GenomeNet

Database: Pfam
Entry: Phage_FRD3
LinkDB: Phage_FRD3
Original site: Phage_FRD3 
#=GF ID   Phage_FRD3
#=GF AC   PF05798.11
#=GF DE   Bacteriophage FRD3 protein
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_7781 (release 8.0)
#=GF GA   25.00 25.00;
#=GF TC   107.30 107.20;
#=GF NC   24.30 23.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR008765;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of bacteriophage FRD3 proteins.
#=GF SQ   8
#=GS M1EBA8_9CAUD/1-75      AC M1EBA8.1
#=GS Q7Y501_BPR69/1-75      AC Q7Y501.1
#=GS A0A0A7HF05_9CAUD/1-75  AC A0A0A7HF05.1
#=GS Q5QC44_9CAUD/1-75      AC Q5QC44.1
#=GS E5FJ17_9CAUD/1-75      AC E5FJ17.1
#=GS Q06E92_BPR32/1-75      AC Q06E92.1
#=GS A0A0U4IHT5_9VIRU/1-75  AC A0A0U4IHT5.1
#=GS Y14E_BPT4/1-75         AC P39508.1
M1EBA8_9CAUD/1-75                 MASVDIDVVDFEYIEEVIRNRYPELRIANSQNSKSWNINVVINGPLKAINRFMEIEYCEGMEPEDKMFYMGLIK-e
Q7Y501_BPR69/1-75                 MAKVSIDVVDYEYTEEVIRNRHPEVRIDSVQDSKFWTTELNLSGPYEAVKKFMVEEYCEGMHPEDAKFYVNLIK-k
A0A0A7HF05_9CAUD/1-75             MANVNIDIVDFEYTYEVIRNRYPSLSMAYIKDTQFFSIQIEIQGPLEDLTRFMADEYCDGMHAEDAEFYMGLIQ-k
Q5QC44_9CAUD/1-75                 MAKVNIDIVDFEYTYEVIRNRYPSLTMTYIKDTQFCSMQIEVQGPLEDLTRFMADEYCDGMHAEDAEFYMGLIQ-k
E5FJ17_9CAUD/1-75                 MAKVNIDIVDFEYTYEVIRNRYPSLSMTYIKDTQFFSIQIEVQGPLEDLTRFMTDEYCDGMHVEDAEFYMGLIQ-k
Q06E92_BPR32/1-75                 MAKVDIDIVDFEYIEEIIRNRYPELSITSVQDSKFWSIQIVIEGPLEVLERFMANEYCDGMDAEDVEFYMGLIEQ.
A0A0U4IHT5_9VIRU/1-75             MATVSIDVVDYEYTEEVIRNRHPEVRIDSVQDSKFWTTELNLSGPYEAVKKFMVEEYCEGMHPEDAKFYVNLIK-k
Y14E_BPT4/1-75                    MAKVDIDIVDFEYIEEIIRNRYPELSITSVQDSKFWSIQIVIEGPLEDLTRFMANEYCDGMDSEDAEFYMGLIEQ.
#=GC seq_cons                     MAKVsIDIVDFEYTEEVIRNRYPELoIsslQDSKFWSIQIslpGPLEsLsRFMs-EYCDGMHsEDAEFYMGLIc.K
//
DBGET integrated database retrieval system