GenomeNet

Database: Pfam
Entry: Prd1-P2
LinkDB: Prd1-P2
Original site: Prd1-P2 
#=GF ID   Prd1-P2
#=GF AC   PF09214.12
#=GF DE   Bacteriophage Prd1, adsorption protein P2
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1n7v
#=GF GA   25.00 25.00;
#=GF TC   968.50 968.40;
#=GF NC   22.10 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12623018
#=GF RT   The receptor binding protein P2 of PRD1, a virus targeting
#=GF RT   antibiotic-resistant bacteria, has a novel fold suggesting
#=GF RT   multiple functions. 
#=GF RA   Xu L, Benson SD, Butcher SJ, Bamford DH, Burnett RM; 
#=GF RL   Structure. 2003;11:309-322.
#=GF DR   INTERPRO; IPR015297;
#=GF DR   SCOP; 1n7v; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Members of this family form a set of bacteriophage adsorption
#=GF CC   proteins, composed mainly of beta-strands whose complicated
#=GF CC   topology forms an elongated seahorse-shaped molecule with a
#=GF CC   distinct head, containing a pseudo-beta propeller structure with
#=GF CC   approximate 6-fold symmetry, and tail. They are required for the
#=GF CC   attachment of the phage to the host conjugative DNA transfer
#=GF CC   complex. This is a poorly understood large transmembrane complex
#=GF CC   of unknown architecture, with at least 11 different proteins
#=GF CC   [1].
#=GF SQ   3
#=GS Q3T4V4_9VIRU/2-556  AC Q3T4V4.1
#=GS Q3T4Y5_9VIRU/2-561  AC Q3T4Y5.1
#=GS P2_BPPRD/2-556      AC P27378.3
#=GS P2_BPPRD/2-556      DR PDB; 1N7U A; 2-555;
#=GS P2_BPPRD/2-556      DR PDB; 1N7V A; 2-556;
Q3T4V4_9VIRU/2-556             .ANFNVPKLGVFPVAAVFDIDNVPEDSSATGSRWLPSIYQGGNYWGGGPQALRAQVSNFDSSNRLPYNPRTENNPAGNCAFAFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYKAEIFRPVNPLPMSDTAPDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAAAAYGFGYQVTVYRWEEIPVEFIADPETCPAQPTTDKVIIRKTDLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTLNPPLRITNNYFADDEVKENTITIGNYTTTLSSAYYAVYKTDGYGGATCFIASGGAGISALVQLQDNSVLDVLYYSLPLSLGGSKAAIDEWVANNCGLFPMSGGLDKTTLLEIPRRQLEAINPQDGPGQDDLFILDESGAYASFSSFIGYPEAAYYVAGAATFMDVENPDEIIFILRNGAGWYACEIGDALKIA.....DDEFDSVDYFAYRGGVMFIGSARYTEGGDPLPIKYRAIIPALP
Q3T4Y5_9VIRU/2-561             a-TITVPKLGEFPTLAVIDIDNVPVDSSNTGSRWLPSVYEGANYFAGGPQKLNATMGTFDSNDRLPYNPRTDDNPAGNCAFSFNPFGQYISNISSAQSVHERIYGIDPNAEPLFTPNAASITNGGNPTMSQDYDYHNIGPINSAYKAEIFRPVNPLPMSDTVPDPETLEPGQAVPVIKTDGIYTDSGIAAFIFDKPVTEPNPNWPPLPPPEIPIIYPMPALGIGAAAAYGFGYQVTRYVWESVPVEFIADPATCPANPTTDKVIIRTTALNPEGTPCAYDPSITLVRQNGNPMNAVAGRLVPEVLDITVDIFLTGKFFALCPPYRVTNNYFADETVNEFTVTRGNWRGAMGAVYWQVYQTDGAGMAKAFIGFGGSGLSALITLQDDTVIDELFYSVPLSIGGSGGPFREWLANNTGMYPYSFGMNKSALIEIPRRSLEAIQPQAVPGYDDIFRLDESAGYASFSSFIGYAQSAYYVAGAGTFMDVENPDQIIFVLRDGKGWYSCDISDALYIGldndgDPEYDSVDYFAFSGGVMFIGSARYTEGGDPLPIKYRAVIPALP
P2_BPPRD/2-556                 .ANFNVPKLGVFPVAAVFDIDNVPEDSSATGSRWLPSIYQGGNYWGGGPQALHAQVSNFDSSNRLPYNPRTENNPAGNCAFAFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYKAEIFRPVNPLPMSDTAPDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAAAAYGFGYQVTVYRWEEIPVEFIADPETCPAQPTTDKVIIRTTDLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTLNPPLRITNNYFADDEVKENTVTIGNYTTTLSSAYYAVYKTDGYGGATCFIASGGAGISALVQLQDNSVLDVLYYSLPLSLGGSKAAIDEWVANNCGLFPMSGGLDKTTLLEIPRRQLEAINPQDGPGQYDLFILDDSGAYASFSSFIGYPEAAYYVAGAATFMDVENPDEIIFILRNGAGWYACEIGDALKIA.....DDEFDSVDYFAYRGGVMFIGSARYTEGGDPLPIKYRAIIPGLP
#=GR P2_BPPRD/2-556      SS    .-EEEE-EEEE--EEEEEEE-SS---BTTT--SSS-BTT-GGGEE--SSEEEEEEEE---TTSEEE--B-BTTBTT--B-S----EEE---SHHHHHHHHHHHTTS-TT-----EE-HHHHHGGGTT--EE-TTSEEETTEEESEEEEEEEESS----EEEEE-TTT--EEEE--EE-TTS--B----EE-BSSS-EEEE-TTTTTSS-SEEEEE--BGGGTEEEEEEEEEEEEEEEEEEEEE-EEEEETTS---SS-BSS-EEEEE-SS-SS-EE--B-TT-EEEE-TT-TTSEEEEEEEEEEEEEEEEEEEEEEEEEE---EEEEEEEEETTCEE--EEEES---SEEEE-SEEEEEE-SSSEEEEEEESSSSEEEEEEEEETTEEEEEEEEEE-GGGTT-HHHHHHHHHHHHS---CCC--EESSSEEEEHHHHH-S--S--TTTT-EEEETT-TTS-TT---EEEEETTEEEEEEE--SSTTS--EEEEEETTSS-EEEEE-CCCCEEC.....TTEE----EEEEETTEEEEEE--B-TT--B-B-EEEEEEE---
#=GC SS_cons                   .-EEEE-EEEE--EEEEEEE-SS---BTTT--SSS-BTT-GGGEE--SSEEEEEEEE---TTSEEE--B-BTTBTT--B-S----EEE---SHHHHHHHHHHHTTS-TT-----EE-HHHHHGGGTT--EE-TTSEEETTEEESEEEEEEEESS----EEEEE-TTT--EEEE--EE-TTS--B----EE-BSSS-EEEE-TTTTTSS-SEEEEE--BGGGTEEEEEEEEEEEEEEEEEEEEE-EEEEETTS---SS-BSS-EEEEE-SS-SS-EE--B-TT-EEEE-TT-TTSEEEEEEEEEEEEEEEEEEEEEEEEEE---EEEEEEEEETTCEE--EEEES---SEEEE-SEEEEEE-SSSEEEEEEESSSSEEEEEEEEETTEEEEEEEEEE-GGGTT-HHHHHHHHHHHHS---CCC--EESSSEEEEHHHHH-S--S--TTTT-EEEETT-TTS-TT---EEEEETTEEEEEEE--SSTTS--EEEEEETTSS-EEEEE-CCCCEEC.....TTEE----EEEEETTEEEEEE--B-TT--B-B-EEEEEEE---
#=GC seq_cons                  .ANFNVPKLGVFPVAAVFDIDNVPEDSSATGSRWLPSIYQGGNYWGGGPQAL+AQVSNFDSSNRLPYNPRTENNPAGNCAFAFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYKAEIFRPVNPLPMSDTAPDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAAAAYGFGYQVTVYRWEEIPVEFIADPETCPAQPTTDKVIIRTTDLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTLNPPLRITNNYFADDEVKENTVTIGNYTTTLSSAYYAVYKTDGYGGATCFIASGGAGISALVQLQDNSVLDVLYYSLPLSLGGSKAAIDEWVANNCGLFPMSGGLDKTTLLEIPRRQLEAINPQDGPGQDDLFILDESGAYASFSSFIGYPEAAYYVAGAATFMDVENPDEIIFILRNGAGWYACEIGDALKIA.....DDEFDSVDYFAYRGGVMFIGSARYTEGGDPLPIKYRAIIPALP
//
DBGET integrated database retrieval system