMPVAINPLIKYTT.RTSV.SSLRGAVVNGYIYIQRHLFGSKKQEFEACYNNGKGLLNCKNLERSKYDIDSAELIGTLIRIPLHDKHSIPHISIHPDPLSYNGPVTLYLSRYDTELNKDVLCVHTGFMSEGHHDIKTVFGDCGGMLFDPKGRLLGLHCAGSDDVVFMDTTTGKSNIWTSYKLQHPSEIMITLNNEINLPN.PANYDFETTKVVYQHPLRNVCATLETLQHLTNKTNAKLPYDSRLLSDFNITAEQYNQYGYYIDYNNFVNNFNRYTTTTI.GTKSFETCIKYGLMDNKKPDYYNQ.....
#=GR F8RL29_AMV79/1387-1700      SS    ...-TTT-----EE-----GGGS-EEEEE-.SS-E.EEEE-EEETTEEEEEGGGG-SSHHHHHHHHGGGGGGGGEET--TTTB-GGG-EEETTEEEEEBSSTTSS---EE-SSGGG-EEEEEEEEEEEETTTTEEEEEEEEEEEETTEE-----CCGTT-EEE-TTSEEEEEEEEEES--EE-BTTTTB--TTTT--S---EEEEE-TTS-BSSSS.GGGTTTC----EESSSS--HHHHHHHHHHHH-TT-------THHHHHH---HHHHHHHT----HHHHHHTHHHHHHB-B.TTB-HHHHHHH----XXXXTTTXX.....
F8RL30_AMV79/1387-1700                 ...SAASNPSISHIVLEMPVAINPLIKYTT.RTSV.SSLRGAVVNGYIYIQRHLFGSKKQEFEACYNNGKGLLNCKNLERSKYDIDSAELIGTLIRIPLHDKHSIPHISIHPDPLSYNGPVTLYLSRYDTELNKDVLCVHTGFMSEGHHDIKTVFGDCGGMLFDPKGRLLGLHCAGSDDVVFMDTTTGKSNIWTSYKLQHPSEIMITLNNEINLPN.PANYDFETTKVVYQHPLRNVCATLETLQHLTNKTNAKLPYDSRLLSDFNITAEQYNQYGYYIDYNNFVNNFNRYTTTTI.GTKSFETCIKYGLMDNKKPDYYNQ.....
A0A2H4NG12_9NIDO/1620-1918             nay---TNSSQRYVVPGCTPEMNPKLTFLNpTTQVrSILYGAIVDGYLYIERHMFGGDKETFLKNYADGEGLTHVSPLPQSIYNIAEATLYKTMIKVPLHKPQPSPF-KKHPDPNKYTGPVQMYV---DT------RIVH-GFIQEGHHDICTQNGDCGGMLFTLNGEFLGLHCAGSLDVVFADNK--NPTIWTGYKNPHPSEIMITLDSDINLPGdTTDYDFTSTKVIYKHPLRAVVPTLQTLQHITNSSNEYYPYDKLLYRDFSITEEDYLKHKLYVNYPYFVNNFKTIINHTL.GSNSLEFCLKYGIK----------qiqfv
A0A1B1X402_9NIDO/1339-1651             ...SAACNPSIPHAVLNLPVEINPLITFSV.NNYT.SGLRGAIINGYLYIQRHLFGDTKKTFQECYDNGRGLDRCKNLERSKYDIESTVIDGTLIKIPLVDKNMVPHIKVHPNPLSYTGPVTLYLSRYDDTKKEDILCVHTGFISEGHHDIRTIFGDCGGMLFDQAGNFLGLHCAGSGDVIFQDK-DGNPNIWTSYRTKHPSEIMITINNEINIPN.PTNYDFNSTKVIYNHPLRKISATLETLQHLTNPTNLKMAYDPRLYNDFNITEEQYDLHGYYVDYNDFVNNFNKYVTTTI.GSKSFELCLKYGITDRNNVTYRNQ.....
A0A1B1X3Z6_9NIDO/1375-1688             ...SAASNPSVPHLALNLPVTINPLITFST.GKYD.SSLRGAIVNGYIYIQRHLFGETKKQFELCYNNGAGLDKCKNLERSKYDIDSAEIIGTLIRIPLINKDSVPKIVVHPNPLTYTGPITLYLSKYDVELQKPVLCMHTGFVEEGHHDIKTVFGDCGGMLFTQEGQLLGLHCAGSDDVSFQDIATGKPNIWTSYKTQHPSEIMITLDSKINLQN.PENYDFSSRTVIYTHPLRSIRATLETLQFLTNPTNTPIAYDNRLWSDFRISAEDYKRCGYNVDYKTFVNNFKTYTTTLInGTRSFESCIKYGITDKN-TT----yrnk.
A0A1B1X400_9NIDO/1339-1651             ...SAACNPSIPHAVLNLPVEINPLITFSV.NNYT.SGLRGAIINGYLYIQRHLFGDTKKTFQECYDNGRGLDRCKNLERSKYDIESTVIDGTLIKIPLVDKNMVPHIKVHPNPLSYTGPVTLYLSRYDDTKKEDILCVHTGFISEGHHDIRTIFGDCGGMLFDQAGNFLGLHCAGSGDVIFQDK-DGNPNIWTSYRTKHPSEIMITINNEINIPN.PTNYDFNSTKVIYNHPLRKISATLETLQHLTNPTNLKMAYDPRLYNDFNITEEQYDLHGYYVDYNDFVNNFNKYVTTTI.GSKSFELCLKYGITDRNNVTYRNQ.....
A0A3G1LCF0_9NIDO/1389-1702             ...SAASNPSISHIVLEMPVAINPLIKYTT.KTSV.SSLRGAVVNGYIYIQRHLFGSKKQEFEACYNNGKGLLNCKNLDRSKYDIDSAELIGTLIRIPLHDKHSVPHISLHPDPLSYNGPVTLYLSRYDTELNKDVLCVHTGFMSEGHHDIKTVFGDCGGMLFDPKGRLLGLHCAGSDDVVFMDITTGKSNIWTSYKLQHPSEIMITLNNEINLPN.PENYDFETSKVVYQHPLRNVCATLETLQHLTNTTNAKLPYDPRLLSDFNITAEQYAQYGYYVDYSNFVNNFNRYTTTTI.GTKSFETCIKYGLLENKKTDYYNQ.....
A0A2H4NG39_9NIDO/1620-1918             nay---TNSSQRYVVPGCTPEMNPKLTFLNpTTQVrSILYGAIVDGYLYIERHMFGGDKETFLKNYADGEGLTHVSPLPQSIYNIAEATLYKTMIKVPLHKPQPSPF-KKHPDPNKYTGPVQMYV---DT------RIVH-GFIQEGHHDICTQNGDCGGMLFTLNGEFLGLHCAGSLDVVFADNK--NPTIWTGYKNPHPSEIMITLDSDINLPGdTTDYDFTSTKVIYKHPLRAVVPTLQTLQHITNSSNEYYPYDKLLYRDFSITEEDYLKHKLYVNYPYFVNNFKTIINHTL.GSNSLEFCLKYGIK----------qiqfv
A0A1B1X401_9NIDO/1375-1688             ...SAASNPSVPHLALNLPVTINPLITFST.GKYD.SSLRGAIVNGYIYIQRHLFGETKKQFELCYNNGAGLDKCKNLERSKYDIDSAEIIGTLIRIPLINKDSVPKIVVHPNPLTYTGPITLYLSKYDVELQKPVLCMHTGFVEEGHHDIKTVFGDCGGMLFTQEGQLLGLHCAGSDDVSFQDIATGKPNIWTSYKTQHPSEIMITLDSKINLQN.PENYDFSSRTVIYTHPLRSIRATLETLQFLTNPTNTPIAYDNRLWSDFRISAEDYKRCGYNVDYKTFVNNFKTYTTTLInGTRSFESCIKYGITDKN-TT----yrnk.
#=GC SS_cons                           ...-TTT-----EE-----GGGS-EEEEE-.SS-E.EEEE-EEETTEEEEEGGGG-SSHHHHHHHHGGGGGGGGEET--TTTB-GGG-EEETTEEEEEBSSTTSS---EE-SSGGG-EEEEEEEEEEEETTTTEEEEEEEEEEEETTEE-----CCGTT-EEE-TTSEEEEEEEEEES--EE-BTTTTB--TTTT--S---EEEEE-TTS-BSSSS.GGGTTTC----EESSSS--HHHHHHHHHHHH-TT-------THHHHHH---HHHHHHHT----HHHHHHTHHHHHHB-B.TTB-HHHHHHH----XXXXTTTXX.....
#=GC seq_cons                          ...SAAoNPSlsHlVLshPVpINPLITFos.ss.s.SuLRGAIVNGYlYIQRHLFGssKcpFptCYsNGcGLs+CKNLERSKYDI-SAplhGTLI+IPLhcKpslP+IplHPsPLoYTGPVTLYLS+YDsphpcslLCVHTGFlpEGHHDI+TlFGDCGGMLFs.pGphLGLHCAGSsDVlFtDptsGpPNIWTSYKspHPSEIMITLss-INLPN.PsNYDFsSTKVIYpHPLRslsATLETLQHLTNsTNthhsYDsRLasDFsITtEpYppaGYYVDYssFVNNFppYsTTTI.Go+SFEhClKYGIpDpp.ss.........
//
DBGET integrated database retrieval system