GenomeNet

Database: Pfam
Entry: Pro_sub2
LinkDB: Pro_sub2
Original site: Pro_sub2 
#=GF ID   Pro_sub2
#=GF AC   PF18513.2
#=GF DE   Prodomain subtilisin 2
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF03531
#=GF GA   25.00 25.00;
#=GF TC   123.30 123.30;
#=GF NC   20.70 18.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   23011838
#=GF RT   Solution NMR structure of a sheddase inhibitor prodomain from
#=GF RT   the malarial parasite Plasmodium falciparum.
#=GF RA   He Y, Chen Y, Oganesyan N, Ruan B, O'Brochta D, Bryan PN, Orban
#=GF RA   J;
#=GF RL   Proteins. 2012;80:2810-2817.
#=GF DR   INTERPRO; IPR040935;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Plasmodium subtilisin 2 (Sub2) is a multidomain protein that
#=GF CC   plays an important role in malaria infection. This domain is a
#=GF CC   conserved region of the inhibitory prodomain of Sub2 from
#=GF CC   Plasmodium falciparum, termed prosub2 which has structural
#=GF CC   similarity to bacterial and mammalian subtilisin-like
#=GF CC   prodomains.
#=GF SQ   5
#=GS B3L5H8_PLAKH/623-710      AC B3L5H8.1
#=GS Q7RQ80_PLAYO/496-583      AC Q7RQ80.1
#=GS Q8IHZ5_PLAF7/553-640      AC Q8IHZ5.1
#=GS A0A509AID5_PLABA/501-588  AC A0A509AID5.1
#=GS A5K529_PLAVS/647-734      AC A5K529.1
B3L5H8_PLAKH/623-710                 .DKQELILVLRGDLDLHSPYMKLVIKRSNAKFEQHIKRNFEQIDKIVYDISSPINFLCFFVPTIFDMNNFHLLKEALMVLHKELERYME
Q7RQ80_PLAYO/496-583                 .KEQELIFIFHGDLDLHSKKMKTIINEANVKFTKYINMHFKDVKNIRYDISSPINFVCFFIPIIFDMSNLKILKEALIILHNELKNYID
Q8IHZ5_PLAF7/553-640                 s-KQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQALLILHNDLHEYVE
A0A509AID5_PLABA/501-588             .KEQELIFIFHGNLDLHSKEMKTVINEANAKFTKYINMHFKDVKNIRYDISSPINFVCFFIPIIFDMSNLKILKEALIILNNELKDYID
A5K529_PLAVS/647-734                 e-RQELIFVLRGDLDLHSTYMRRVIKRSNAKFEEHIKKNFQQVDSIVYDVSSPINFLCFFVPTVFDMSNFHMLKEALLVLQKELERYME
#=GC seq_cons                        .c+QELIFVL+GDLDLHSKpMKsVINcANAKFEKYIKcHFK-VDsIsYDISSPINFLCFFIPTIFDMSNh+lLKEALlILHNEL+cYlE
//
DBGET integrated database retrieval system