GenomeNet

Database: Pfam
Entry: Pur_ac_phosph_N
LinkDB: Pur_ac_phosph_N
Original site: Pur_ac_phosph_N 
#=GF ID   Pur_ac_phosph_N
#=GF AC   PF16656.6
#=GF DE   Purple acid Phosphatase, N-terminal domain
#=GF AU   Punta M;0000-0002-0050-0676
#=GF SE   PDB:1kbp_A
#=GF GA   30.00 30.00;
#=GF TC   30.00 30.00;
#=GF NC   29.90 29.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   8683579
#=GF RT   Mechanism of Fe(III)-Zn(II) purple acid phosphatase based on
#=GF RT   crystal structures.
#=GF RA   Klabunde T, Strater N, Frohlich R, Witzel H, Krebs B;
#=GF RL   J Mol Biol. 1996;259:737-748.
#=GF DR   INTERPRO; IPR015914;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is found at the N-terminus of Purple acid
#=GF CC   phosphatase proteins.
#=GF SQ   6175
#=GS A0A3B6LL81_WHEAT/85-203     AC A0A3B6LL81.1
#=GS A0A1L6J9X3_9SPHN/38-138     AC A0A1L6J9X3.1
#=GS A0A0E0HU23_ORYNI/54-145     AC A0A0E0HU23.1
#=GS A0A0E0GWH4_ORYNI/8-89       AC A0A0E0GWH4.1
#=GS A0A1M6USY5_9FLAO/45-146     AC A0A1M6USY5.1
#=GS A0A1N6NXG8_9GAMM/46-141     AC A0A1N6NXG8.1
#=GS W5TIM5_9NOCA/115-208        AC W5TIM5.1
#=GS A0A340XTR5_LIPVE/87-182     AC A0A340XTR5.1
#=GS S2YUM0_9CORY/46-132         AC S2YUM0.1
#=GS A0A2T4CBI6_TRILO/34-120     AC A0A2T4CBI6.1
#=GS A0A287RAK6_HORVV/1-110      AC A0A287RAK6.1
#=GS A0A1U7XGC1_NICSY/168-276    AC A0A1U7XGC1.1
#=GS B9H0V4_POPTR/81-172         AC B9H0V4.2
#=GS A0A445LN38_GLYSO/19-127     AC A0A445LN38.1
#=GS A0A2I0ALE8_9ASPA/209-309    AC A0A2I0ALE8.1
#=GS A0A2A2YUS5_9ACTN/78-183     AC A0A2A2YUS5.1
#=GS A0A0N5BA92_STREA/28-125     AC A0A0N5BA92.1
#=GS A0A0W8CCA0_PHYNI/68-165     AC A0A0W8CCA0.1
#=GS A0A2M9IK43_9ACTN/48-143     AC A0A2M9IK43.1
#=GS N6WMQ7_9EURY/37-120         AC N6WMQ7.1
#=GS A8X727_CAEBR/21-107         AC A8X727.2
#=GS A0A100YU31_9FIRM/56-148     AC A0A100YU31.1
#=GS A0A0E0MJN8_ORYPU/44-131     AC A0A0E0MJN8.1
#=GS K7IM68_NASVI/29-120         AC K7IM68.1
#=GS A0A1B0C504_9MUSC/493-607    AC A0A1B0C504.1
#=GS A0A2H3HID0_FUSOX/69-173     AC A0A2H3HID0.1
#=GS A0A453K9I6_AEGTS/8-96       AC A0A453K9I6.1
#=GS G0RRS8_HYPJQ/66-169         AC G0RRS8.1
#=GS A0A0M8T8V0_9ACTN/80-206     AC A0A0M8T8V0.1
#=GS A0A0E0QGQ9_ORYRU/77-203     AC A0A0E0QGQ9.1
#=GS C3Z3N2_BRAFL/38-129         AC C3Z3N2.1
#=GS A0A0F5VT18_9ACTN/75-180     AC A0A0F5VT18.1
#=GS I4YJ71_WALMC/18-112         AC I4YJ71.1
#=GS A0A0S3RUT0_PHAAN/71-183     AC A0A0S3RUT0.1
#=GS A0A1U8KRF7_GOSHI/141-245    AC A0A1U8KRF7.1
#=GS A0A094GYC7_9PEZI/37-130     AC A0A094GYC7.1
#=GS A0A3B6TM66_WHEAT/55-146     AC A0A3B6TM66.1
#=GS A0A059LGY9_9CHLO/122-225    AC A0A059LGY9.1
#=GS S2D0A0_9BACT/27-112         AC S2D0A0.1
#=GS A0A1D6KKC7_MAIZE/204-316    AC A0A1D6KKC7.1
#=GS S3B9K3_9BURK/56-200         AC S3B9K3.1
#=GS A0A1V9G210_9BACT/54-151     AC A0A1V9G210.1
#=GS A0A2H5PFE3_CITUN/174-282    AC A0A2H5PFE3.1
#=GS V4MHN2_EUTSA/172-280        AC V4MHN2.1
#=GS A0A3E0HFY7_9PSEU/62-173     AC A0A3E0HFY7.1
#=GS A0A314XUJ8_PRUYE/49-136     AC A0A314XUJ8.1
#=GS A0A251T3U9_HELAN/253-361    AC A0A251T3U9.1
#=GS K7LFF7_SOYBN/72-174         AC K7LFF7.1
#=GS A0A0M3RE16_9BACI/985-1090   AC A0A0M3RE16.1
#=GS R7CGS9_9FIRM/55-149         AC R7CGS9.1
#=GS A0A3B6C6V6_WHEAT/47-134     AC A0A3B6C6V6.1
#=GS A0A168LPI5_9BACL/89-188     AC A0A168LPI5.1
#=GS V4RIF8_9ROSI/78-189         AC V4RIF8.1
#=GS H3GZF9_PHYRM/91-189         AC H3GZF9.1
#=GS A0A1C4IE37_9ACTN/48-143     AC A0A1C4IE37.1
#=GS A0A453D6Z0_AEGTS/1-79       AC A0A453D6Z0.1
#=GS A0A3B6MT22_WHEAT/170-278    AC A0A3B6MT22.1
#=GS A0A3N4U092_9ACTN/48-141     AC A0A3N4U092.1
#=GS A0A1Y1UMI4_9TREE/63-147     AC A0A1Y1UMI4.1
#=GS F9WZK8_ZYMTI/29-116         AC F9WZK8.1
#=GS A0A445IJ75_GLYSO/47-134     AC A0A445IJ75.1
#=GS G4YJW0_PHYSP/154-259        AC G4YJW0.1
#=GS A0A2T7EIB6_9POAL/170-278    AC A0A2T7EIB6.1
#=GS A0A287PH98_HORVV/22-130     AC A0A287PH98.1
#=GS A0A0Q9B4F6_9ACTN/73-178     AC A0A0Q9B4F6.1
#=GS A0A329SKP7_9STRA/95-193     AC A0A329SKP7.1
#=GS X8CGV6_MYCIT/60-153         AC X8CGV6.1
#=GS A0A250X2B5_9CHLO/5-47       AC A0A250X2B5.1
#=GS D8LE49_ECTSI/164-278        AC D8LE49.1
#=GS K7LXJ7_SOYBN/67-178         AC K7LXJ7.1
#=GS A0A059BMC4_EUCGR/165-252    AC A0A059BMC4.1
#=GS A0A287EI94_HORVV/3-74       AC A0A287EI94.1
#=GS A0A2R7KY54_9SPHI/35-116     AC A0A2R7KY54.1
#=GS A0A1S4DIR5_TOBAC/168-276    AC A0A1S4DIR5.1
#=GS A0A2P7PY99_9ACTN/55-149     AC A0A2P7PY99.1
#=GS A0A078M3X7_9STAP/80-231     AC A0A078M3X7.1
#=GS A0A423XFT1_9PEZI/33-120     AC A0A423XFT1.1
#=GS A0A3B6LL30_WHEAT/85-203     AC A0A3B6LL30.1
#=GS A0A3L6PLL3_PANMI/40-131     AC A0A3L6PLL3.1
#=GS A0A409YDC4_9AGAR/37-127     AC A0A409YDC4.1
#=GS R0G573_9BRAS/57-148         AC R0G573.1
#=GS W2PQU2_PHYPN/95-193         AC W2PQU2.1
#=GS U2T819_LEIAQ/19-112         AC U2T819.1
#=GS A0A1U7ZUJ1_NELNU/169-277    AC A0A1U7ZUJ1.1
#=GS A0A1R3JF97_COCAP/171-279    AC A0A1R3JF97.1
#=GS A0A3Q0RBC2_AMPCI/118-205    AC A0A3Q0RBC2.1
#=GS A0A1Y3MX01_PIRSE/195-294    AC A0A1Y3MX01.1
#=GS A0A151I267_9HYME/131-220    AC A0A151I267.1
#=GS A0A1V9FMS0_9BACT/203-286    AC A0A1V9FMS0.1
#=GS A0A445G567_GLYSO/85-176     AC A0A445G567.1
#=GS A0A1U7W6Z9_NICSY/46-134     AC A0A1U7W6Z9.1
#=GS I2GL27_9BACT/31-127         AC I2GL27.1
#=GS A0A1L9VBR1_ASPGL/35-124     AC A0A1L9VBR1.1
#=GS A0A1R3L047_9ROSI/2-58       AC A0A1R3L047.1
#=GS R4LSU4_9ACTN/40-135         AC R4LSU4.1
#=GS A0A2T7EJN5_9POAL/55-146     AC A0A2T7EJN5.1
#=GS A0A1Y4RIY8_9FIRM/55-147     AC A0A1Y4RIY8.1
#=GS L1LZW1_PSEPU/38-134         AC L1LZW1.1
#=GS A0A167J0B9_CALVF/70-172     AC A0A167J0B9.1
#=GS A0A2N7VPK1_9BURK/56-152     AC A0A2N7VPK1.1
#=GS A0A453NAR6_AEGTS/1-80       AC A0A453NAR6.1
#=GS A0A0D2BAX9_9EURO/68-171     AC A0A0D2BAX9.1
#=GS V4RJD8_9ROSI/86-198         AC V4RJD8.1
#=GS Q10Q09_ORYSJ/172-280        AC Q10Q09.1
#=GS A0A1R3JMB4_9ROSI/62-153     AC A0A1R3JMB4.1
#=GS A0A2K8XNS5_9FLAO/52-161     AC A0A2K8XNS5.1
#=GS A0A1S3XQH6_TOBAC/60-151     AC A0A1S3XQH6.1
#=GS A0A0P0V8Z3_ORYSJ/1-87       AC A0A0P0V8Z3.1
#=GS A0A1E7K8D8_9ACTN/105-210    AC A0A1E7K8D8.1
#=GS A0A1U8AYA4_NELNU/50-141     AC A0A1U8AYA4.1
#=GS Q9VZ56_DROME/38-141         AC Q9VZ56.2
#=GS A0A075KBC7_9FIRM/38-129     AC A0A075KBC7.1
#=GS A0A2R6Q3B7_ACTCH/46-133     AC A0A2R6Q3B7.1
#=GS A0A2K8XNM2_9FLAO/24-110     AC A0A2K8XNM2.1
#=GS U4TRK2_DENPD/26-117         AC U4TRK2.1
#=GS A0A0Q3EIJ1_BRADI/166-274    AC A0A0Q3EIJ1.1
#=GS A0A1C5BRA3_9ACTN/223-316    AC A0A1C5BRA3.1
#=GS M9M127_PAEPP/37-137         AC M9M127.1
#=GS A0A1M6CNU8_9FLAO/21-112     AC A0A1M6CNU8.1
#=GS A0A1S3C514_CUCME/68-181     AC A0A1S3C514.1
#=GS A0A3B6KFK0_WHEAT/53-140     AC A0A3B6KFK0.1
#=GS A0A2G2ZHG4_CAPAN/144-247    AC A0A2G2ZHG4.1
#=GS A0A2G5F4P8_AQUCA/143-246    AC A0A2G5F4P8.1
#=GS A0A417PS02_9CLOT/67-159     AC A0A417PS02.1
#=GS A0A4P1QSE1_LUPAN/169-277    AC A0A4P1QSE1.1
#=GS A0A1I8GHM8_9PLAT/29-120     AC A0A1I8GHM8.1
#=GS A0A067GD80_CITSI/59-150     AC A0A067GD80.1
#=GS A0A1Y0IEK4_9GAMM/598-684    AC A0A1Y0IEK4.1
#=GS A0A0C2T2K3_AMAMU/1-87       AC A0A0C2T2K3.1
#=GS A0A314Y028_PRUYE/89-129     AC A0A314Y028.1
#=GS A0A3A5N177_9MICO/48-141     AC A0A3A5N177.1
#=GS A0A061FSS3_THECC/252-355    AC A0A061FSS3.1
#=GS A0A2M9EBX6_9GAMM/42-137     AC A0A2M9EBX6.1
#=GS A0A2R6QGD6_ACTCH/175-283    AC A0A2R6QGD6.1
#=GS A0A0K1Q8B7_9DELT/14-82      AC A0A0K1Q8B7.1
#=GS A0A397KW81_BRACM/52-149     AC A0A397KW81.1
#=GS M0YS05_HORVV/47-135         AC M0YS05.1
#=GS A0A1V0DGR2_9BACT/234-315    AC A0A1V0DGR2.1
#=GS A0A2G3BCE0_CAPCH/6-94       AC A0A2G3BCE0.1
#=GS A0A388LFV4_CHABU/218-321    AC A0A388LFV4.1
#=GS A0A348ALY0_9FIRM/53-150     AC A0A348ALY0.1
#=GS A0A287KQG4_HORVV/25-108     AC A0A287KQG4.1
#=GS A2R1M4_ASPNC/70-173         AC A2R1M4.1
#=GS R6SXH0_9BACE/32-130         AC R6SXH0.1
#=GS G4ZZW6_PHYSP/96-194         AC G4ZZW6.1
#=GS A0A1U7XDM9_NICSY/60-151     AC A0A1U7XDM9.1
#=GS A0A0M2GUF3_9ACTN/79-208     AC A0A0M2GUF3.1
#=GS A0A3B6SI68_WHEAT/135-248    AC A0A3B6SI68.1
#=GS A0A242K391_9ENTE/37-136     AC A0A242K391.1
#=GS A0A0M0G114_SPOGL/986-1092   AC A0A0M0G114.1
#=GS G3XQ08_ASPNA/70-173         AC G3XQ08.1
#=GS T1KXV2_TETUR/32-123         AC T1KXV2.2
#=GS A0A0E0AY17_9ORYZ/177-288    AC A0A0E0AY17.1
#=GS A0A2A2LRU6_9BILA/24-112     AC A0A2A2LRU6.1
#=GS A0A1S2Z1X7_CICAR/79-191     AC A0A1S2Z1X7.1
#=GS A0A453K9U8_AEGTS/1-86       AC A0A453K9U8.1
#=GS A0A445HTS1_GLYSO/62-153     AC A0A445HTS1.1
#=GS A0A1S3E8V6_CICAR/65-177     AC A0A1S3E8V6.1
#=GS A0A0C1Y224_9CYAN/48-162     AC A0A0C1Y224.1
#=GS D3BJ35_POLPP/15-114         AC D3BJ35.1
#=GS J3NEE7_ORYBR/165-273        AC J3NEE7.1
#=GS M1AD80_SOLTU/53-144         AC M1AD80.1
#=GS A0A162LLJ0_9ACTN/1-94       AC A0A162LLJ0.1
#=GS A0A1I3RR51_9SPHI/245-340    AC A0A1I3RR51.1
#=GS F6HKK1_VITVI/2-80           AC F6HKK1.1
#=GS A0A2G1XMF1_STRCJ/54-148     AC A0A2G1XMF1.1
#=GS D3BF43_POLPP/46-187         AC D3BF43.1
#=GS A0A345HUW5_9ACTN/79-184     AC A0A345HUW5.1
#=GS B4FKP7_MAIZE/52-139         AC B4FKP7.1
#=GS A0A1P9WWX7_9BACT/42-124     AC A0A1P9WWX7.1
#=GS D2RNV9_ACIFV/60-153         AC D2RNV9.1
#=GS A0A2G7ESS6_9ACTN/56-149     AC A0A2G7ESS6.1
#=GS A0A3B6KGB0_WHEAT/51-139     AC A0A3B6KGB0.1
#=GS A0A1B8WC10_9BACI/55-157     AC A0A1B8WC10.1
#=GS A0A1Y3MX08_PIRSE/188-291    AC A0A1Y3MX08.1
#=GS A0A0S3R6Y5_PHAAN/53-144     AC A0A0S3R6Y5.1
#=GS D0NUG4_PHYIT/1-83           AC D0NUG4.1
#=GS A0A3B6GX00_WHEAT/205-308    AC A0A3B6GX00.1
#=GS A0A2R6S2M0_ACTCH/52-143     AC A0A2R6S2M0.1
#=GS A0A2N5X6T3_9GAMM/55-141     AC A0A2N5X6T3.1
#=GS W2PUE4_PHYPN/1-82           AC W2PUE4.1
#=GS A0A2H5NCK4_CITUN/59-150     AC A0A2H5NCK4.1
#=GS A0A1B1MA95_STRLN/73-178     AC A0A1B1MA95.1
#=GS R6PJ75_9CLOT/19-110         AC R6PJ75.1
#=GS W2K0C2_PHYPR/208-314        AC W2K0C2.1
#=GS I1I8W6_BRADI/173-285        AC I1I8W6.1
#=GS A0A1G4W0G1_9FIRM/41-136     AC A0A1G4W0G1.1
#=GS A0A0U2N9Q7_9BACL/1076-1175  AC A0A0U2N9Q7.1
#=GS A0A1Y1XJ05_9FUNG/166-257    AC A0A1Y1XJ05.1
#=GS A0A3Q7J5N1_SOLLC/11-103     AC A0A3Q7J5N1.1
#=GS A0A090II36_9GAMM/225-311    AC A0A090II36.1
#=GS A0A1U7VAI1_NICSY/68-180     AC A0A1U7VAI1.1
#=GS A0A2P6VHX5_9CHLO/166-269    AC A0A2P6VHX5.1
#=GS ACP7_HUMAN/32-125           AC Q6ZNF0.2
#=GS A0A287R077_HORVV/102-220    AC A0A287R077.1
#=GS A0A314XJF9_PRUYE/10-70      AC A0A314XJF9.1
#=GS I1R438_ORYGL/55-142         AC I1R438.1
#=GS A0A2I4BIN5_9TELE/28-121     AC A0A2I4BIN5.1
#=GS A0A1P8XRS2_9ACTN/48-142     AC A0A1P8XRS2.1
#=GS A0A1D7VS89_9ACTN/63-168     AC A0A1D7VS89.1
#=GS A0A067FSP1_CITSI/169-277    AC A0A067FSP1.1
#=GS A0A2U9P1N8_STRAS/74-179     AC A0A2U9P1N8.1
#=GS A0A0D2E4L5_9EURO/69-172     AC A0A0D2E4L5.1
#=GS V4PJ70_9CAUL/53-154         AC V4PJ70.1
#=GS A0A183QH72_9TREM/30-137     AC A0A183QH72.1
#=GS A0A0E0GI82_ORYNI/66-157     AC A0A0E0GI82.1
#=GS G9N7D3_HYPVG/66-169         AC G9N7D3.1
#=GS S2Z186_9CORY/32-119         AC S2Z186.1
#=GS A0A0P0XNU8_ORYSJ/186-294    AC A0A0P0XNU8.1
#=GS V4UHD2_9ROSI/43-130         AC V4UHD2.1
#=GS A0A1Y2D212_9FUNG/151-241    AC A0A1Y2D212.1
#=GS A0A3B3YSN0_9TELE/28-121     AC A0A3B3YSN0.1
#=GS A0A2S9BQF9_9MICO/53-149     AC A0A2S9BQF9.1
#=GS A0A1H4CEF0_9BACT/30-124     AC A0A1H4CEF0.1
#=GS A0A059BLE4_EUCGR/1-75       AC A0A059BLE4.1
#=GS K9B9F6_9STAP/72-224         AC K9B9F6.1
#=GS A0A199UA04_MANES/49-136     AC A0A199UA04.1
#=GS A0A3Q0I4Q8_PHODC/70-182     AC A0A3Q0I4Q8.1
#=GS A0A1B6PD28_SORBI/64-157     AC A0A1B6PD28.1
#=GS A0A067LF84_JATCU/46-133     AC A0A067LF84.1
#=GS A0A316ELC0_9FLAO/56-162     AC A0A316ELC0.1
#=GS I1QLK5_ORYGL/177-288        AC I1QLK5.1
#=GS A0A415DXJ7_9BACT/269-364    AC A0A415DXJ7.1
#=GS A0A366R5Q9_9HYPO/109-210    AC A0A366R5Q9.1
#=GS A0A287S1W1_HORVV/67-180     AC A0A287S1W1.1
#=GS A0A0D2V8Z6_GOSRA/1-76       AC A0A0D2V8Z6.1
#=GS Q0AVG7_SYNWW/44-137         AC Q0AVG7.1
#=GS J0N5M6_9CLOT/56-152         AC J0N5M6.1
#=GS J3N632_ORYBR/1-75           AC J3N632.1
#=GS B1BZV7_9FIRM/238-330        AC B1BZV7.1
#=GS A0A1Z5SQM7_HORWE/70-174     AC A0A1Z5SQM7.1
#=GS N1S1R9_FUSC4/70-173         AC N1S1R9.1
#=GS A0A453T6U0_AEGTS/55-125     AC A0A453T6U0.1
#=GS A0A0E0MCI6_ORYPU/139-227    AC A0A0E0MCI6.1
#=GS A0A1B6PF13_SORBI/73-166     AC A0A1B6PF13.1
#=GS A0A2C9JIZ3_BIOGL/30-122     AC A0A2C9JIZ3.1
#=GS A0A0D9WSJ1_9ORYZ/133-224    AC A0A0D9WSJ1.1
#=GS A0A2N5N0S5_9BACL/229-341    AC A0A2N5N0S5.1
#=GS M4DT62_BRARP/176-285        AC M4DT62.1
#=GS A0A2G5TG67_9PELO/21-104     AC A0A2G5TG67.1
#=GS A0A2P5DFV2_TREOI/116-224    AC A0A2P5DFV2.1
#=GS A0A395MWK9_9HYPO/27-115     AC A0A395MWK9.1
#=GS A0A1A5YTE1_9BACL/598-704    AC A0A1A5YTE1.1
#=GS A0A2G3BW56_CAPCH/14-78      AC A0A2G3BW56.1
#=GS A0A498I6L6_MALDO/180-288    AC A0A498I6L6.1
#=GS A0A2Y9ASE9_9MICO/64-161     AC A0A2Y9ASE9.1
#=GS A0A059ANQ1_EUCGR/68-159     AC A0A059ANQ1.1
#=GS A0A1S3DYU7_CICAR/116-224    AC A0A1S3DYU7.1
#=GS A0A3Q7HZC0_SOLLC/1-76       AC A0A3Q7HZC0.1
#=GS A0A1Y3MUE5_PIRSE/1-100      AC A0A1Y3MUE5.1
#=GS A0A0P1AKJ6_PLAHL/86-192     AC A0A0P1AKJ6.1
#=GS A0A067DW36_CITSI/2-102      AC A0A067DW36.1
#=GS T1LMZ2_TRIUA/160-269        AC T1LMZ2.1
#=GS A0A2V3JQC5_9EURY/544-631    AC A0A2V3JQC5.1
#=GS A0A1U8GAY3_CAPAN/60-151     AC A0A1U8GAY3.1
#=GS A0A251V2W9_HELAN/60-151     AC A0A251V2W9.1
#=GS A0A383VSN8_TETOB/161-263    AC A0A383VSN8.1
#=GS A0A287PGX7_HORVV/85-193     AC A0A287PGX7.1
#=GS A0A345HN20_9ACTN/76-178     AC A0A345HN20.1
#=GS A0A371FZ86_MUCPR/169-277    AC A0A371FZ86.1
#=GS A0A2P5EC92_TREOI/55-142     AC A0A2P5EC92.1
#=GS A0A0M3CFJ3_9SPHI/38-135     AC A0A0M3CFJ3.1
#=GS A0A1Y3N1A2_PIRSE/52-159     AC A0A1Y3N1A2.1
#=GS A0A075K6R6_9FIRM/39-135     AC A0A075K6R6.1
#=GS R5YAM8_9FIRM/62-155         AC R5YAM8.1
#=GS A0A428TYU1_9HYPO/5-100      AC A0A428TYU1.1
#=GS A0A061EK97_THECC/643-755    AC A0A061EK97.1
#=GS A0A1K1PT88_SELRU/42-131     AC A0A1K1PT88.1
#=GS A0A2D3V946_9PEZI/80-184     AC A0A2D3V946.1
#=GS A0A0D3D354_BRAOL/54-148     AC A0A0D3D354.1
#=GS A0A176J5D3_9BACI/1115-1215  AC A0A176J5D3.1
#=GS A0A452ZW22_AEGTS/79-192     AC A0A452ZW22.1
#=GS A0A167QME1_9HYPO/73-174     AC A0A167QME1.1
#=GS A0A452S774_URSAM/28-117     AC A0A452S774.1
#=GS A0A2P6NST0_9MYCE/38-133     AC A0A2P6NST0.1
#=GS A0A2K9PKI4_9FLAO/22-114     AC A0A2K9PKI4.1
#=GS I1PL09_ORYGL/52-141         AC I1PL09.1
#=GS A0A0X3SMJ8_9ACTN/66-183     AC A0A0X3SMJ8.1
#=GS A0A2T4ABT7_TRIHA/22-112     AC A0A2T4ABT7.1
#=GS A0A1L9U7H7_ASPBC/1-77       AC A0A1L9U7H7.1
#=GS A0A225WZ84_9STRA/183-289    AC A0A225WZ84.1
#=GS A0A445A6Q5_ARAHY/64-156     AC A0A445A6Q5.1
#=GS A0A1Q3D2K1_CEPFO/70-161     AC A0A1Q3D2K1.1
#=GS A0A251U9Q9_HELAN/101-216    AC A0A251U9Q9.1
#=GS A0A1W4V154_DROFC/34-128     AC A0A1W4V154.1
#=GS A0A078JJN4_BRANA/76-187     AC A0A078JJN4.1
#=GS A0A0K0EAF3_STRER/25-113     AC A0A0K0EAF3.1
#=GS V4SW87_9ROSI/216-319        AC V4SW87.1
#=GS A0A2U1PCC0_ARTAN/52-139     AC A0A2U1PCC0.1
#=GS A0A2M9JV36_9ACTN/77-182     AC A0A2M9JV36.1
#=GS G7L615_MEDTR/54-141         AC G7L615.1
#=GS A0A1R3IY57_COCAP/60-151     AC A0A1R3IY57.1
#=GS D6K1I5_9ACTN/83-188         AC D6K1I5.1
#=GS R4K6T8_CLOPA/49-144         AC R4K6T8.1
#=GS A0A287LTF1_HORVV/91-194     AC A0A287LTF1.1
#=GS A0A059BMI9_EUCGR/44-131     AC A0A059BMI9.1
#=GS H3GBF7_PHYRM/67-161         AC H3GBF7.1
#=GS A0A1R3J1D7_9ROSI/76-188     AC A0A1R3J1D7.1
#=GS A0A060WH96_ONCMY/29-123     AC A0A060WH96.1
#=GS A0A445FM29_GLYSO/94-206     AC A0A445FM29.1
#=GS A0A2P9HA73_PARUW/45-133     AC A0A2P9HA73.1
#=GS A0A0N4YBN9_NIPBR/40-134     AC A0A0N4YBN9.1
#=GS A0A3M2RJ04_9HYPO/33-122     AC A0A3M2RJ04.1
#=GS F2DF56_HORVV/68-181         AC F2DF56.1
#=GS I1IXG9_BRADI/49-136         AC I1IXG9.1
#=GS A0A1Y1XJ07_9FUNG/96-187     AC A0A1Y1XJ07.1
#=GS A0A024TI22_9STRA/80-177     AC A0A024TI22.1
#=GS M4F3X6_BRARP/43-130         AC M4F3X6.1
#=GS A0A2P6NA57_9MYCE/61-149     AC A0A2P6NA57.1
#=GS A0A1Y1VM23_9FUNG/173-271    AC A0A1Y1VM23.1
#=GS R6BPC8_9FIRM/75-172         AC R6BPC8.1
#=GS A0A061EBE6_THECC/176-284    AC A0A061EBE6.1
#=GS A0A498KEC8_MALDO/64-155     AC A0A498KEC8.1
#=GS A0A2H5NWK6_CITUN/189-292    AC A0A2H5NWK6.1
#=GS A0A1H9L4N7_9SPHN/41-138     AC A0A1H9L4N7.1
#=GS D8SYQ0_SELML/73-183         AC D8SYQ0.1
#=GS M0ZS86_SOLTU/47-135         AC M0ZS86.1
#=GS W2RI01_PHYPN/62-159         AC W2RI01.1
#=GS A0A0F7U1T8_9EURO/34-123     AC A0A0F7U1T8.1
#=GS A0A166ES63_DAUCS/52-139     AC A0A166ES63.1
#=GS M2XXL8_GALSU/129-244        AC M2XXL8.1
#=GS G7KLC0_MEDTR/71-182         AC G7KLC0.2
#=GS L8G379_PSED2/35-128         AC L8G379.1
#=GS A0A0K9PZI5_ZOSMR/149-253    AC A0A0K9PZI5.1
#=GS B9RGF7_RICCO/220-322        AC B9RGF7.1
#=GS A0A3B6DL92_WHEAT/145-236    AC A0A3B6DL92.1
#=GS A0A3R7H1C5_9STRA/72-170     AC A0A3R7H1C5.1
#=GS A0A1Y3N6J5_PIRSE/46-144     AC A0A1Y3N6J5.1
#=GS A0A2V3JQC5_9EURY/640-727    AC A0A2V3JQC5.1
#=GS A0A327X3D2_9BACT/37-133     AC A0A327X3D2.1
#=GS A0A1T2XAT8_9BACL/313-421    AC A0A1T2XAT8.1
#=GS A0A3M7RSU3_BRAPC/36-128     AC A0A3M7RSU3.1
#=GS C0PDY0_MAIZE/66-179         AC C0PDY0.1
#=GS B4L6R8_DROMO/1-95           AC B4L6R8.2
#=GS A0A1M4XAZ9_9FIRM/60-152     AC A0A1M4XAZ9.1
#=GS Q86IH2_DICDI/184-299        AC Q86IH2.1
#=GS W4FTY6_9STRA/128-237        AC W4FTY6.1
#=GS Q741N5_MYCPA/69-162         AC Q741N5.1
#=GS A0A0A0MW17_PAPAN/32-125     AC A0A0A0MW17.2
#=GS A0A1I8N4S5_MUSDO/33-126     AC A0A1I8N4S5.1
#=GS A0A0D2W8U8_GOSRA/56-147     AC A0A0D2W8U8.1
#=GS A0A3B6LPL1_WHEAT/173-281    AC A0A3B6LPL1.1
#=GS S2XLY7_9BACL/483-586        AC S2XLY7.1
#=GS V6MGX3_9BACL/38-138         AC V6MGX3.1
#=GS V7AEU9_PHAVU/54-145         AC V7AEU9.1
#=GS A0A394DKZ0_LUPAN/57-148     AC A0A394DKZ0.1
#=GS A0A1S2R3M2_9BACI/52-153     AC A0A1S2R3M2.1
#=GS A0A0C1MXN9_9CYAN/19-103     AC A0A0C1MXN9.1
#=GS A0A1Q4YI80_9ACTN/82-210     AC A0A1Q4YI80.1
#=GS A0A3Q8WSD5_9ACTO/68-187     AC A0A3Q8WSD5.1
#=GS B9RHA3_RICCO/58-149         AC B9RHA3.1
#=GS W2Q499_PHYPN/198-304        AC W2Q499.1
#=GS L7F9E2_9ACTN/77-193         AC L7F9E2.1
#=GS A0A1H5NS10_9ACTN/74-179     AC A0A1H5NS10.1
#=GS A0A2G3CRK9_CAPCH/72-184     AC A0A2G3CRK9.1
#=GS A0A1S3Y2F4_TOBAC/52-143     AC A0A1S3Y2F4.1
#=GS A0A445AVY5_ARAHY/53-144     AC A0A445AVY5.1
#=GS M0SE93_MUSAM/55-146         AC M0SE93.1
#=GS Q5BAS0_EMENI/33-121         AC Q5BAS0.1
#=GS A0A1I6MS20_9GAMM/58-151     AC A0A1I6MS20.1
#=GS A0A402CXZ2_9BACT/51-147     AC A0A402CXZ2.1
#=GS A0A443P8J2_9MAGN/68-180     AC A0A443P8J2.1
#=GS H3GMG0_PHYRM/183-288        AC H3GMG0.1
#=GS A0A2A2LRT7_9BILA/24-111     AC A0A2A2LRT7.1
#=GS A0A182R6C0_ANOFN/29-120     AC A0A182R6C0.2
#=GS A0A397YF88_BRACM/143-246    AC A0A397YF88.1
#=GS A0A2P5DVU0_TREOI/53-145     AC A0A2P5DVU0.1
#=GS G3J4A5_CORMM/73-174         AC G3J4A5.1
#=GS A0A2U1NDU4_ARTAN/193-301    AC A0A2U1NDU4.1
#=GS M4F891_BRARP/61-152         AC M4F891.1
#=GS R6DVD1_9FIRM/34-128         AC R6DVD1.1
#=GS A0A1B8D8V6_9PEZI/39-130     AC A0A1B8D8V6.1
#=GS A0A329SP97_9STRA/89-187     AC A0A329SP97.1
#=GS A0A2K5WEH9_MACFA/32-125     AC A0A2K5WEH9.1
#=GS A0A087SN34_AUXPR/76-188     AC A0A087SN34.1
#=GS A0A0L8HI16_OCTBM/36-138     AC A0A0L8HI16.1
#=GS Q9U309_CAEEL/22-117         AC Q9U309.1
#=GS A0A3E0WQF6_9GAMM/55-151     AC A0A3E0WQF6.1
#=GS A0A2I0N244_9CLOT/81-228     AC A0A2I0N244.1
#=GS A0A0E3WGT0_9BACL/607-706    AC A0A0E3WGT0.1
#=GS V4UUX0_9ROSI/87-174         AC V4UUX0.1
#=GS A0A3B4CUR1_PYGNA/28-121     AC A0A3B4CUR1.1
#=GS A0A2I4ERF6_JUGRE/57-151     AC A0A2I4ERF6.1
#=GS A0A1T5ATP6_9BACT/40-136     AC A0A1T5ATP6.1
#=GS A0A1J7H7L8_LUPAN/176-276    AC A0A1J7H7L8.1
#=GS A0A314UKH0_PRUYE/49-136     AC A0A314UKH0.1
#=GS A0A495CX99_9MYCO/255-346    AC A0A495CX99.1
#=GS A0A2B8B5J2_9ACTN/63-168     AC A0A2B8B5J2.1
#=GS A0A168LPI5_9BACL/528-625    AC A0A168LPI5.1
#=GS A0A0J7XZ74_9SPHN/38-134     AC A0A0J7XZ74.1
#=GS H9JFJ6_BOMMO/807-898        AC H9JFJ6.1
#=GS A0A433Y874_9BACL/337-447    AC A0A433Y874.1
#=GS A0A166GFG1_DAUCS/56-147     AC A0A166GFG1.1
#=GS A0A0S6XU45_9FUNG/37-124     AC A0A0S6XU45.1
#=GS A0A1G7E6I7_9ACTN/35-154     AC A0A1G7E6I7.1
#=GS D2W3L7_NAEGR/22-122         AC D2W3L7.1
#=GS A0A2J6PR38_9HELO/35-119     AC A0A2J6PR38.1
#=GS A0A2P5B100_PARAD/47-133     AC A0A2P5B100.1
#=GS V4MED8_EUTSA/58-148         AC V4MED8.1
#=GS A0A1Y3MX13_PIRSE/98-198     AC A0A1Y3MX13.1
#=GS V9GH45_9BACL/51-148         AC V9GH45.1
#=GS A0A1Y2B2J4_9TREE/50-143     AC A0A1Y2B2J4.1
#=GS A0A1U7Z037_NICSY/52-145     AC A0A1U7Z037.1
#=GS Q2QLL9_ORYSJ/59-150         AC Q2QLL9.1
#=GS A0A445K496_GLYSO/64-155     AC A0A445K496.1
#=GS A0A0P1B5P9_PLAHL/91-188     AC A0A0P1B5P9.1
#=GS A0A3L6PVY2_PANMI/48-135     AC A0A3L6PVY2.1
#=GS A0A0S9E0F3_9MICO/55-154     AC A0A0S9E0F3.1
#=GS M4BKT0_HYAAE/50-165         AC M4BKT0.1
#=GS A0A2P4ZK50_9HYPO/34-120     AC A0A2P4ZK50.1
#=GS W2PP21_PHYPN/100-198        AC W2PP21.1
#=GS A0A445C3I4_ARAHY/51-141     AC A0A445C3I4.1
#=GS A0A3B6KQZ0_WHEAT/52-144     AC A0A3B6KQZ0.1
#=GS A0A3B6KFY2_WHEAT/84-203     AC A0A3B6KFY2.1
#=GS A0A150ARJ3_9BACT/7-99       AC A0A150ARJ3.1
#=GS A0A1I3RMQ8_9SPHI/49-146     AC A0A1I3RMQ8.1
#=GS A0A061FJT8_THECC/836-939    AC A0A061FJT8.1
#=GS T0R9R0_SAPDV/191-284        AC T0R9R0.1
#=GS A0A3G3GR81_9BACT/36-133     AC A0A3G3GR81.1
#=GS B4NC50_DROWI/33-137         AC B4NC50.1
#=GS A0A1H4YWF6_9ACTN/78-183     AC A0A1H4YWF6.1
#=GS G4KSE0_OSCVS/43-140         AC G4KSE0.1
#=GS M7Z1G0_TRIUA/47-134         AC M7Z1G0.1
#=GS A0A3N7G463_POPTR/2-63       AC A0A3N7G463.1
#=GS R5KYY3_9FIRM/75-172         AC R5KYY3.1
#=GS A0A1P8RTV3_9FLAO/7-87       AC A0A1P8RTV3.1
#=GS A0A1R3RGI6_ASPC5/33-122     AC A0A1R3RGI6.1
#=GS A0A0F7TXJ3_9EURO/35-122     AC A0A0F7TXJ3.1
#=GS A0A287PHX0_HORVV/115-223    AC A0A287PHX0.1
#=GS L1JM98_GUITC/263-382        AC L1JM98.1
#=GS A0A2R6R6S1_ACTCH/56-147     AC A0A2R6R6S1.1
#=GS M5XBB0_PRUPE/169-276        AC M5XBB0.1
#=GS A0A1Y1XIZ8_9FUNG/170-261    AC A0A1Y1XIZ8.1
#=GS A0A0D9Y0R6_9ORYZ/965-1073   AC A0A0D9Y0R6.1
#=GS A0A1U8A0D2_NELNU/149-252    AC A0A1U8A0D2.1
#=GS A0A1X7VAQ1_AMPQE/641-732    AC A0A1X7VAQ1.1
#=GS E0VL88_PEDHC/34-125         AC E0VL88.1
#=GS A0A2P6P4Z8_ROSCH/73-181     AC A0A2P6P4Z8.1
#=GS A0A0C2T9S2_AMAMU/1-87       AC A0A0C2T9S2.1
#=GS A0A2T7EJP8_9POAL/62-153     AC A0A2T7EJP8.1
#=GS A0A1I1UKW4_9BACT/30-111     AC A0A1I1UKW4.1
#=GS A0A0Q4GQC0_9SPHI/34-118     AC A0A0Q4GQC0.1
#=GS D1BCR8_SANKS/243-337        AC D1BCR8.1
#=GS A0A0E0GWH5_ORYNI/63-176     AC A0A0E0GWH5.1
#=GS V6K1W2_STRRC/74-179         AC V6K1W2.1
#=GS A0A0W8C569_PHYNI/61-158     AC A0A0W8C569.1
#=GS A0A287JGF6_HORVV/9-99       AC A0A287JGF6.2
#=GS A0A1X2IF19_9FUNG/56-161     AC A0A1X2IF19.1
#=GS A0A2U1T8Y9_9CORY/49-146     AC A0A2U1T8Y9.1
#=GS C5XWK4_SORBI/144-251        AC C5XWK4.1
#=GS A0A259UF05_9FIRM/35-131     AC A0A259UF05.1
#=GS A0A0E0C8W0_9ORYZ/205-308    AC A0A0E0C8W0.1
#=GS A0A194YKI3_SORBI/55-145     AC A0A194YKI3.1
#=GS A0A2R6QGE0_ACTCH/195-303    AC A0A2R6QGE0.1
#=GS A0A061GP98_THECC/62-153     AC A0A061GP98.1
#=GS A0A287EIF1_HORVV/45-138     AC A0A287EIF1.1
#=GS A0A0U1NTY1_9BACI/987-1091   AC A0A0U1NTY1.1
#=GS A0A2T3A1I7_9PEZI/34-123     AC A0A2T3A1I7.1
#=GS A0A453ELN7_AEGTS/64-177     AC A0A453ELN7.1
#=GS A0A0L8GF81_OCTBM/45-135     AC A0A0L8GF81.1
#=GS A0A498JX87_MALDO/76-188     AC A0A498JX87.1
#=GS A0A2C9UD23_MANES/96-208     AC A0A2C9UD23.1
#=GS A0A2K6QR20_RHIRO/32-125     AC A0A2K6QR20.1
#=GS A0A445JLN8_GLYSO/173-281    AC A0A445JLN8.1
#=GS I1RKT7_GIBZE/34-123         AC I1RKT7.1
#=GS A0A1B8GKV0_9PEZI/35-121     AC A0A1B8GKV0.1
#=GS A0A2C9JWK9_BIOGL/49-141     AC A0A2C9JWK9.1
#=GS A0A1I3V3H7_9FLAO/19-110     AC A0A1I3V3H7.1
#=GS A0A453K9Y9_AEGTS/108-196    AC A0A453K9Y9.1
#=GS A0A484E649_BRELC/98-196     AC A0A484E649.1
#=GS A0A2H5PDF4_CITUN/78-189     AC A0A2H5PDF4.1
#=GS A0A0P1AG99_PLAHL/189-295    AC A0A0P1AG99.1
#=GS T1GWM5_MEGSC/169-258        AC T1GWM5.1
#=GS A0A0B8PU02_9VIBR/64-150     AC A0A0B8PU02.1
#=GS A0A1U7YY54_NELNU/50-137     AC A0A1U7YY54.1
#=GS K0JZC5_SACES/44-134         AC K0JZC5.1
#=GS I4DHV7_ORYSJ/173-281        AC I4DHV7.1
#=GS A0A2G2YIL1_CAPAN/47-135     AC A0A2G2YIL1.1
#=GS A0A0D3FKI8_9ORYZ/68-155     AC A0A0D3FKI8.1
#=GS G0RHA2_HYPJQ/34-120         AC G0RHA2.1
#=GS E3JBW9_FRAIE/51-145         AC E3JBW9.1
#=GS A0A1U8A995_NELNU/148-251    AC A0A1U8A995.1
#=GS PPA11_ARATH/54-130          AC Q9SI18.1
#=GS A0A3B6KRJ1_WHEAT/52-144     AC A0A3B6KRJ1.1
#=GS D7MBM6_ARALL/51-147         AC D7MBM6.1
#=GS A0A0E4A090_9BACT/31-127     AC A0A0E4A090.1
#=GS A0A1H9C927_9FLAO/125-217    AC A0A1H9C927.1
#=GS F6W4G5_ORNAN/8-147          AC F6W4G5.1
#=GS A0A0D2P079_GOSRA/169-277    AC A0A0D2P079.1
#=GS A0A287WJP8_HORVV/70-184     AC A0A287WJP8.1
#=GS R4KAZ7_9FIRM/35-142         AC R4KAZ7.1
#=GS K3Z5V8_SETIT/66-157         AC K3Z5V8.1
#=GS A0A319BTH6_ASPLB/70-173     AC A0A319BTH6.1
#=GS A0A068TL08_COFCA/62-153     AC A0A068TL08.1
#=GS A0A453JV22_AEGTS/65-157     AC A0A453JV22.1
#=GS A0A2U1KAK7_ARTAN/54-145     AC A0A2U1KAK7.1
#=GS A0A1U8B5R1_NELNU/63-154     AC A0A1U8B5R1.1
#=GS A0A2M9BU58_9MICO/55-152     AC A0A2M9BU58.1
#=GS A0A074KWP3_9BACT/38-123     AC A0A074KWP3.1
#=GS A0A1S3BB33_CUCME/60-151     AC A0A1S3BB33.1
#=GS A0A0G3GWR7_9CORY/33-122     AC A0A0G3GWR7.1
#=GS A0A2M9D194_9CELL/239-332    AC A0A2M9D194.1
#=GS C5XMG6_SORBI/208-311        AC C5XMG6.1
#=GS A0A380NLM6_9FIRM/53-149     AC A0A380NLM6.1
#=GS A0A1H4DZI4_ALKAM/41-137     AC A0A1H4DZI4.1
#=GS A0A0R0AZW9_9GAMM/39-134     AC A0A0R0AZW9.1
#=GS A0A177URJ3_9BASI/32-132     AC A0A177URJ3.1
#=GS A0A1A6HIW6_NEOLE/4-96       AC A0A1A6HIW6.1
#=GS A0A3S3R5K4_9MAGN/55-147     AC A0A3S3R5K4.1
#=GS A0A3L6T8K7_PANMI/149-254    AC A0A3L6T8K7.1
#=GS A0A1Q3BZ96_CEPFO/63-154     AC A0A1Q3BZ96.1
#=GS A0A453L801_AEGTS/212-320    AC A0A453L801.1
#=GS A0A1S3AW88_CUCME/65-176     AC A0A1S3AW88.1
#=GS G7JA61_MEDTR/71-183         AC G7JA61.2
#=GS A0A1S8TMI9_9CLOT/52-140     AC A0A1S8TMI9.1
#=GS A0A087STP1_AUXPR/149-255    AC A0A087STP1.1
#=GS A0A067DIL4_CITSI/86-198     AC A0A067DIL4.1
#=GS A0A0D3HIB6_9ORYZ/56-143     AC A0A0D3HIB6.1
#=GS M4EDN0_BRARP/178-286        AC M4EDN0.1
#=GS A0A0L9TR24_PHAAN/53-144     AC A0A0L9TR24.1
#=GS A0A1W4UNP3_DROFC/34-137     AC A0A1W4UNP3.1
#=GS A0A495W1Y4_9PSEU/46-136     AC A0A495W1Y4.1
#=GS Q6ZI95_ORYSJ/177-288        AC Q6ZI95.1
#=GS A0A1S1MQ45_9GAMM/25-111     AC A0A1S1MQ45.1
#=GS R7C6Z3_9CLOT/1-91           AC R7C6Z3.1
#=GS A0A397YVR5_BRACM/176-284    AC A0A397YVR5.1
#=GS A0A2B4RMF1_STYPI/20-120     AC A0A2B4RMF1.1
#=GS A0A445HIX3_GLYSO/217-319    AC A0A445HIX3.1
#=GS A0A2T7DWR8_9POAL/147-252    AC A0A2T7DWR8.1
#=GS A0A0D2U3R3_GOSRA/58-149     AC A0A0D2U3R3.1
#=GS A0A383VVS5_TETOB/161-263    AC A0A383VVS5.1
#=GS A0A162J1R6_9PEZI/70-173     AC A0A162J1R6.1
#=GS A0A1V6TN32_9EURO/78-168     AC A0A1V6TN32.1
#=GS Q0AVJ0_SYNWW/46-138         AC Q0AVJ0.1
#=GS J3NEE8_ORYBR/176-284        AC J3NEE8.1
#=GS A0A3B6B726_WHEAT/153-244    AC A0A3B6B726.1
#=GS A0A317ZPG2_9BACT/194-288    AC A0A317ZPG2.1
#=GS A0A445LE90_GLYSO/100-187    AC A0A445LE90.1
#=GS A0A2P6PPR6_ROSCH/66-156     AC A0A2P6PPR6.1
#=GS A0A1X1R9G3_9MYCO/57-150     AC A0A1X1R9G3.1
#=GS A0A2V5I7F7_9EURO/33-122     AC A0A2V5I7F7.1
#=GS F7BW71_CALJA/32-125         AC F7BW71.2
#=GS A0A178IM58_9BACT/242-344    AC A0A178IM58.1
#=GS A0A498JUN8_MALDO/54-144     AC A0A498JUN8.1
#=GS A0A226DQZ9_FOLCA/47-144     AC A0A226DQZ9.1
#=GS F4KTN8_HALH1/29-118         AC F4KTN8.1
#=GS A0A195ESY8_9HYME/25-116     AC A0A195ESY8.1
#=GS A0A1J4N2H5_9ACTN/52-140     AC A0A1J4N2H5.1
#=GS A0A1I4PGB1_9BACI/474-582    AC A0A1I4PGB1.1
#=GS A0A3B6SP24_WHEAT/86-177     AC A0A3B6SP24.1
#=GS W9R991_9ROSA/54-165         AC W9R991.1
#=GS A0A2K5WEP7_MACFA/32-125     AC A0A2K5WEP7.1
#=GS A0A067S7A9_GALM3/38-128     AC A0A067S7A9.1
#=GS A0A2H3YLJ6_PHODC/74-186     AC A0A2H3YLJ6.1
#=GS A0A1S3UE64_VIGRR/74-185     AC A0A1S3UE64.1
#=GS A0A194RHJ9_PAPMA/33-124     AC A0A194RHJ9.1
#=GS A4JNY0_BURVG/94-190         AC A4JNY0.1
#=GS J1K108_9RHIZ/72-218         AC J1K108.1
#=GS D7MHN1_ARALL/53-144         AC D7MHN1.1
#=GS A0A1G6JIF4_9ACTN/54-152     AC A0A1G6JIF4.1
#=GS A0A1H6YE31_9BACT/41-137     AC A0A1H6YE31.1
#=GS A0A2R8MNE9_CALJA/32-125     AC A0A2R8MNE9.1
#=GS M1BIV5_SOLTU/218-320        AC M1BIV5.1
#=GS A0A135LQ40_PENPA/21-108     AC A0A135LQ40.1
#=GS A0A2G9IAZ2_9LAMI/60-149     AC A0A2G9IAZ2.1
#=GS A0A0F4Z5N0_TALEM/29-116     AC A0A0F4Z5N0.1
#=GS A0A1Q3C7H5_CEPFO/214-317    AC A0A1Q3C7H5.1
#=GS Q9VZ57_DROME/38-131         AC Q9VZ57.1
#=GS A0A072VTY2_MEDTR/194-297    AC A0A072VTY2.1
#=GS A0A238UBZ3_9FLAO/22-113     AC A0A238UBZ3.1
#=GS A0A146FAQ4_9EURO/70-173     AC A0A146FAQ4.1
#=GS A0A1S3HBI2_LINUN/1-78       AC A0A1S3HBI2.1
#=GS L5KMS2_PTEAL/35-128         AC L5KMS2.1
#=GS A0A1J6J0Z1_NICAT/168-276    AC A0A1J6J0Z1.1
#=GS A0A1R3HVI2_COCAP/58-149     AC A0A1R3HVI2.1
#=GS A0A364L3F8_9EURO/36-125     AC A0A364L3F8.1
#=GS A0A3P8NDD8_ASTCA/28-121     AC A0A3P8NDD8.1
#=GS W2PUM3_PHYPN/243-349        AC W2PUM3.1
#=GS A0A0N5BAV9_STREA/79-175     AC A0A0N5BAV9.1
#=GS A0A3B3XH88_9TELE/47-140     AC A0A3B3XH88.1
#=GS A0A199VUQ9_ANACO/73-185     AC A0A199VUQ9.1
#=GS A0A1B6PDP5_SORBI/168-276    AC A0A1B6PDP5.1
#=GS A0A1V1YVZ6_9ACTN/1-92       AC A0A1V1YVZ6.1
#=GS A0A0E0ACE9_9ORYZ/54-145     AC A0A0E0ACE9.1
#=GS A0A0S3R5Z5_PHAAN/181-289    AC A0A0S3R5Z5.1
#=GS A0A251MVB7_PRUPE/17-107     AC A0A251MVB7.1
#=GS A0A239MFS3_9ACTN/35-146     AC A0A239MFS3.1
#=GS A0A453KM01_AEGTS/1-108      AC A0A453KM01.1
#=GS A0A2C9TZS4_MANES/55-146     AC A0A2C9TZS4.1
#=GS A0A0D2SRI8_GOSRA/231-339    AC A0A0D2SRI8.1
#=GS A0A453KAJ5_AEGTS/96-184     AC A0A453KAJ5.1
#=GS A0A0D3DXG6_BRAOL/145-248    AC A0A0D3DXG6.1
#=GS A0A0D9VVS2_9ORYZ/92-179     AC A0A0D9VVS2.1
#=GS A0A3M6TYY5_9CNID/735-838    AC A0A3M6TYY5.1
#=GS B8BJ51_ORYSI/56-144         AC B8BJ51.1
#=GS A0A0D9ZFS8_9ORYZ/8-89       AC A0A0D9ZFS8.1
#=GS A0A1K1MDT2_9FLAO/25-114     AC A0A1K1MDT2.1
#=GS A0A3B6TIV9_WHEAT/171-281    AC A0A3B6TIV9.1
#=GS A0A2N5N3J0_9BACL/1012-1111  AC A0A2N5N3J0.1
#=GS M4EZR4_BRARP/60-151         AC M4EZR4.1
#=GS A0A3E2NFY0_9CLOT/56-145     AC A0A3E2NFY0.1
#=GS A0A1X2BVT9_9MYCO/55-148     AC A0A1X2BVT9.1
#=GS A0A3L6Q9I5_PANMI/50-137     AC A0A3L6Q9I5.1
#=GS I1R436_ORYGL/52-145         AC I1R436.1
#=GS A0A2U1ZSH8_9MICO/242-336    AC A0A2U1ZSH8.1
#=GS M0SF11_MUSAM/170-278        AC M0SF11.1
#=GS A0A453JWI8_AEGTS/15-123     AC A0A453JWI8.1
#=GS A0A3B6MNQ7_WHEAT/51-139     AC A0A3B6MNQ7.1
#=GS A0A3L6TMS2_PANMI/108-179    AC A0A3L6TMS2.1
#=GS A0A365ZZG3_9ACTN/56-158     AC A0A365ZZG3.1
#=GS A0A1R3HNG7_9ROSI/138-242    AC A0A1R3HNG7.1
#=GS B4M7R1_DROVI/46-140         AC B4M7R1.2
#=GS A0A0U3PNR7_9ACTN/80-185     AC A0A0U3PNR7.1
#=GS A0A0E0HU24_ORYNI/77-168     AC A0A0E0HU24.1
#=GS A0A251PC88_PRUPE/175-283    AC A0A251PC88.1
#=GS A0A3G9JY10_9FIRM/64-159     AC A0A3G9JY10.1
#=GS A0A2J6KWQ2_LACSA/185-293    AC A0A2J6KWQ2.1
#=GS D3B6U1_POLPP/32-129         AC D3B6U1.1
#=GS A0A0L9ULM6_PHAAN/50-142     AC A0A0L9ULM6.1
#=GS A0A3S9SZ96_9FIRM/27-117     AC A0A3S9SZ96.1
#=GS D7KQJ7_ARALL/142-250        AC D7KQJ7.1
#=GS C5XLM4_SORBI/68-159         AC C5XLM4.1
#=GS D0N2Z3_PHYIT/189-293        AC D0N2Z3.1
#=GS A0A1H6W7B1_9FIRM/62-151     AC A0A1H6W7B1.1
#=GS A0A1D6KE94_MAIZE/174-282    AC A0A1D6KE94.1
#=GS R6VHZ9_9BACT/29-128         AC R6VHZ9.1
#=GS A0A1I7SZL4_9PELO/18-101     AC A0A1I7SZL4.1
#=GS A0A1G5BMM1_9ACTN/48-143     AC A0A1G5BMM1.1
#=GS D7T9W8_VITVI/229-337        AC D7T9W8.1
#=GS A0A117RZF8_9ACTN/90-195     AC A0A117RZF8.1
#=GS A0A287LQW0_HORVV/8-99       AC A0A287LQW0.1
#=GS A0A1G7ANU9_9ACTN/73-168     AC A0A1G7ANU9.1
#=GS A0A0L0QLN7_VIRPA/700-799    AC A0A0L0QLN7.1
#=GS A0A2H5MYW9_CITUN/54-141     AC A0A2H5MYW9.1
#=GS A0A1X0K5B1_9MYCO/66-159     AC A0A1X0K5B1.1
#=GS A0A314UJ14_PRUYE/54-141     AC A0A314UJ14.1
#=GS T0S7S1_SAPDV/25-119         AC T0S7S1.1
#=GS A0A2R7KMC6_9SPHI/30-128     AC A0A2R7KMC6.1
#=GS A0A1B8E7W9_9PEZI/70-174     AC A0A1B8E7W9.1
#=GS A0A2G9FXB0_9LAMI/1-75       AC A0A2G9FXB0.1
#=GS A0A2V0P770_9CHLO/73-187     AC A0A2V0P770.1
#=GS A0A0L9V8E0_PHAAN/54-146     AC A0A0L9V8E0.1
#=GS A0A0S3S7Y1_PHAAN/42-132     AC A0A0S3S7Y1.1
#=GS D7LB06_ARALL/46-134         AC D7LB06.1
#=GS A0A370TAR9_9PEZI/35-126     AC A0A370TAR9.1
#=GS A0A2G9H3J9_9LAMI/58-149     AC A0A2G9H3J9.1
#=GS A0A3M6UD27_9CNID/40-132     AC A0A3M6UD27.1
#=GS A0A0E0JBF1_ORYNI/173-281    AC A0A0E0JBF1.1
#=GS M7Z1C7_TRIUA/53-140         AC M7Z1C7.1
#=GS A0A059CXQ5_EUCGR/63-154     AC A0A059CXQ5.1
#=GS A0A2I0I4I5_PUNGR/41-132     AC A0A2I0I4I5.1
#=GS A0A0R0HD25_SOYBN/7-98       AC A0A0R0HD25.1
#=GS A0A0R0GGX0_SOYBN/22-112     AC A0A0R0GGX0.1
#=GS A0A2G5ETC1_AQUCA/7-94       AC A0A2G5ETC1.1
#=GS A0A0D9V6F3_9ORYZ/55-146     AC A0A0D9V6F3.1
#=GS A0A1X7FU42_PARCY/59-156     AC A0A1X7FU42.1
#=GS A0A0D1JZU6_9MYCO/53-146     AC A0A0D1JZU6.1
#=GS A0A0U1LZV7_TALIS/330-417    AC A0A0U1LZV7.1
#=GS A0A444ZC03_ARAHY/78-190     AC A0A444ZC03.1
#=GS A0A3B6MUP1_WHEAT/1-95       AC A0A3B6MUP1.1
#=GS A0A2I4G8V3_JUGRE/61-152     AC A0A2I4G8V3.1
#=GS A0A453JWK3_AEGTS/18-126     AC A0A453JWK3.1
#=GS A0A0K9RCQ9_SPIOL/218-326    AC A0A0K9RCQ9.1
#=GS A0A1A9ADL8_9ACTN/48-143     AC A0A1A9ADL8.1
#=GS A0A168C8H4_CORDF/26-115     AC A0A168C8H4.1
#=GS A0A1S2YJB3_CICAR/145-248    AC A0A1S2YJB3.1
#=GS A0A1L7WHP8_9HELO/34-123     AC A0A1L7WHP8.1
#=GS A0A1L9N6R8_ASPTC/70-173     AC A0A1L9N6R8.1
#=GS A0A0V0YRR7_9BILA/2-70       AC A0A0V0YRR7.1
#=GS A0A3T1D5J0_9BACL/612-728    AC A0A3T1D5J0.1
#=GS A0A2N0JYJ8_9ACTN/72-177     AC A0A2N0JYJ8.1
#=GS A0A1Y1ID18_KLENI/146-250    AC A0A1Y1ID18.1
#=GS A0A0K9XCF4_9ACTN/82-187     AC A0A0K9XCF4.1
#=GS A0A3B6CFU3_WHEAT/171-276    AC A0A3B6CFU3.1
#=GS A0A1A9WVN1_9MUSC/39-132     AC A0A1A9WVN1.1
#=GS A0A285QXI0_9ACTN/58-151     AC A0A285QXI0.1
#=GS G9P6D2_HYPAI/34-123         AC G9P6D2.1
#=GS A0A0M9ZMJ3_9ACTN/74-179     AC A0A0M9ZMJ3.1
#=GS A0A0B5EVH6_STRA4/81-186     AC A0A0B5EVH6.1
#=GS A0A1H1RFU5_9CORY/78-234     AC A0A1H1RFU5.1
#=GS A0A2V1J1R8_9BACT/258-357    AC A0A2V1J1R8.1
#=GS J9R0E5_RIEAN/53-180         AC J9R0E5.1
#=GS A0A0F4P0M9_PSEO7/24-112     AC A0A0F4P0M9.1
#=GS A0A2Y9E8C0_TRIMA/109-202    AC A0A2Y9E8C0.1
#=GS R7I2U7_9CLOT/1-91           AC R7I2U7.1
#=GS R5CGX0_9FIRM/57-152         AC R5CGX0.1
#=GS A0A124SF02_CYNCS/17-108     AC A0A124SF02.1
#=GS A0A498IDL6_MALDO/53-141     AC A0A498IDL6.1
#=GS A0A316E6F3_9FLAO/36-130     AC A0A316E6F3.1
#=GS W7YV21_9BACL/541-638        AC W7YV21.1
#=GS A0A453KAK0_AEGTS/4-92       AC A0A453KAK0.1
#=GS A0A3D9EZ26_9FLAO/27-112     AC A0A3D9EZ26.1
#=GS A0A317LS55_9ACTN/93-181     AC A0A317LS55.1
#=GS A0A2N0GP30_9ACTN/82-188     AC A0A2N0GP30.1
#=GS A0A1R1CZJ5_9BACL/35-136     AC A0A1R1CZJ5.1
#=GS A0A1I5Y0F9_9LACT/70-222     AC A0A1I5Y0F9.1
#=GS A0A2H5AWF7_9ACTN/77-182     AC A0A2H5AWF7.1
#=GS A0A1G4G406_9PORP/273-369    AC A0A1G4G406.1
#=GS A0A445FBI0_GLYSO/72-183     AC A0A445FBI0.1
#=GS A0A2P5RUB7_GOSBA/169-277    AC A0A2P5RUB7.1
#=GS K0YR79_9CORY/50-141         AC K0YR79.1
#=GS A0A1Z5R8U7_SORBI/84-201     AC A0A1Z5R8U7.1
#=GS A0A2I0VXD4_9ASPA/51-139     AC A0A2I0VXD4.1
#=GS A0A1Y2EA00_9PEZI/34-123     AC A0A1Y2EA00.1
#=GS A0A090LQY9_STRRB/27-122     AC A0A090LQY9.1
#=GS A0A139WZN4_9CYAN/9-119      AC A0A139WZN4.1
#=GS T0Q8K1_SAPDV/70-169         AC T0Q8K1.1
#=GS A0A2G2XWQ2_CAPAN/56-147     AC A0A2G2XWQ2.1
#=GS A0A371DZR4_MUCPR/142-245    AC A0A371DZR4.1
#=GS A0A2N3UI81_9ACTN/74-167     AC A0A2N3UI81.1
#=GS A0A061GIQ7_THECC/63-154     AC A0A061GIQ7.1
#=GS A0A1I3QBG5_9PSEU/37-131     AC A0A1I3QBG5.1
#=GS A0A0D2RL65_GOSRA/60-151     AC A0A0D2RL65.1
#=GS A0A2H3Y895_PHODC/70-182     AC A0A2H3Y895.1
#=GS A0A3L6RCV5_PANMI/139-247    AC A0A3L6RCV5.1
#=GS A0A1I2WKV4_9SPHI/48-132     AC A0A1I2WKV4.1
#=GS B9SRV6_RICCO/1-75           AC B9SRV6.1
#=GS A0A3S3P1A0_9ACAR/1-78       AC A0A3S3P1A0.1
#=GS A0A150AHW4_9BACT/45-148     AC A0A150AHW4.1
#=GS A0A2I0I532_PUNGR/1-75       AC A0A2I0I532.1
#=GS A0A1G7ZRA6_9ACTN/85-187     AC A0A1G7ZRA6.1
#=GS A0A0D3HX61_9ORYZ/516-610    AC A0A0D3HX61.1
#=GS B6QKE0_TALMQ/29-116         AC B6QKE0.1
#=GS A0A1J6JI53_NICAT/143-251    AC A0A1J6JI53.1
#=GS A0A2T3Z8H7_9HYPO/22-112     AC A0A2T3Z8H7.1
#=GS A0A0E0D2X0_9ORYZ/80-167     AC A0A0E0D2X0.1
#=GS A0A2H5PKN4_CITUN/75-166     AC A0A2H5PKN4.1
#=GS A0A287QK64_HORVV/95-203     AC A0A287QK64.1
#=GS J3L4Y1_ORYBR/210-313        AC J3L4Y1.1
#=GS A0A2M9C0C6_9MICO/697-791    AC A0A2M9C0C6.1
#=GS A0A2C9UE45_MANES/93-205     AC A0A2C9UE45.1
#=GS A0A364KM61_9EURO/33-118     AC A0A364KM61.1
#=GS A0A2I0WYK1_9ASPA/148-250    AC A0A2I0WYK1.1
#=GS A0A2S8ZQM7_9MICO/242-333    AC A0A2S8ZQM7.1
#=GS A0A498JE22_MALDO/356-458    AC A0A498JE22.1
#=GS A0A0E0IEZ6_ORYNI/161-272    AC A0A0E0IEZ6.1
#=GS A0A2X0TTC8_WHEAT/143-248    AC A0A2X0TTC8.1
#=GS A0A1M7Q388_9BACT/229-325    AC A0A1M7Q388.1
#=GS A0A1V9Y8T8_9STRA/184-277    AC A0A1V9Y8T8.1
#=GS I1GNM1_BRADI/51-145         AC I1GNM1.1
#=GS A0A2G9H3K0_9LAMI/58-149     AC A0A2G9H3K0.1
#=GS A0A3Q7I9I9_SOLLC/70-182     AC A0A3Q7I9I9.1
#=GS A0A0E0RKH4_ORYRU/445-539    AC A0A0E0RKH4.1
#=GS M8AQC5_TRIUA/17-108         AC M8AQC5.1
#=GS G2RGJ3_THITE/36-121         AC G2RGJ3.1
#=GS A0A3B6MM31_WHEAT/174-282    AC A0A3B6MM31.1
#=GS A0A2S4Z6X3_9ACTN/49-144     AC A0A2S4Z6X3.1
#=GS A0A1M6QCN7_9BACT/135-227    AC A0A1M6QCN7.1
#=GS A0A397I0M0_9EURO/34-123     AC A0A397I0M0.1
#=GS C4IIN9_CLOBU/61-149         AC C4IIN9.1
#=GS W9RAH0_9ROSA/203-311        AC W9RAH0.1
#=GS A0A250VNW6_STROL/74-179     AC A0A250VNW6.1
#=GS A0A1I2JJ19_9ACTN/80-186     AC A0A1I2JJ19.1
#=GS A0A1V2SC52_9BACI/717-816    AC A0A1V2SC52.1
#=GS A0A3B6QJK3_WHEAT/59-150     AC A0A3B6QJK3.1
#=GS A0A371AR40_9FIRM/54-149     AC A0A371AR40.1
#=GS A0A0R3P3Y3_DROPS/42-143     AC A0A0R3P3Y3.1
#=GS A8XTP7_CAEBR/46-139         AC A8XTP7.2
#=GS A0A287PUR3_HORVV/56-148     AC A0A287PUR3.1
#=GS A0A0Q4LIA0_9SPHI/46-144     AC A0A0Q4LIA0.1
#=GS A0A2P5BU66_TREOI/146-249    AC A0A2P5BU66.1
#=GS A0A0N4ZQH4_PARTI/26-119     AC A0A0N4ZQH4.1
#=GS A0A2G4TAI8_RHIZD/59-160     AC A0A2G4TAI8.1
#=GS F0SF17_PSESL/21-113         AC F0SF17.1
#=GS A0A2G3DH75_CAPCH/239-341    AC A0A2G3DH75.1
#=GS W7SUE8_9PSEU/51-144         AC W7SUE8.1
#=GS A0A421GCW5_9STRA/33-131     AC A0A421GCW5.1
#=GS L8FYE5_PSED2/70-174         AC L8FYE5.1
#=GS A0A251V5K0_HELAN/59-150     AC A0A251V5K0.1
#=GS A0A287TIZ0_HORVV/1-80       AC A0A287TIZ0.1
#=GS A0A0K0XUI6_9GAMM/38-118     AC A0A0K0XUI6.1
#=GS A0A0A0LWA9_CUCSA/62-153     AC A0A0A0LWA9.1
#=GS A0A453L811_AEGTS/1-95       AC A0A453L811.1
#=GS A0A3L6STI2_PANMI/184-272    AC A0A3L6STI2.1
#=GS E9ENB8_METRA/26-116         AC E9ENB8.1
#=GS A0A1B7LV56_9MICC/235-327    AC A0A1B7LV56.1
#=GS A0A1U8FKJ3_CAPAN/55-142     AC A0A1U8FKJ3.1
#=GS W4FSD2_9STRA/128-237        AC W4FSD2.1
#=GS M4CRV9_BRARP/60-147         AC M4CRV9.1
#=GS C3ZZU0_BRAFL/24-115         AC C3ZZU0.1
#=GS M4FGY5_BRARP/75-186         AC M4FGY5.1
#=GS A0A453NAN1_AEGTS/65-157     AC A0A453NAN1.1
#=GS A0A1I0VET1_9BACL/609-716    AC A0A1I0VET1.1
#=GS A0A3B3DSX4_ORYME/26-119     AC A0A3B3DSX4.1
#=GS A0A0D3BK13_BRAOL/49-144     AC A0A0D3BK13.1
#=GS A0A0V2FD45_CAUVI/43-143     AC A0A0V2FD45.1
#=GS G2FUL4_9FIRM/251-348        AC G2FUL4.1
#=GS G0IXK3_CYCMS/231-326        AC G0IXK3.1
#=GS A0A1H0JLK2_9BACT/47-138     AC A0A1H0JLK2.1
#=GS A0A1R3HL90_COCAP/67-172     AC A0A1R3HL90.1
#=GS A0A1Z5R9Z4_SORBI/130-247    AC A0A1Z5R9Z4.1
#=GS A0A0L9VP92_PHAAN/74-185     AC A0A0L9VP92.1
#=GS Q7XVG3_ORYSJ/52-141         AC Q7XVG3.1
#=GS A0A3L6PPK7_PANMI/175-287    AC A0A3L6PPK7.1
#=GS A0A1U8BGN3_NELNU/24-112     AC A0A1U8BGN3.1
#=GS A0A1M7NI71_9ACTN/76-194     AC A0A1M7NI71.1
#=GS A0A482VJS3_9CUCU/25-116     AC A0A482VJS3.1
#=GS A0A2C9VMV4_MANES/58-149     AC A0A2C9VMV4.1
#=GS A0A158NSC8_ATTCE/30-121     AC A0A158NSC8.1
#=GS A0A2D0RME6_ICTPU/26-119     AC A0A2D0RME6.1
#=GS A0A0X3BKG9_9EURY/216-299    AC A0A0X3BKG9.1
#=GS A0A3B6PTQ8_WHEAT/59-150     AC A0A3B6PTQ8.1
#=GS V4AER7_LOTGI/168-263        AC V4AER7.1
#=GS N4UF48_FUSC1/69-170         AC N4UF48.1
#=GS F4L0X8_HALH1/22-113         AC F4L0X8.1
#=GS F0ZBD3_DICPU/24-120         AC F0ZBD3.1
#=GS A0A2G3DH56_CAPCH/78-180     AC A0A2G3DH56.1
#=GS A0A287TJC0_HORVV/85-177     AC A0A287TJC0.1
#=GS A0A0D2QJD8_GOSRA/61-152     AC A0A0D2QJD8.1
#=GS A0A024GVU8_9STRA/140-246    AC A0A024GVU8.1
#=GS A6C7F2_9PLAN/41-137         AC A6C7F2.1
#=GS A0A151SR68_CAJCA/453-544    AC A0A151SR68.1
#=GS A0A0K0FU16_STRVS/79-175     AC A0A0K0FU16.1
#=GS A0A0R0H044_SOYBN/217-319    AC A0A0R0H044.1
#=GS I3J3A5_ORENI/776-867        AC I3J3A5.1
#=GS A0A1I1L5J8_9SPHI/33-130     AC A0A1I1L5J8.1
#=GS A0A2U1QF39_ARTAN/80-194     AC A0A2U1QF39.1
#=GS E3NI17_CAERE/20-115         AC E3NI17.1
#=GS A0A1I2X553_9FIRM/63-160     AC A0A1I2X553.1
#=GS A0A287RUJ5_HORVV/1-96       AC A0A287RUJ5.1
#=GS L1M9J8_9BACT/45-136         AC L1M9J8.1
#=GS A0A3B6CEP2_WHEAT/148-239    AC A0A3B6CEP2.1
#=GS A0A0D9XA43_9ORYZ/178-275    AC A0A0D9XA43.1
#=GS A0A498JRZ5_MALDO/180-288    AC A0A498JRZ5.1
#=GS A0A1Q3BIG2_CEPFO/69-181     AC A0A1Q3BIG2.1
#=GS M8AZP4_TRIUA/44-135         AC M8AZP4.1
#=GS A0A1C5C3H8_9ACTN/48-143     AC A0A1C5C3H8.1
#=GS F2UHU8_SALR5/29-118         AC F2UHU8.1
#=GS E1VVZ0_GLUAR/220-311        AC E1VVZ0.1
#=GS G4Q306_ACIIR/31-121         AC G4Q306.1
#=GS M1VGQ9_CYAM1/128-235        AC M1VGQ9.1
#=GS A0A0Q6Y5Q0_9MICO/55-152     AC A0A0Q6Y5Q0.1
#=GS A0A177UR62_9BASI/32-130     AC A0A177UR62.1
#=GS A0A0Q7JVF7_9BACL/7-122      AC A0A0Q7JVF7.1
#=GS F8K1E0_STREN/56-149         AC F8K1E0.1
#=GS A2XIP0_ORYSI/68-155         AC A2XIP0.1
#=GS A0A2N0FMZ0_9ACTN/53-147     AC A0A2N0FMZ0.1
#=GS A0A0K8LC31_9EURO/34-123     AC A0A0K8LC31.1
#=GS A0A2S4YU00_9ACTN/74-191     AC A0A2S4YU00.1
#=GS A0A0N0A473_9ACTN/75-180     AC A0A0N0A473.1
#=GS A0A0D2QJH5_GOSRA/169-277    AC A0A0D2QJH5.1
#=GS A0A3D8YBT4_9BACT/36-132     AC A0A3D8YBT4.1
#=GS A0A397Y9H3_BRACM/59-150     AC A0A397Y9H3.1
#=GS A0A445KJA9_GLYSO/181-289    AC A0A445KJA9.1
#=GS L8H162_ACACA/156-258        AC L8H162.1
#=GS A0A1D7QFK1_9SPHI/33-131     AC A0A1D7QFK1.1
#=GS A0A2I0B0E8_9ASPA/64-176     AC A0A2I0B0E8.1
#=GS A0A2K3D056_CHLRE/98-212     AC A0A2K3D056.1
#=GS A0A1I7VXA8_LOALO/42-128     AC A0A1I7VXA8.1
#=GS A0A453ELQ1_AEGTS/67-180     AC A0A453ELQ1.1
#=GS M0QXC1_HUMAN/32-125         AC M0QXC1.1
#=GS A0A3Q0KN95_SCHMA/30-121     AC A0A3Q0KN95.1
#=GS R6I7G2_9FIRM/45-133         AC R6I7G2.1
#=GS A0A182NCF8_9DIPT/35-126     AC A0A182NCF8.1
#=GS A0A1S3AWC6_CUCME/65-176     AC A0A1S3AWC6.1
#=GS A0A1S3B1Z1_CUCME/52-145     AC A0A1S3B1Z1.1
#=GS A0A022QVD0_ERYGU/72-184     AC A0A022QVD0.1
#=GS V4UUP3_9ROSI/59-150         AC V4UUP3.1
#=GS A0A212FKJ2_DANPL/32-123     AC A0A212FKJ2.1
#=GS G0T437_SOYBN/145-251        AC G0T437.1
#=GS A0A0E0JPF2_ORYPU/62-153     AC A0A0E0JPF2.1
#=GS A0A0E0Q3A6_ORYRU/142-247    AC A0A0E0Q3A6.1
#=GS A0A1A9USZ0_GLOAU/41-135     AC A0A1A9USZ0.1
#=GS A0A368RC45_SETIT/1-89       AC A0A368RC45.1
#=GS A0A2P6VD00_9CHLO/29-206     AC A0A2P6VD00.1
#=GS A0A1D6PZG4_MAIZE/83-201     AC A0A1D6PZG4.1
#=GS A0A1Q3BSA6_CEPFO/102-213    AC A0A1Q3BSA6.1
#=GS A0A059W8M0_STRA9/91-196     AC A0A059W8M0.1
#=GS A0A3N7G6S7_POPTR/96-204     AC A0A3N7G6S7.1
#=GS A0A2K6BWZ4_MACNE/32-125     AC A0A2K6BWZ4.1
#=GS F0XDX6_GROCL/33-122         AC F0XDX6.1
#=GS A0A2U1Q4L0_ARTAN/216-325    AC A0A2U1Q4L0.1
#=GS A0A0E0P3W8_ORYRU/63-176     AC A0A0E0P3W8.1
#=GS A0A1H6QND9_9BACT/34-114     AC A0A1H6QND9.1
#=GS A0A1R3SR15_9BACT/722-821    AC A0A1R3SR15.1
#=GS R5K5D4_9CLOT/235-329        AC R5K5D4.1
#=GS A0A2P5DFT7_TREOI/166-274    AC A0A2P5DFT7.1
#=GS A0A2C9JIY6_BIOGL/26-118     AC A0A2C9JIY6.1
#=GS A0A0D2JRB2_9DELT/123-225    AC A0A0D2JRB2.1
#=GS M4DJP3_BRARP/143-246        AC M4DJP3.1
#=GS A0A0N1EDF9_9SPHN/25-125     AC A0A0N1EDF9.1
#=GS A0A1A5YCX7_9BACL/7-110      AC A0A1A5YCX7.1
#=GS A0A2P4UF42_9ACTN/71-176     AC A0A2P4UF42.1
#=GS A0A1U8KUB3_GOSHI/226-328    AC A0A1U8KUB3.1
#=GS R6HZQ0_9FIRM/49-138         AC R6HZQ0.1
#=GS K3ZRC8_SETIT/150-254        AC K3ZRC8.1
#=GS J3NEE6_ORYBR/164-272        AC J3NEE6.1
#=GS A0A2T4BGT4_9HYPO/21-111     AC A0A2T4BGT4.1
#=GS R6VQY0_9BACT/287-387        AC R6VQY0.1
#=GS C9RL59_FIBSS/785-865        AC C9RL59.1
#=GS A0A2I4G8M4_JUGRE/68-179     AC A0A2I4G8M4.1
#=GS A0A2G5E5X2_AQUCA/177-285    AC A0A2G5E5X2.1
#=GS A0A090DV63_9BACT/31-119     AC A0A090DV63.1
#=GS A0A1C6QVK2_9BURK/53-149     AC A0A1C6QVK2.1
#=GS A0A225UZC4_9STRA/63-160     AC A0A225UZC4.1
#=GS A2YHH3_ORYSI/142-247        AC A2YHH3.1
#=GS A0A0A1MJW3_RHIZD/59-160     AC A0A0A1MJW3.1
#=GS A0A1H0CUU0_9ACTN/772-864    AC A0A1H0CUU0.1
#=GS A0A2K6BX39_MACNE/32-125     AC A0A2K6BX39.1
#=GS B0WRM8_CULQU/25-116         AC B0WRM8.1
#=GS A0A1A5XFB6_9BURK/71-167     AC A0A1A5XFB6.1
#=GS A0A1H6DKX7_9ACTN/39-152     AC A0A1H6DKX7.1
#=GS A0A445IBA9_GLYSO/63-154     AC A0A445IBA9.1
#=GS A0A151TVN7_CAJCA/44-131     AC A0A151TVN7.1
#=GS A0A1H3L3A5_9MICO/50-145     AC A0A1H3L3A5.1
#=GS A0A199W6A6_ANACO/55-146     AC A0A199W6A6.1
#=GS A0A0D2U273_GOSRA/47-139     AC A0A0D2U273.1
#=GS A0A3E2HK93_SCYLI/27-117     AC A0A3E2HK93.1
#=GS A0A0E0MNX6_ORYPU/864-972    AC A0A0E0MNX6.1
#=GS A0A3M6VN40_9STRA/185-290    AC A0A3M6VN40.1
#=GS A0A0G2ZXQ7_9DELT/229-312    AC A0A0G2ZXQ7.1
#=GS A0A443N774_9MAGN/64-155     AC A0A443N774.1
#=GS A0A1B1Y844_9FLAO/44-131     AC A0A1B1Y844.1
#=GS I7Z876_9GAMM/70-168         AC I7Z876.1
#=GS A0A367KBE8_9FUNG/59-160     AC A0A367KBE8.1
#=GS A0A2T7DWT2_9POAL/147-252    AC A0A2T7DWT2.1
#=GS I1R7G6_ORYGL/120-228        AC I1R7G6.1
#=GS A0A087ZWE4_APIME/25-116     AC A0A087ZWE4.1
#=GS A0A251QU10_PRUPE/68-181     AC A0A251QU10.1
#=GS A0A0D3GLH5_9ORYZ/142-247    AC A0A0D3GLH5.1
#=GS A0A1U8K5A5_GOSHI/62-153     AC A0A1U8K5A5.1
#=GS C9Z590_STRSW/80-185         AC C9Z590.1
#=GS A0A397YF92_BRACM/178-286    AC A0A397YF92.1
#=GS A0A1U7MJ10_9FIRM/36-132     AC A0A1U7MJ10.1
#=GS A0A3B6IV73_WHEAT/1-78       AC A0A3B6IV73.1
#=GS A0A2W2A2A2_9MICO/55-170     AC A0A2W2A2A2.1
#=GS A0A166AIB9_DAUCS/52-140     AC A0A166AIB9.1
#=GS A0A2I0KW57_PUNGR/56-147     AC A0A2I0KW57.1
#=GS D4YMS9_9MICO/37-133         AC D4YMS9.1
#=GS A0A0E0GIY9_ORYNI/171-279    AC A0A0E0GIY9.1
#=GS F4PNQ9_CAVFA/30-186         AC F4PNQ9.1
#=GS F0ZBD4_DICPU/23-119         AC F0ZBD4.1
#=GS A0A1S2Z6A9_CICAR/180-288    AC A0A1S2Z6A9.1
#=GS A0A0B2AF13_9MICC/64-157     AC A0A0B2AF13.1
#=GS A0A0K1EHM1_CHOCO/29-117     AC A0A0K1EHM1.1
#=GS A0A059D7Z9_EUCGR/145-247    AC A0A059D7Z9.1
#=GS F6UAF3_ORNAN/34-110         AC F6UAF3.2
#=GS A0A3L6QS31_PANMI/186-295    AC A0A3L6QS31.1
#=GS A0A269WC34_9BACL/1068-1167  AC A0A269WC34.1
#=GS H0V7G3_CAVPO/61-154         AC H0V7G3.2
#=GS E1WXV8_HALMS/30-125         AC E1WXV8.1
#=GS A0A1M6FAN2_9FLAO/634-712    AC A0A1M6FAN2.1
#=GS D8RZB9_SELML/170-283        AC D8RZB9.1
#=GS F4PPK2_CAVFA/171-279        AC F4PPK2.1
#=GS A0A2Z5EKA5_9SPHN/40-137     AC A0A2Z5EKA5.1
#=GS D2VG13_NAEGR/99-204         AC D2VG13.1
#=GS A0A0E0LX88_ORYPU/178-294    AC A0A0E0LX88.1
#=GS A0A1J7GDD6_LUPAN/51-143     AC A0A1J7GDD6.1
#=GS A0A0F7TWD5_9EURO/67-171     AC A0A0F7TWD5.1
#=GS A0A1X9YFR8_9SPHN/40-136     AC A0A1X9YFR8.1
#=GS S2YDH2_9ACTN/74-179         AC S2YDH2.1
#=GS A0A139I9Z6_9PEZI/399-502    AC A0A139I9Z6.1
#=GS A0A1R3INB5_COCAP/169-277    AC A0A1R3INB5.1
#=GS A0A0M2GIF6_9ACTN/81-186     AC A0A0M2GIF6.1
#=GS A0A2H5NW33_CITUN/183-291    AC A0A2H5NW33.1
#=GS A0A1I8Q1X8_STOCA/1-88       AC A0A1I8Q1X8.1
#=GS A0A1H9FYK3_9LACT/45-197     AC A0A1H9FYK3.1
#=GS A0A0U5CH83_9EURO/71-161     AC A0A0U5CH83.1
#=GS A0A0P1ACC3_PLAHL/200-305    AC A0A0P1ACC3.1
#=GS A0A3S0C7D4_9FLAO/69-175     AC A0A3S0C7D4.1
#=GS A0A1Q4VZB6_9ACTN/56-150     AC A0A1Q4VZB6.1
#=GS A0A2H3YLI0_PHODC/1-81       AC A0A2H3YLI0.1
#=GS A0A0Q3HVI6_BRADI/59-148     AC A0A0Q3HVI6.1
#=GS A0A174NQU6_9BACE/257-375    AC A0A174NQU6.1
#=GS V5E3N3_KALBG/34-120         AC V5E3N3.1
#=GS A0A1Y1XK72_9FUNG/152-242    AC A0A1Y1XK72.1
#=GS D7L1V7_ARALL/59-157         AC D7L1V7.1
#=GS A0A2V0NRP9_9CHLO/206-315    AC A0A2V0NRP9.1
#=GS A0A098LKA2_9BACT/165-246    AC A0A098LKA2.1
#=GS A0A1D1VKD8_RAMVA/34-127     AC A0A1D1VKD8.1
#=GS A0A3M6VEM4_9STRA/100-198    AC A0A3M6VEM4.1
#=GS A0A1X1TIU2_9MYCO/1-94       AC A0A1X1TIU2.1
#=GS A0A2P5DXN0_TREOI/61-153     AC A0A2P5DXN0.1
#=GS A0A0U3P3K6_9LACT/53-205     AC A0A0U3P3K6.1
#=GS A0A2U0H3G1_9MICO/49-146     AC A0A2U0H3G1.1
#=GS A0A175YNS7_DAUCS/142-245    AC A0A175YNS7.1
#=GS S2J469_MUCC1/43-140         AC S2J469.1
#=GS Q8H5T7_ORYSJ/142-247        AC Q8H5T7.1
#=GS A0A0C1YQ20_9CYAN/41-137     AC A0A0C1YQ20.1
#=GS A0A1L6KZ43_9DELT/99-200     AC A0A1L6KZ43.1
#=GS A0A162I1A0_9HYPO/34-123     AC A0A162I1A0.1
#=GS A0A3N0DI67_9ACTN/152-253    AC A0A3N0DI67.1
#=GS A0A1S2VPF0_9BACT/34-130     AC A0A1S2VPF0.1
#=GS A0A1U8A325_NELNU/150-253    AC A0A1U8A325.1
#=GS R6I8A0_9FIRM/38-131         AC R6I8A0.1
#=GS A0A2U2ZT08_9ACTN/77-182     AC A0A2U2ZT08.1
#=GS A0A371I8A6_MUCPR/88-179     AC A0A371I8A6.1
#=GS A0A162XP78_9FLAO/21-112     AC A0A162XP78.1
#=GS A0A3B6LHH2_WHEAT/11-99      AC A0A3B6LHH2.1
#=GS A0A3D9I4F8_9BACL/627-737    AC A0A3D9I4F8.1
#=GS A0A287PY20_HORVV/182-290    AC A0A287PY20.1
#=GS A0A0E0MNX4_ORYPU/1440-1548  AC A0A0E0MNX4.1
#=GS A0A0A0LBQ8_CUCSA/3-66       AC A0A0A0LBQ8.1
#=GS A0A2U1P7Z1_ARTAN/796-905    AC A0A2U1P7Z1.1
#=GS A0A3B6KE22_WHEAT/37-126     AC A0A3B6KE22.1
#=GS A0A1V4HTI8_9BACL/337-448    AC A0A1V4HTI8.1
#=GS A0A3B6A2J8_WHEAT/173-286    AC A0A3B6A2J8.1
#=GS A0A3B6KTH4_WHEAT/52-144     AC A0A3B6KTH4.1
#=GS A0A445CQJ1_ARAHY/50-138     AC A0A445CQJ1.1
#=GS A0A1Q5UHQ5_9EURO/31-121     AC A0A1Q5UHQ5.1
#=GS D8S6N1_SELML/73-183         AC D8S6N1.1
#=GS A0A0E0MJN6_ORYPU/49-143     AC A0A0E0MJN6.1
#=GS A0A453D6Z3_AEGTS/1-90       AC A0A453D6Z3.1
#=GS A0A269PV24_9GAMM/214-301    AC A0A269PV24.1
#=GS B8BM28_ORYSI/52-144         AC B8BM28.1
#=GS A0A1Y1XJT4_9FUNG/167-258    AC A0A1Y1XJT4.1
#=GS A0A210PFC2_MIZYE/22-112     AC A0A210PFC2.1
#=GS A0A453JWJ9_AEGTS/164-272    AC A0A453JWJ9.1
#=GS U5DBQ9_AMBTC/46-133         AC U5DBQ9.1
#=GS A0A2G2X160_CAPBA/102-193    AC A0A2G2X160.1
#=GS A0A251U8W2_HELAN/69-184     AC A0A251U8W2.1
#=GS A0A2P5EZM2_TREOI/17-108     AC A0A2P5EZM2.1
#=GS B7Q0U0_IXOSC/16-108         AC B7Q0U0.1
#=GS A0A0K9RH06_SPIOL/70-181     AC A0A0K9RH06.1
#=GS A0A098F3A5_9BACI/986-1090   AC A0A098F3A5.1
#=GS A0A3D9KZW2_9BACT/22-114     AC A0A3D9KZW2.1
#=GS A0A2M9JS00_9ACTN/83-188     AC A0A2M9JS00.1
#=GS A0A067CDN4_SAPPC/131-238    AC A0A067CDN4.1
#=GS A7S863_NEMVE/23-134         AC A7S863.1
#=GS A0A0Q3EXZ1_BRADI/93-184     AC A0A0Q3EXZ1.1
#=GS V7ACX0_PHAVU/54-145         AC V7ACX0.1
#=GS A0A1X7UL29_AMPQE/150-251    AC A0A1X7UL29.1
#=GS K3Z626_SETIT/56-147         AC K3Z626.1
#=GS M3Z223_MUSPF/32-125         AC M3Z223.1
#=GS A0A1J7HEV6_LUPAN/47-133     AC A0A1J7HEV6.1
#=GS A0A165E6D5_9BASI/69-172     AC A0A165E6D5.1
#=GS M4AIJ9_XIPMA/28-121         AC M4AIJ9.1
#=GS A0A453FQM5_AEGTS/4-47       AC A0A453FQM5.1
#=GS A0A2T5LRZ1_9EURO/39-125     AC A0A2T5LRZ1.1
#=GS A0A453T6V3_AEGTS/99-190     AC A0A453T6V3.1
#=GS M4FGW9_BRARP/77-188         AC M4FGW9.1
#=GS A0A3B6IWZ3_WHEAT/174-282    AC A0A3B6IWZ3.1
#=GS A0A2G5EPR7_AQUCA/176-284    AC A0A2G5EPR7.1
#=GS D0NVK8_PHYIT/174-279        AC D0NVK8.1
#=GS A0A022R5I2_ERYGU/43-131     AC A0A022R5I2.1
#=GS A0A495JKB0_9ACTN/80-175     AC A0A495JKB0.1
#=GS A0A0D9Y1T8_9ORYZ/53-144     AC A0A0D9Y1T8.1
#=GS Q6YGT9_SOYBN/92-183         AC Q6YGT9.1
#=GS A0A133V0P7_9EURY/67-172     AC A0A133V0P7.1
#=GS A0A3Q2ZCJ5_KRYMA/28-121     AC A0A3Q2ZCJ5.1
#=GS A0A0T2L1E0_9MICO/37-133     AC A0A0T2L1E0.1
#=GS A0A1I4MTC9_9BACL/61-160     AC A0A1I4MTC9.1
#=GS A0A1V9X9V5_9ACAR/28-124     AC A0A1V9X9V5.1
#=GS L8GZQ1_ACACA/123-213        AC L8GZQ1.1
#=GS A0A2T7D5Q8_9POAL/110-227    AC A0A2T7D5Q8.1
#=GS D5XD20_THEPJ/328-415        AC D5XD20.1
#=GS A0A1U7WIF3_NICSY/61-152     AC A0A1U7WIF3.1
#=GS A0A2H3YAJ3_PHODC/56-147     AC A0A2H3YAJ3.1
#=GS A0A318U9T2_9SPHI/33-115     AC A0A318U9T2.1
#=GS A0A1D5UL33_WHEAT/47-134     AC A0A1D5UL33.1
#=GS A0A200PZD2_9MAGN/58-145     AC A0A200PZD2.1
#=GS C9LVB0_SELS3/54-144         AC C9LVB0.1
#=GS F7V5R3_CLOSS/61-157         AC F7V5R3.1
#=GS A0A2S5BGI4_9BASI/51-143     AC A0A2S5BGI4.1
#=GS A0A089ILP5_9BACL/38-136     AC A0A089ILP5.1
#=GS A0A090KXY3_STRRB/71-164     AC A0A090KXY3.1
#=GS A0A1R3HD98_9ROSI/52-140     AC A0A1R3HD98.1
#=GS A0A445DNQ3_ARAHY/165-268    AC A0A445DNQ3.1
#=GS A0A2H5PKN7_CITUN/59-150     AC A0A2H5PKN7.1
#=GS A0A3L6RE93_PANMI/143-231    AC A0A3L6RE93.1
#=GS M2M8G7_BAUPA/30-117         AC M2M8G7.1
#=GS A0A329SX53_9STRA/189-294    AC A0A329SX53.1
#=GS A0A445BYH7_ARAHY/219-312    AC A0A445BYH7.1
#=GS A0A2H2I2C6_CAEJA/19-114     AC A0A2H2I2C6.1
#=GS A0A399D1B5_9BACT/23-123     AC A0A399D1B5.1
#=GS A0A285BET0_9FIRM/37-129     AC A0A285BET0.1
#=GS A0A427YFT6_9TREE/71-175     AC A0A427YFT6.1
#=GS A0A3L6R7Z1_PANMI/155-263    AC A0A3L6R7Z1.1
#=GS A0A2R6R8Z9_ACTCH/71-182     AC A0A2R6R8Z9.1
#=GS W2K5E8_PHYPR/70-169         AC W2K5E8.1
#=GS A0A1I5RMJ7_9BACT/49-144     AC A0A1I5RMJ7.1
#=GS C6J0B3_9BACL/40-141         AC C6J0B3.1
#=GS A0A1H6DVA9_9ACTN/70-163     AC A0A1H6DVA9.1
#=GS A0A1R3FVT7_COCAP/83-186     AC A0A1R3FVT7.1
#=GS E3EDE7_PAEPS/42-139         AC E3EDE7.1
#=GS A0A1H8U3Y5_9GAMM/29-115     AC A0A1H8U3Y5.1
#=GS A0A453RMA4_AEGTS/116-226    AC A0A453RMA4.1
#=GS R7ZWR7_9BACT/53-154         AC R7ZWR7.1
#=GS F7APV1_HORSE/32-125         AC F7APV1.2
#=GS A0A0D2WNR0_CAPO3/181-287    AC A0A0D2WNR0.1
#=GS A0A0E0BP02_9ORYZ/52-145     AC A0A0E0BP02.1
#=GS A0A1H8UHM3_9PSEU/52-145     AC A0A1H8UHM3.1
#=GS M0YYK8_HORVV/7-89           AC M0YYK8.1
#=GS M2NFJ9_BAUPA/78-180         AC M2NFJ9.1
#=GS A0A059APQ3_EUCGR/17-108     AC A0A059APQ3.1
#=GS A0A0Q7B751_9ACTN/43-144     AC A0A0Q7B751.1
#=GS A0A171KRP3_9BURK/63-162     AC A0A171KRP3.1
#=GS A0A1H1ITC1_9BURK/56-152     AC A0A1H1ITC1.1
#=GS Q67WU6_ORYSJ/54-145         AC Q67WU6.1
#=GS A0A2N5M461_9BACI/987-1091   AC A0A2N5M461.1
#=GS A0A177HI05_9ACTN/59-164     AC A0A177HI05.1
#=GS A0A2T7EK64_9POAL/149-254    AC A0A2T7EK64.1
#=GS A0A0D2VBI2_GOSRA/171-279    AC A0A0D2VBI2.1
#=GS A0A0J0YB80_9SPHI/52-150     AC A0A0J0YB80.1
#=GS A0A1Y1U8F4_9TREE/93-197     AC A0A1Y1U8F4.1
#=GS A0A143PTA4_9BACT/37-142     AC A0A143PTA4.1
#=GS A0A2S1JWB2_9GAMM/25-114     AC A0A2S1JWB2.1
#=GS A0A402FYN8_9SAUR/24-117     AC A0A402FYN8.1
#=GS A0A372MBA7_9ACTN/37-142     AC A0A372MBA7.1
#=GS H2UJV6_TAKRU/52-145         AC H2UJV6.2
#=GS W9IHR4_9HYPO/69-173         AC W9IHR4.1
#=GS A0A225WSV4_9STRA/91-189     AC A0A225WSV4.1
#=GS A0A2K8VDJ9_9FLAO/22-113     AC A0A2K8VDJ9.1
#=GS A0A0D2U744_GOSRA/56-147     AC A0A0D2U744.1
#=GS A0A2K1XKN1_POPTR/180-288    AC A0A2K1XKN1.2
#=GS A0A1D6EVQ7_MAIZE/201-309    AC A0A1D6EVQ7.1
#=GS E4N626_KITSK/94-193         AC E4N626.1
#=GS M1D308_SOLTU/64-176         AC M1D308.1
#=GS A0A1U8QCW6_NELNU/73-185     AC A0A1U8QCW6.1
#=GS A0A445DKP4_ARAHY/77-189     AC A0A445DKP4.1
#=GS G5EGR0_CAEEL/19-102         AC G5EGR0.2
#=GS A0A067KT97_JATCU/69-181     AC A0A067KT97.1
#=GS A0A371PIF0_9BACL/33-133     AC A0A371PIF0.1
#=GS G0MR95_CAEBE/23-118         AC G0MR95.1
#=GS A0A372FEB4_9BACT/54-155     AC A0A372FEB4.1
#=GS A0A225VFT6_9STRA/72-169     AC A0A225VFT6.1
#=GS A0A067L2R6_JATCU/49-136     AC A0A067L2R6.1
#=GS A0A2T7BYA9_9POAL/61-174     AC A0A2T7BYA9.1
#=GS G7JHG8_MEDTR/144-233        AC G7JHG8.1
#=GS A0A1Z5R915_SORBI/130-247    AC A0A1Z5R915.1
#=GS A0A1Y1I5W5_KLENI/55-151     AC A0A1Y1I5W5.1
#=GS A0A1J7IPZ6_LUPAN/17-108     AC A0A1J7IPZ6.1
#=GS A0A0M2Y1G6_9SPHI/27-128     AC A0A0M2Y1G6.1
#=GS A0A3M6TBQ5_9CNID/44-137     AC A0A3M6TBQ5.1
#=GS A0A498LF13_LABRO/1-80       AC A0A498LF13.1
#=GS A0A249DG67_LACRH/1044-1145  AC A0A249DG67.1
#=GS A0A0L9V8N3_PHAAN/54-145     AC A0A0L9V8N3.1
#=GS A0A074WAJ1_9PEZI/33-119     AC A0A074WAJ1.1
#=GS A0A3Q7GFN0_SOLLC/168-276    AC A0A3Q7GFN0.1
#=GS A0A062V4M6_9EURY/506-606    AC A0A062V4M6.1
#=GS A0A1W6N0J5_9RHIZ/35-129     AC A0A1W6N0J5.1
#=GS I0Z8X7_COCSC/56-152         AC I0Z8X7.1
#=GS A0A067G6I3_CITSI/54-145     AC A0A067G6I3.1
#=GS W5KMZ9_ASTMX/28-121         AC W5KMZ9.1
#=GS A0A1U9NJH1_9BACT/253-334    AC A0A1U9NJH1.1
#=GS A0A443RAI4_9ACAR/7-98       AC A0A443RAI4.1
#=GS K7MZ83_SOYBN/99-186         AC K7MZ83.1
#=GS A0A179F0F8_METCM/34-123     AC A0A179F0F8.1
#=GS A0A399T1X3_9BACT/27-111     AC A0A399T1X3.1
#=GS A0A368RPG4_SETIT/196-307    AC A0A368RPG4.1
#=GS B6HUH0_PENRW/33-120         AC B6HUH0.1
#=GS A0A1B8EIP5_9PEZI/39-130     AC A0A1B8EIP5.1
#=GS A0A2G7F7R8_9ACTN/52-145     AC A0A2G7F7R8.1
#=GS A0A1D8SPD6_STROV/48-142     AC A0A1D8SPD6.1
#=GS A0A365MKN2_GIBIN/28-117     AC A0A365MKN2.1
#=GS H3GLK9_PHYRM/2-93           AC H3GLK9.1
#=GS A0A1R3T2Z2_9BACT/33-129     AC A0A1R3T2Z2.1
#=GS A0A1M4XBK4_9FIRM/37-124     AC A0A1M4XBK4.1
#=GS B1C470_9FIRM/84-177         AC B1C470.1
#=GS A0A0K9QLJ7_SPIOL/64-155     AC A0A0K9QLJ7.1
#=GS A0A2C9W597_MANES/179-281    AC A0A2C9W597.1
#=GS A0A061E9P3_THECC/174-282    AC A0A061E9P3.1
#=GS A0A0Q5V6H3_9FLAO/19-110     AC A0A0Q5V6H3.1
#=GS A0A397YBX5_BRACM/49-144     AC A0A397YBX5.1
#=GS K9ERA6_9LACT/123-275        AC K9ERA6.1
#=GS R7P6R3_9BACT/29-137         AC R7P6R3.1
#=GS A0A453L803_AEGTS/173-281    AC A0A453L803.1
#=GS A0A0D2UTF0_CAPO3/31-114     AC A0A0D2UTF0.1
#=GS A0A0L8H5I1_OCTBM/1-85       AC A0A0L8H5I1.1
#=GS A0A1B8EHM6_9PEZI/34-131     AC A0A1B8EHM6.1
#=GS A0A0D3FFF3_9ORYZ/171-279    AC A0A0D3FFF3.1
#=GS A0A1R4H1C5_9GAMM/198-281    AC A0A1R4H1C5.1
#=GS A0A1X1V467_9MYCO/67-160     AC A0A1X1V467.1
#=GS W2PI28_PHYPN/67-164         AC W2PI28.1
#=GS D4MXL2_ANAHA/65-175         AC D4MXL2.1
#=GS V4LRV6_EUTSA/44-134         AC V4LRV6.1
#=GS A0A0D9PB99_METAN/26-116     AC A0A0D9PB99.1
#=GS A0A1R4JK17_9MICO/244-337    AC A0A1R4JK17.1
#=GS A0A1X7D1K4_9ACTN/79-184     AC A0A1X7D1K4.1
#=GS A0A445K413_GLYSO/64-155     AC A0A445K413.1
#=GS A0A1G9Y7S6_9FLAO/7-113      AC A0A1G9Y7S6.1
#=GS A0A168H6A9_MUCCL/22-123     AC A0A168H6A9.1
#=GS A0A094D355_9PEZI/70-174     AC A0A094D355.1
#=GS I0Z5F6_COCSC/41-128         AC I0Z5F6.1
#=GS A0A067BI35_SAPPC/162-272    AC A0A067BI35.1
#=GS A0A443HHW1_BYSSP/32-119     AC A0A443HHW1.1
#=GS A0A1H0A0M6_9FIRM/30-124     AC A0A1H0A0M6.1
#=GS A0A0W8DCS9_PHYNI/24-117     AC A0A0W8DCS9.1
#=GS R8VTD3_9CLOT/45-132         AC R8VTD3.1
#=GS A0A1H9EID7_9LACT/94-260     AC A0A1H9EID7.1
#=GS A0A445LMN9_GLYSO/197-305    AC A0A445LMN9.1
#=GS A0A2I0SNZ6_9ACTN/91-196     AC A0A2I0SNZ6.1
#=GS A0A166HZH3_DAUCS/217-315    AC A0A166HZH3.1
#=GS A0A1H2STE0_9ALTE/148-237    AC A0A1H2STE0.1
#=GS A0A0N4U4A4_DRAME/42-133     AC A0A0N4U4A4.1
#=GS A0A2G5C788_AQUCA/58-149     AC A0A2G5C788.1
#=GS A0A1Q5U0F3_9EURO/34-123     AC A0A1Q5U0F3.1
#=GS A0A2P6UAY7_9ACTN/17-129     AC A0A2P6UAY7.1
#=GS A0A1Q4Y6C4_9ACTN/73-178     AC A0A1Q4Y6C4.1
#=GS A0A3B6RS39_WHEAT/55-146     AC A0A3B6RS39.1
#=GS A0A287KQH4_HORVV/63-176     AC A0A287KQH4.1
#=GS A0A251SSA3_HELAN/225-327    AC A0A251SSA3.1
#=GS A0A2T7EUE2_9POAL/186-295    AC A0A2T7EUE2.1
#=GS A0A1V1YE66_9ACTN/14-119     AC A0A1V1YE66.1
#=GS A0A023BW74_9FLAO/20-112     AC A0A023BW74.1
#=GS A0A0E0E0V7_9ORYZ/181-296    AC A0A0E0E0V7.1
#=GS B9XCR2_PEDPL/33-114         AC B9XCR2.1
#=GS A0A1Y2D256_9FUNG/184-274    AC A0A1Y2D256.1
#=GS A0A0E0AF47_9ORYZ/142-247    AC A0A0E0AF47.1
#=GS A0A397GIB1_9EURO/70-173     AC A0A397GIB1.1
#=GS M1BDJ1_SOLTU/64-176         AC M1BDJ1.1
#=GS A0A445KAX1_GLYSO/180-288    AC A0A445KAX1.1
#=GS G4ULU9_NEUT9/37-123         AC G4ULU9.1
#=GS A0A287PY07_HORVV/8-116      AC A0A287PY07.1
#=GS A0A286DUF5_9ACTN/49-137     AC A0A286DUF5.1
#=GS Q9NAM9_CAEEL/21-116         AC Q9NAM9.3
#=GS A0A1H8Y9U2_9PSEU/76-190     AC A0A1H8Y9U2.1
#=GS A0A0D2S0R0_GOSRA/71-183     AC A0A0D2S0R0.1
#=GS A0A2A2LRZ7_9BILA/24-111     AC A0A2A2LRZ7.1
#=GS A0A428U3Y0_9HYPO/33-122     AC A0A428U3Y0.1
#=GS A0A2G2WF94_CAPBA/55-142     AC A0A2G2WF94.1
#=GS D0P2U9_PHYIT/3-101          AC D0P2U9.1
#=GS C6LI97_9FIRM/64-158         AC C6LI97.1
#=GS B9H4H5_POPTR/58-149         AC B9H4H5.1
#=GS A0A3B6KHJ4_WHEAT/84-203     AC A0A3B6KHJ4.1
#=GS A0A445HBW1_GLYSO/67-178     AC A0A445HBW1.1
#=GS A0A445B2Y5_ARAHY/83-183     AC A0A445B2Y5.1
#=GS A0A428NH39_9HYPO/33-122     AC A0A428NH39.1
#=GS A0A2P6P4Y8_ROSCH/179-287    AC A0A2P6P4Y8.1
#=GS A0A1B8DUH5_9PEZI/35-126     AC A0A1B8DUH5.1
#=GS W2KFX9_PHYPR/90-188         AC W2KFX9.1
#=GS J2WIC6_9SPHN/41-138         AC J2WIC6.1
#=GS A0A314Z1K5_PRUYE/14-98      AC A0A314Z1K5.1
#=GS A0A1Y4S263_9FIRM/1067-1173  AC A0A1Y4S263.1
#=GS V4UHK9_9ROSI/54-145         AC V4UHK9.1
#=GS A0A177HP59_9ACTN/74-190     AC A0A177HP59.1
#=GS A0A0X8WRD1_9CYAN/52-142     AC A0A0X8WRD1.1
#=GS A9UQK5_MONBE/1029-1132      AC A9UQK5.1
#=GS A0A1B8DII2_9PEZI/70-174     AC A0A1B8DII2.1
#=GS A0A2T4BTF6_TRILO/64-169     AC A0A2T4BTF6.1
#=GS A0A117J3G2_9FIRM/30-126     AC A0A117J3G2.1
#=GS A0A1H1MW70_9FLAO/24-110     AC A0A1H1MW70.1
#=GS A0A3L6SKG0_PANMI/64-155     AC A0A3L6SKG0.1
#=GS A0A2S1QTS2_9FLAO/23-110     AC A0A2S1QTS2.1
#=GS W5N433_LEPOC/31-124         AC W5N433.1
#=GS A0A016S2P7_9BILA/40-134     AC A0A016S2P7.1
#=GS A0A0W8DVY2_PHYNI/127-222    AC A0A0W8DVY2.1
#=GS A0A0P0CGQ0_9FLAO/35-131     AC A0A0P0CGQ0.1
#=GS A0A3R7M0I5_9EURO/70-173     AC A0A3R7M0I5.1
#=GS A0A2P6TB37_CHLSO/306-463    AC A0A2P6TB37.1
#=GS A0A238UDN1_9FLAO/21-113     AC A0A238UDN1.1
#=GS A0A067FW44_CITSI/169-277    AC A0A067FW44.1
#=GS A0A1C4S8W9_9ACTN/74-179     AC A0A1C4S8W9.1
#=GS A0A453K9K2_AEGTS/108-196    AC A0A453K9K2.1
#=GS A0A0E0FM02_ORYNI/141-229    AC A0A0E0FM02.1
#=GS A0A3B6NMP7_WHEAT/63-155     AC A0A3B6NMP7.1
#=GS A0A0E0E495_9ORYZ/54-145     AC A0A0E0E495.1
#=GS A0A2H5P0I5_CITUN/61-152     AC A0A2H5P0I5.1
#=GS A0A1R1D0S8_9BACL/227-324    AC A0A1R1D0S8.1
#=GS I2GN31_9BACT/30-112         AC I2GN31.1
#=GS A0A3R7IET5_9EURO/25-112     AC A0A3R7IET5.1
#=GS A2R120_ASPNC/33-122         AC A2R120.1
#=GS A0A268SNG9_9BACL/1078-1177  AC A0A268SNG9.1
#=GS C5WSX6_SORBI/66-179         AC C5WSX6.2
#=GS A0A059ACB2_EUCGR/220-322    AC A0A059ACB2.1
#=GS A0A067LB19_JATCU/144-247    AC A0A067LB19.1
#=GS A0A368JD69_9BACT/210-297    AC A0A368JD69.1
#=GS A0A443I2W8_BYSSP/72-175     AC A0A443I2W8.1
#=GS A0A0A1SY42_9HYPO/34-121     AC A0A0A1SY42.1
#=GS A0A444Y4I9_ARAHY/58-151     AC A0A444Y4I9.1
#=GS A0A0D3HRH5_9ORYZ/55-142     AC A0A0D3HRH5.1
#=GS A0A0S3SEH8_PHAAN/224-326    AC A0A0S3SEH8.1
#=GS A0A2K6KCP7_RHIBE/32-125     AC A0A2K6KCP7.1
#=GS A0A2R6PRH2_ACTCH/43-134     AC A0A2R6PRH2.1
#=GS A0A0D9PID8_METAN/35-123     AC A0A0D9PID8.1
#=GS A0A1B7URA3_9GAMM/47-143     AC A0A1B7URA3.1
#=GS A0A1X1Q8V6_9FIRM/58-149     AC A0A1X1Q8V6.1
#=GS A0A061GPZ6_THECC/62-153     AC A0A061GPZ6.1
#=GS A0A287QYS4_HORVV/6-93       AC A0A287QYS4.1
#=GS A0A1Y4S0K4_9FIRM/55-150     AC A0A1Y4S0K4.1
#=GS A0A2I0XAA6_9ASPA/44-129     AC A0A2I0XAA6.1
#=GS A0A1R3HPD4_9ROSI/171-279    AC A0A1R3HPD4.1
#=GS W9RU81_9ROSA/231-335        AC W9RU81.1
#=GS D8SSG3_SELML/38-128         AC D8SSG3.1
#=GS M0RCA8_RAT/1-85             AC M0RCA8.2
#=GS A0A1N7F210_9ACTN/48-142     AC A0A1N7F210.1
#=GS A0A0G3M6M5_9FLAO/22-109     AC A0A0G3M6M5.1
#=GS D7WF92_9CORY/80-236         AC D7WF92.1
#=GS V4UHE3_9ROSI/61-152         AC V4UHE3.1
#=GS A0A2V0PC07_9CHLO/41-155     AC A0A2V0PC07.1
#=GS A0A1S3XXP9_TOBAC/47-135     AC A0A1S3XXP9.1
#=GS D0NUN2_PHYIT/69-166         AC D0NUN2.1
#=GS A0A267DPC1_9PLAT/61-156     AC A0A267DPC1.1
#=GS A0A0A0KRS7_CUCSA/198-300    AC A0A0A0KRS7.1
#=GS A0A0C4WHQ3_9GAMM/45-141     AC A0A0C4WHQ3.1
#=GS A0A2T7DFL1_9POAL/208-311    AC A0A2T7DFL1.1
#=GS V5GDC5_BYSSN/32-119         AC V5GDC5.1
#=GS A0A453KAL0_AEGTS/1-77       AC A0A453KAL0.1
#=GS A0A445K3V6_GLYSO/64-155     AC A0A445K3V6.1
#=GS D8S9C8_SELML/141-244        AC D8S9C8.1
#=GS A0A1H7SZP8_9BURK/54-151     AC A0A1H7SZP8.1
#=GS A0A1R3G4M7_COCAP/68-158     AC A0A1R3G4M7.1
#=GS M0WKF7_HORVV/25-108         AC M0WKF7.1
#=GS A0A1E7NGR9_KITAU/87-180     AC A0A1E7NGR9.1
#=GS A0A287TJ88_HORVV/85-177     AC A0A287TJ88.1
#=GS A0A329SN63_9STRA/100-198    AC A0A329SN63.1
#=GS A0A2I0BEZ5_9ASPA/109-205    AC A0A2I0BEZ5.1
#=GS A0A2H5B9X0_9ACTN/41-134     AC A0A2H5B9X0.1
#=GS A0A2P2E6W2_9PROT/58-171     AC A0A2P2E6W2.1
#=GS W9SFG9_9ROSA/62-153         AC W9SFG9.1
#=GS A0A1R3SYE7_9BACT/267-364    AC A0A1R3SYE7.1
#=GS A0A329SXS1_9STRA/61-158     AC A0A329SXS1.1
#=GS A0A225DZW1_9BACT/16-112     AC A0A225DZW1.1
#=GS A0A0D1Y2P3_9EURO/28-118     AC A0A0D1Y2P3.1
#=GS A0A199W6S8_ANACO/205-306    AC A0A199W6S8.1
#=GS A0A2X0IJI5_9ACTN/73-166     AC A0A2X0IJI5.1
#=GS A0A1B6PIJ7_SORBI/177-295    AC A0A1B6PIJ7.1
#=GS A0A239TLQ7_9STAP/98-250     AC A0A239TLQ7.1
#=GS A0A443QKL5_9ACAR/1-78       AC A0A443QKL5.1
#=GS A0A251SZD9_HELAN/64-156     AC A0A251SZD9.1
#=GS A0A2V2NBZ0_9EURY/33-121     AC A0A2V2NBZ0.1
#=GS A0A1L9PBL2_ASPVE/31-120     AC A0A1L9PBL2.1
#=GS A0A415R689_9FIRM/71-163     AC A0A415R689.1
#=GS A0A2U1N256_ARTAN/52-139     AC A0A2U1N256.1
#=GS A0A0D2B3E4_9EURO/95-198     AC A0A0D2B3E4.1
#=GS H3SML1_9BACL/213-323        AC H3SML1.1
#=GS A0A2V3JKC3_9EURY/246-333    AC A0A2V3JKC3.1
#=GS A0A2G8LIT7_STIJA/31-117     AC A0A2G8LIT7.1
#=GS A0A1Y1VE46_9FUNG/138-236    AC A0A1Y1VE46.1
#=GS A0A453FQR5_AEGTS/77-180     AC A0A453FQR5.1
#=GS M4BQC8_HYAAE/1-83           AC M4BQC8.1
#=GS A0A370N9A2_9BURK/54-150     AC A0A370N9A2.1
#=GS C6W7F0_DYAFD/230-326        AC C6W7F0.1
#=GS A0A368RCE3_SETIT/213-319    AC A0A368RCE3.1
#=GS A0A453JWD2_AEGTS/1-95       AC A0A453JWD2.1
#=GS A0A1U7XGR4_NICSY/71-183     AC A0A1U7XGR4.1
#=GS W2H4L7_PHYPR/189-294        AC W2H4L7.1
#=GS A0A1S3IUQ3_LINUN/35-126     AC A0A1S3IUQ3.1
#=GS A0A445LVN1_GLYSO/52-144     AC A0A445LVN1.1
#=GS A0A1G5G1V3_9ACTN/77-183     AC A0A1G5G1V3.1
#=GS L7FGK7_9ACTN/75-180         AC L7FGK7.1
#=GS A0A0S6XLN1_9FUNG/70-174     AC A0A0S6XLN1.1
#=GS A0A2W2EQD2_9ACTN/43-162     AC A0A2W2EQD2.1
#=GS A0A200QXL5_9MAGN/75-186     AC A0A200QXL5.1
#=GS A0A2I4E2M3_JUGRE/55-145     AC A0A2I4E2M3.1
#=GS A0A1S4DC85_TOBAC/61-152     AC A0A1S4DC85.1
#=GS A0A445EQL7_ARAHY/185-293    AC A0A445EQL7.1
#=GS A0A2K2B8Q6_POPTR/71-182     AC A0A2K2B8Q6.2
#=GS D7T8B0_VITVI/42-130         AC D7T8B0.1
#=GS A0A1D1VJT3_RAMVA/46-138     AC A0A1D1VJT3.1
#=GS A0A3N2E078_9GAMM/25-113     AC A0A3N2E078.1
#=GS A0A445H0L7_GLYSO/70-160     AC A0A445H0L7.1
#=GS A0A2T0VD81_9MICO/48-141     AC A0A2T0VD81.1
#=GS A0A0D3C9X7_BRAOL/144-247    AC A0A0D3C9X7.1
#=GS A0A453J6B9_AEGTS/122-230    AC A0A453J6B9.1
#=GS A0A2I0L7W2_PUNGR/69-181     AC A0A2I0L7W2.1
#=GS A0A1I7V1P2_9PELO/21-105     AC A0A1I7V1P2.1
#=GS D8SZI9_SELML/1-89           AC D8SZI9.1
#=GS A0A1U8AYI1_NELNU/219-321    AC A0A1U8AYI1.1
#=GS A0A2S4Z4F6_9ACTN/74-179     AC A0A2S4Z4F6.1
#=GS A0A0D3VIJ2_9BACL/317-425    AC A0A0D3VIJ2.1
#=GS A0A453K9W8_AEGTS/81-169     AC A0A453K9W8.1
#=GS A0A143PX72_9BACT/41-137     AC A0A143PX72.1
#=GS A0A1X7L9P8_9BACL/40-141     AC A0A1X7L9P8.1
#=GS A0A2V0P5W8_9CHLO/118-220    AC A0A2V0P5W8.1
#=GS A0A251QQX5_PRUPE/68-181     AC A0A251QQX5.1
#=GS A0A0D2WTG5_CAPO3/21-115     AC A0A0D2WTG5.1
#=GS I1H4B9_BRADI/148-254        AC I1H4B9.1
#=GS A0A2T6D7H9_9BACT/25-120     AC A0A2T6D7H9.1
#=GS A0A2P5SJ68_GOSBA/70-161     AC A0A2P5SJ68.1
#=GS A0A2U0H3B4_9MICO/45-141     AC A0A2U0H3B4.1
#=GS W4H495_9STRA/232-325        AC W4H495.1
#=GS A0A0B8NPP7_9VIBR/56-142     AC A0A0B8NPP7.1
#=GS A0A087Y4G6_POEFO/47-140     AC A0A087Y4G6.2
#=GS A0A0D3CTG9_BRAOL/49-136     AC A0A0D3CTG9.1
#=GS A0A1Q3BDV1_CEPFO/101-188    AC A0A1Q3BDV1.1
#=GS A0A0Q5TNK1_9BACT/36-132     AC A0A0Q5TNK1.1
#=GS M0SPT3_MUSAM/121-212        AC M0SPT3.1
#=GS A0A319ENC9_ASPSB/30-133     AC A0A319ENC9.1
#=GS A0A453M6T1_AEGTS/73-164     AC A0A453M6T1.1
#=GS A0A067HAB4_CITSI/1-89       AC A0A067HAB4.1
#=GS A0A287QN64_HORVV/7-98       AC A0A287QN64.1
#=GS I1P8V7_ORYGL/171-279        AC I1P8V7.1
#=GS A0A0E0RJ36_ORYRU/173-281    AC A0A0E0RJ36.1
#=GS A0A0C9XZ06_9AGAR/35-125     AC A0A0C9XZ06.1
#=GS A0A1M5VFM9_9CLOT/241-328    AC A0A1M5VFM9.1
#=GS A0A420XT64_9ACTN/56-149     AC A0A420XT64.1
#=GS A0A0N5B9X4_STREA/59-147     AC A0A0N5B9X4.1
#=GS A0A3E1NCY9_9BACT/35-117     AC A0A3E1NCY9.1
#=GS M0U5B2_MUSAM/73-185         AC M0U5B2.1
#=GS A0A0H1ASN6_9GAMM/46-143     AC A0A0H1ASN6.1
#=GS A0A287KQG9_HORVV/15-97      AC A0A287KQG9.1
#=GS A0A2U1N0T1_ARTAN/46-133     AC A0A2U1N0T1.1
#=GS B4GTD6_DROPE/42-143         AC B4GTD6.1
#=GS A0A059DEL7_EUCGR/27-114     AC A0A059DEL7.1
#=GS A0A0A2TKX5_9BACI/36-136     AC A0A0A2TKX5.1
#=GS A0A1P8BA48_ARATH/96-204     AC A0A1P8BA48.1
#=GS A0A251RV34_HELAN/116-225    AC A0A251RV34.1
#=GS A0A0S7DNW0_9EURO/34-121     AC A0A0S7DNW0.1
#=GS M4F825_BRARP/53-147         AC M4F825.1
#=GS B8NXS3_ASPFN/68-171         AC B8NXS3.1
#=GS A0A287QK92_HORVV/86-194     AC A0A287QK92.1
#=GS A0A453D6Z8_AEGTS/1-90       AC A0A453D6Z8.1
#=GS N1RV39_FUSC4/28-117         AC N1RV39.1
#=GS A0A0D3BDX7_BRAOL/61-152     AC A0A0D3BDX7.1
#=GS W1PQF6_AMBTC/170-278        AC W1PQF6.1
#=GS A0A3Q9R030_9BACI/53-171     AC A0A3Q9R030.1
#=GS A0A2K1J1L2_PHYPA/77-168     AC A0A2K1J1L2.1
#=GS A0A0C3HH11_9PEZI/36-123     AC A0A0C3HH11.1
#=GS A0A1M4VRR0_9BACT/44-145     AC A0A1M4VRR0.1
#=GS A0A2I4HB11_JUGRE/55-145     AC A0A2I4HB11.1
#=GS A0A453ELP5_AEGTS/10-92      AC A0A453ELP5.1
#=GS A0A059AN39_EUCGR/65-156     AC A0A059AN39.1
#=GS A0A1S3VWK7_VIGRR/226-328    AC A0A1S3VWK7.1
#=GS A0A061FSS3_THECC/836-939    AC A0A061FSS3.1
#=GS A0A0E0AT81_9ORYZ/78-204     AC A0A0E0AT81.1
#=GS A0A086AU08_9FLAO/22-109     AC A0A086AU08.1
#=GS A0A0E0BUF4_9ORYZ/120-228    AC A0A0E0BUF4.1
#=GS A0A3N4RRF1_9ACTN/71-176     AC A0A3N4RRF1.1
#=GS A0A1H8RR42_9ACTN/70-163     AC A0A1H8RR42.1
#=GS A0A2C6CY84_9BACT/24-109     AC A0A2C6CY84.1
#=GS W6UZE3_ECHGR/20-116         AC W6UZE3.1
#=GS V4LMA7_EUTSA/171-279        AC V4LMA7.1
#=GS D8QZ38_SELML/204-301        AC D8QZ38.1
#=GS A0A167U952_9HYPO/28-119     AC A0A167U952.1
#=GS A0A494XJF3_9BURK/56-152     AC A0A494XJF3.1
#=GS A8LCL7_FRASN/43-142         AC A8LCL7.1
#=GS A0A3M2I202_9GAMM/2-97       AC A0A3M2I202.1
#=GS A8XTN4_CAEBR/46-139         AC A8XTN4.2
#=GS A0A194QMF5_PAPXU/33-124     AC A0A194QMF5.1
#=GS A0A1U7X1F8_NICSY/168-276    AC A0A1U7X1F8.1
#=GS A0A068TWJ7_COFCA/168-276    AC A0A068TWJ7.1
#=GS A0A059AD22_EUCGR/227-306    AC A0A059AD22.1
#=GS A0A1A9UMZ7_GLOAU/30-115     AC A0A1A9UMZ7.1
#=GS A0A2G2VR58_CAPBA/50-138     AC A0A2G2VR58.1
#=GS A0A287RUL5_HORVV/128-236    AC A0A287RUL5.1
#=GS A0A1U8QC28_NELNU/73-185     AC A0A1U8QC28.1
#=GS A0A287KQH6_HORVV/147-260    AC A0A287KQH6.1
#=GS A0A2K2DFL4_BRADI/89-192     AC A0A2K2DFL4.1
#=GS M5XSX1_PRUPE/147-250        AC M5XSX1.1
#=GS A0A2T7NWB1_POMCA/28-119     AC A0A2T7NWB1.1
#=GS A0A061NX16_9BACL/296-393    AC A0A061NX16.1
#=GS A0A1L9UDM8_ASPBC/33-122     AC A0A1L9UDM8.1
#=GS A0A1Y1I113_KLENI/96-258     AC A0A1Y1I113.1
#=GS S5VA43_STRC3/72-177         AC S5VA43.1
#=GS A0A1T2XNC6_9BACL/35-135     AC A0A1T2XNC6.1
#=GS A0A251TPP6_HELAN/56-148     AC A0A251TPP6.1
#=GS F6MIW5_WHEAT/63-176         AC F6MIW5.1
#=GS A0A1U8I736_GOSHI/47-139     AC A0A1U8I736.1
#=GS A0A3B0K7I4_DROGU/40-142     AC A0A3B0K7I4.1
#=GS H3H2X4_PHYRM/200-306        AC H3H2X4.1
#=GS A0A445G598_GLYSO/92-183     AC A0A445G598.1
#=GS A0A421GCW5_9STRA/569-667    AC A0A421GCW5.1
#=GS A0A2T7CKF5_9POAL/57-144     AC A0A2T7CKF5.1
#=GS A0A087SHZ1_AUXPR/76-202     AC A0A087SHZ1.1
#=GS A0A0D2SN18_GOSRA/60-151     AC A0A0D2SN18.1
#=GS A0A160T0S1_9CHLR/558-644    AC A0A160T0S1.2
#=GS A0A453L810_AEGTS/164-272    AC A0A453L810.1
#=GS M4DMM0_BRARP/163-260        AC M4DMM0.1
#=GS A0A1Y1IIR1_KLENI/51-161     AC A0A1Y1IIR1.1
#=GS A0A3B6RD19_WHEAT/172-285    AC A0A3B6RD19.1
#=GS A0A1Y1HR04_KLENI/65-182     AC A0A1Y1HR04.1
#=GS A0A0D9Z3X2_9ORYZ/171-279    AC A0A0D9Z3X2.1
#=GS A0A022R9B5_ERYGU/1-76       AC A0A022R9B5.1
#=GS V9NC17_MANES/174-282        AC V9NC17.1
#=GS T1KY42_TETUR/31-122         AC T1KY42.1
#=GS A0A0E0GI83_ORYNI/515-609    AC A0A0E0GI83.1
#=GS A0A1S2Y7F9_CICAR/44-135     AC A0A1S2Y7F9.1
#=GS A0A1A9WVN1_9MUSC/460-553    AC A0A1A9WVN1.1
#=GS A0A1U7YJP0_NICSY/53-144     AC A0A1U7YJP0.1
#=GS A0A0E3Z596_9GAMM/36-131     AC A0A0E3Z596.1
#=GS A0A132PLU3_9MYCO/55-148     AC A0A132PLU3.1
#=GS A0A2P6VS99_9CHLO/67-183     AC A0A2P6VS99.1
#=GS A0A177VVN2_9BASI/719-819    AC A0A177VVN2.1
#=GS A0A2G7FNQ8_9EURO/34-123     AC A0A2G7FNQ8.1
#=GS A0A1V4I9C3_9CLOT/47-143     AC A0A1V4I9C3.1
#=GS U5RWF2_9CLOT/45-120         AC U5RWF2.1
#=GS A0A182XBA7_ANOQN/32-123     AC A0A182XBA7.1
#=GS A0A0K3CLM7_RHOTO/45-137     AC A0A0K3CLM7.1
#=GS A0A2P8HP76_9BACT/42-124     AC A0A2P8HP76.1
#=GS A0A0E0LT87_ORYPU/78-203     AC A0A0E0LT87.1
#=GS I1PCV2_ORYGL/80-167         AC I1PCV2.1
#=GS A0A1V6UXZ4_9EURO/33-119     AC A0A1V6UXZ4.1
#=GS A0A3M6UKC2_9CNID/492-585    AC A0A3M6UKC2.1
#=GS A0A1J7BG00_9ACTN/60-154     AC A0A1J7BG00.1
#=GS A0A2T3B754_AMORE/29-120     AC A0A2T3B754.1
#=GS V5F3S4_KALBG/78-166         AC V5F3S4.1
#=GS M0YS07_HORVV/1-76           AC M0YS07.1
#=GS A0A2W0CZ61_9MICO/55-170     AC A0A2W0CZ61.1
#=GS A0A371AR12_9FIRM/57-160     AC A0A371AR12.1
#=GS A0A1X1RTK2_MYCCE/53-146     AC A0A1X1RTK2.1
#=GS A0A059WI67_STRA9/53-146     AC A0A059WI67.1
#=GS A0A2K2DFH3_BRADI/78-181     AC A0A2K2DFH3.1
#=GS A0A2G9GAS4_9LAMI/168-276    AC A0A2G9GAS4.1
#=GS A0A167HIN9_9HYPO/34-123     AC A0A167HIN9.1
#=GS V9NCA3_MANES/53-140         AC V9NCA3.1
#=GS R0HKR9_9BRAS/51-138         AC R0HKR9.1
#=GS A0A2I0HV98_PUNGR/62-153     AC A0A2I0HV98.1
#=GS A0A1D6HR96_MAIZE/144-249    AC A0A1D6HR96.1
#=GS A0A3M2M4Y6_9ACTN/58-146     AC A0A3M2M4Y6.1
#=GS A0A1B8GKJ4_9PEZI/39-130     AC A0A1B8GKJ4.1
#=GS U5CRL6_AMBTC/49-159         AC U5CRL6.1
#=GS A0A0D2SNF0_GOSRA/56-147     AC A0A0D2SNF0.1
#=GS A0A287WJJ3_HORVV/1-101      AC A0A287WJJ3.1
#=GS A0A1U7Y6X6_NICSY/56-147     AC A0A1U7Y6X6.1
#=GS A0A453L825_AEGTS/63-171     AC A0A453L825.1
#=GS A0A0F5JDM1_9BACT/28-117     AC A0A0F5JDM1.1
#=GS A0A200QHH2_9MAGN/62-153     AC A0A200QHH2.1
#=GS A0A398AEF6_BRACM/5-51       AC A0A398AEF6.1
#=GS A0A061DV71_THECC/72-184     AC A0A061DV71.1
#=GS A0A143Y1D4_9FIRM/46-149     AC A0A143Y1D4.1
#=GS A0A371EHT7_MUCPR/72-184     AC A0A371EHT7.1
#=GS V7C5U3_PHAVU/169-277        AC V7C5U3.1
#=GS B4IDV2_DROSE/38-131         AC B4IDV2.1
#=GS A0A127AMD0_9DELT/640-722    AC A0A127AMD0.1
#=GS A0A2P5EWF5_TREOI/60-151     AC A0A2P5EWF5.1
#=GS A0A1Y1VL46_9FUNG/142-234    AC A0A1Y1VL46.1
#=GS A0A068S6G2_9FUNG/52-152     AC A0A068S6G2.1
#=GS A0A2K3Q9E1_9HYPO/34-121     AC A0A2K3Q9E1.1
#=GS V4SI19_9ROSI/59-150         AC V4SI19.1
#=GS M5VJZ9_PRUPE/69-159         AC M5VJZ9.1
#=GS A0A1P8Y694_9ACTN/52-145     AC A0A1P8Y694.1
#=GS A0A167D8C2_9HYPO/37-126     AC A0A167D8C2.1
#=GS F6HKJ9_VITVI/50-142         AC F6HKJ9.1
#=GS A0A268SJS4_9BACL/230-327    AC A0A268SJS4.1
#=GS A8WMV5_CAEBR/20-115         AC A8WMV5.1
#=GS A0A067F5F6_CITSI/43-130     AC A0A067F5F6.1
#=GS A0A2P5RIZ6_GOSBA/80-171     AC A0A2P5RIZ6.1
#=GS C8W6V2_DESAS/80-172         AC C8W6V2.1
#=GS A0A2U0ZNL7_9BACT/33-115     AC A0A2U0ZNL7.1
#=GS A0A1U8EXF4_CAPAN/168-276    AC A0A1U8EXF4.1
#=GS A0A2J6K5R7_LACSA/17-108     AC A0A2J6K5R7.1
#=GS A0A453L826_AEGTS/178-287    AC A0A453L826.1
#=GS A0A133VRQ0_9EURY/407-493    AC A0A133VRQ0.1
#=GS A0A0K9PG31_ZOSMR/45-134     AC A0A0K9PG31.1
#=GS A0A371GAX4_MUCPR/180-288    AC A0A371GAX4.1
#=GS A0A2K6BX02_MACNE/1-86       AC A0A2K6BX02.1
#=GS M0RXL0_MUSAM/79-191         AC M0RXL0.1
#=GS F2DH21_HORVV/59-150         AC F2DH21.1
#=GS A0A498HWM5_MALDO/64-155     AC A0A498HWM5.1
#=GS A0A2P5DVL0_PARAD/180-288    AC A0A2P5DVL0.1
#=GS A0A1Y3XI06_9FIRM/1186-1282  AC A0A1Y3XI06.1
#=GS A0A387BMR8_9MICO/50-145     AC A0A387BMR8.1
#=GS A0A182QGY8_9DIPT/35-126     AC A0A182QGY8.1
#=GS G0J3W0_CYCMS/24-109         AC G0J3W0.1
#=GS A0A370TES7_9PEZI/40-131     AC A0A370TES7.1
#=GS A0A1U7ZWL1_NELNU/146-249    AC A0A1U7ZWL1.1
#=GS A0A286DVV0_9ACTN/985-1075   AC A0A286DVV0.1
#=GS A0A2K2CTT8_BRADI/1-77       AC A0A2K2CTT8.1
#=GS A0A1R4FKM1_9MICO/1186-1281  AC A0A1R4FKM1.1
#=GS A0A1E7MWW4_KITAU/41-134     AC A0A1E7MWW4.1
#=GS A0A1S2XJA9_CICAR/169-277    AC A0A1S2XJA9.1
#=GS A0A059ANY0_EUCGR/67-158     AC A0A059ANY0.1
#=GS A0A453K9J5_AEGTS/108-196    AC A0A453K9J5.1
#=GS A0A0D2USK7_CAPO3/36-148     AC A0A0D2USK7.1
#=GS A0A2P6TLE4_CHLSO/784-900    AC A0A2P6TLE4.1
#=GS A0A1I3KIE1_9BURK/54-150     AC A0A1I3KIE1.1
#=GS A0A0D3C281_BRAOL/111-202    AC A0A0D3C281.1
#=GS PPA10_ARATH/59-150          AC Q9SIV9.1
#=GS A0A1Y2A3U4_9FUNG/99-190     AC A0A1Y2A3U4.1
#=GS A0A0B4H9P5_METMF/5-83       AC A0A0B4H9P5.1
#=GS A0A445FIN1_GLYSO/48-136     AC A0A445FIN1.1
#=GS A0A1H9UZ76_9SPHI/46-144     AC A0A1H9UZ76.1
#=GS A0A1U8JS28_GOSHI/70-161     AC A0A1U8JS28.1
#=GS A0A0R0HQB8_SOYBN/47-134     AC A0A0R0HQB8.1
#=GS D8SRM3_SELML/1-86           AC D8SRM3.1
#=GS A0A127W4D1_SPOPS/38-136     AC A0A127W4D1.1
#=GS A0A316V6K3_9BASI/31-117     AC A0A316V6K3.1
#=GS F4PIX4_CAVFA/23-124         AC F4PIX4.1
#=GS A0A1B1SD06_9BACT/263-362    AC A0A1B1SD06.2
#=GS A0A0D9XP47_9ORYZ/219-308    AC A0A0D9XP47.1
#=GS A0A370EFQ2_9FLAO/18-110     AC A0A370EFQ2.1
#=GS A0A0Q0ZDH1_9SPHI/48-144     AC A0A0Q0ZDH1.1
#=GS A0A0E0BVP6_9ORYZ/507-601    AC A0A0E0BVP6.1
#=GS A0A251QA21_PRUPE/220-322    AC A0A251QA21.1
#=GS A0A2P5EC65_TREOI/48-134     AC A0A2P5EC65.1
#=GS K9XFY6_9CHRO/34-114         AC K9XFY6.1
#=GS A0A1I8EC65_WUCBA/46-137     AC A0A1I8EC65.1
#=GS A0A498HKH1_MALDO/264-371    AC A0A498HKH1.1
#=GS A0A347WJ06_9LACT/47-202     AC A0A347WJ06.1
#=GS A0A0E0RKH2_ORYRU/59-150     AC A0A0E0RKH2.1
#=GS A0A1M6BIC9_9FLAO/30-121     AC A0A1M6BIC9.1
#=GS A0A068UPV9_COFCA/54-145     AC A0A068UPV9.1
#=GS A0A2K3CVM3_CHLRE/67-187     AC A0A2K3CVM3.1
#=GS A0A182FKS4_ANOAL/30-121     AC A0A182FKS4.1
#=GS A0A3B6GRR2_WHEAT/99-212     AC A0A3B6GRR2.1
#=GS I1N686_SOYBN/72-183         AC I1N686.2
#=GS A0A101UN09_9ACTN/73-178     AC A0A101UN09.1
#=GS G7JZ41_MEDTR/176-284        AC G7JZ41.2
#=GS A0A1I5J4V6_9BACT/43-144     AC A0A1I5J4V6.1
#=GS D7LFK9_ARALL/62-178         AC D7LFK9.1
#=GS A0A444ZUB4_ARAHY/165-268    AC A0A444ZUB4.1
#=GS E6U9D8_ETHHY/1152-1253      AC E6U9D8.1
#=GS R4TAD1_9PSEU/78-190         AC R4TAD1.1
#=GS A0A2V5ICY8_9EURO/70-173     AC A0A2V5ICY8.1
#=GS W5WEH6_9PSEU/85-199         AC W5WEH6.1
#=GS A0A420F335_9ACTN/48-142     AC A0A420F335.1
#=GS I1KC33_SOYBN/180-288        AC I1KC33.1
#=GS A0A3B6I504_WHEAT/172-285    AC A0A3B6I504.1
#=GS A0A371PUA7_9ACTN/63-168     AC A0A371PUA7.1
#=GS A1DFH4_NEOFI/1-75           AC A1DFH4.1
#=GS A0A1J7G9Q1_LUPAN/152-260    AC A0A1J7G9Q1.1
#=GS A0A453KAK5_AEGTS/3-90       AC A0A453KAK5.1
#=GS W2PKA6_PHYPN/471-570        AC W2PKA6.1
#=GS I1LUX6_SOYBN/62-153         AC I1LUX6.2
#=GS A0A3B7NAW5_9BACT/25-107     AC A0A3B7NAW5.1
#=GS A0A1G7HER7_9FLAO/58-164     AC A0A1G7HER7.1
#=GS A0A2T3ZV77_TRIHA/67-170     AC A0A2T3ZV77.1
#=GS A0A0S7DST7_9EURO/51-138     AC A0A0S7DST7.1
#=GS A0A498IHQ4_MALDO/49-136     AC A0A498IHQ4.1
#=GS A0A109FHE3_9BASI/46-138     AC A0A109FHE3.1
#=GS A0A1Q9JWC8_9FIRM/79-164     AC A0A1Q9JWC8.1
#=GS A0A0H5S844_BRUMA/46-137     AC A0A0H5S844.1
#=GS B8B0P6_ORYSI/54-145         AC B8B0P6.1
#=GS A0A0K9PN95_ZOSMR/57-147     AC A0A0K9PN95.1
#=GS A0A453EM48_AEGTS/63-176     AC A0A453EM48.1
#=GS A0A314Y249_PRUYE/50-161     AC A0A314Y249.1
#=GS A0A2G2XNM1_CAPBA/61-152     AC A0A2G2XNM1.1
#=GS I1L5N5_SOYBN/54-145         AC I1L5N5.1
#=GS Q97MJ1_CLOAB/52-147         AC Q97MJ1.1
#=GS A0A268SJS4_9BACL/668-765    AC A0A268SJS4.1
#=GS A0A4D9AC84_SALSN/182-290    AC A0A4D9AC84.1
#=GS A0A0D2IZA3_9EURO/71-174     AC A0A0D2IZA3.1
#=GS D3BNQ0_POLPP/27-123         AC D3BNQ0.1
#=GS A0A1G5Y9Q8_9FIRM/933-1037   AC A0A1G5Y9Q8.1
#=GS A0A1H8YA89_9PSEU/49-163     AC A0A1H8YA89.1
#=GS A0A0D3HX62_9ORYZ/494-588    AC A0A0D3HX62.1
#=GS A0A327R4Z2_9BACT/58-156     AC A0A327R4Z2.1
#=GS A0A0P1AXZ2_PLAHL/196-302    AC A0A0P1AXZ2.1
#=GS A0A1V2SFS1_9BACI/494-597    AC A0A1V2SFS1.1
#=GS R6VTJ8_9BACT/28-116         AC R6VTJ8.1
#=GS A0A443QT99_9ACAR/1-78       AC A0A443QT99.1
#=GS A0A432VT09_9GAMM/52-163     AC A0A432VT09.1
#=GS A0A2R6PTB5_ACTCH/43-134     AC A0A2R6PTB5.1
#=GS A0A0F5VZR7_9ACTN/78-183     AC A0A0F5VZR7.1
#=GS A3XIJ1_LEEBM/27-111         AC A3XIJ1.1
#=GS A0A445FM11_GLYSO/19-101     AC A0A445FM11.1
#=GS X4ZXJ6_9BACL/39-136         AC X4ZXJ6.1
#=GS A0A1Y1I9D1_KLENI/148-251    AC A0A1Y1I9D1.1
#=GS A0A0E0IEZ7_ORYNI/176-287    AC A0A0E0IEZ7.1
#=GS A0A1S3ZJV0_TOBAC/46-134     AC A0A1S3ZJV0.1
#=GS A0A2T7BJ71_9BACT/38-116     AC A0A2T7BJ71.1
#=GS A0A2K6GXE7_PROCO/33-126     AC A0A2K6GXE7.1
#=GS A0A0K9R1X5_SPIOL/167-275    AC A0A0K9R1X5.1
#=GS A0A1U8PUY5_GOSHI/60-151     AC A0A1U8PUY5.1
#=GS A0A453JWE7_AEGTS/174-282    AC A0A453JWE7.1
#=GS B0N309_9FIRM/100-195        AC B0N309.1
#=GS R6CHA7_9BACE/292-391        AC R6CHA7.1
#=GS A0A498I6H2_MALDO/109-220    AC A0A498I6H2.1
#=GS A0A3Q7I0P8_SOLLC/53-144     AC A0A3Q7I0P8.1
#=GS A0A3B3V173_9TELE/28-121     AC A0A3B3V173.1
#=GS A0A1S3B8Q9_CUCME/62-153     AC A0A1S3B8Q9.1
#=GS V7BUC2_PHAVU/53-145         AC V7BUC2.1
#=GS F8EGW1_RUNSL/226-322        AC F8EGW1.1
#=GS A0A439D061_9PEZI/34-121     AC A0A439D061.1
#=GS A0A221AFQ5_9BURK/55-151     AC A0A221AFQ5.1
#=GS A0A2K3P163_TRIPR/40-131     AC A0A2K3P163.1
#=GS A0A2G8KG27_STIJA/69-160     AC A0A2G8KG27.1
#=GS A9RAY2_PHYPA/183-292        AC A9RAY2.1
#=GS G1NNL7_MELGA/386-478        AC G1NNL7.2
#=GS W4P5J0_9BACE/45-136         AC W4P5J0.1
#=GS A0A0H3J3Z7_CLOPA/61-155     AC A0A0H3J3Z7.1
#=GS A0A2R6QRZ2_ACTCH/62-153     AC A0A2R6QRZ2.1
#=GS A0A1B8CDF4_9PEZI/35-126     AC A0A1B8CDF4.1
#=GS A0A445HJ65_GLYSO/54-145     AC A0A445HJ65.1
#=GS A0A1J7GRA8_LUPAN/1-75       AC A0A1J7GRA8.1
#=GS A0A3B6MX68_WHEAT/63-177     AC A0A3B6MX68.1
#=GS A0A3B7MV84_9BACT/40-123     AC A0A3B7MV84.1
#=GS A0A287KQH2_HORVV/162-275    AC A0A287KQH2.1
#=GS A0A074YK33_AURSE/72-174     AC A0A074YK33.1
#=GS A2XDX3_ORYSI/171-279        AC A2XDX3.1
#=GS E3NH32_CAERE/2-78           AC E3NH32.1
#=GS A0A1S3VT20_VIGRR/216-318    AC A0A1S3VT20.1
#=GS A0A2P6TMK9_CHLSO/174-276    AC A0A2P6TMK9.1
#=GS D0MZH6_PHYIT/205-311        AC D0MZH6.1
#=GS A0A1E3QDX4_LIPST/32-123     AC A0A1E3QDX4.1
#=GS A0A0W8C030_PHYNI/140-238    AC A0A0W8C030.1
#=GS W7SIZ8_9PSEU/70-182         AC W7SIZ8.1
#=GS A0A2U1PXM6_ARTAN/61-152     AC A0A2U1PXM6.1
#=GS C6CS41_PAESJ/53-151         AC C6CS41.1
#=GS A0A151SR68_CAJCA/17-108     AC A0A151SR68.1
#=GS A0A445DPC3_ARAHY/172-280    AC A0A445DPC3.1
#=GS R6IAJ0_9FIRM/15-106         AC R6IAJ0.1
#=GS A0A068REN9_9FUNG/49-149     AC A0A068REN9.1
#=GS A0A1U7Z4A1_NELNU/58-149     AC A0A1U7Z4A1.1
#=GS I1M3C5_SOYBN/63-154         AC I1M3C5.2
#=GS A0A0K8LA61_9EURO/70-173     AC A0A0K8LA61.1
#=GS A0A1Q4WCM3_9ACTN/83-198     AC A0A1Q4WCM3.1
#=GS M0TB85_MUSAM/56-146         AC M0TB85.1
#=GS T0PQC7_SAPDV/19-119         AC T0PQC7.1
#=GS V4LZ80_EUTSA/451-538        AC V4LZ80.1
#=GS A0A1U8MBW0_GOSHI/58-149     AC A0A1U8MBW0.1
#=GS L8HFR9_ACACA/118-213        AC L8HFR9.1
#=GS A0A368GRQ6_ANCCA/1-81       AC A0A368GRQ6.1
#=GS I1IG27_BRADI/57-151         AC I1IG27.1
#=GS A2WVM5_ORYSI/57-148         AC A2WVM5.1
#=GS A0A078J8J0_BRANA/52-149     AC A0A078J8J0.1
#=GS D3B5R7_POLPP/17-115         AC D3B5R7.1
#=GS A0A0L1J205_ASPNO/68-171     AC A0A0L1J205.1
#=GS A0A1D6EDB4_MAIZE/115-223    AC A0A1D6EDB4.1
#=GS A0A1M6GCT6_9BACT/233-328    AC A0A1M6GCT6.1
#=GS K3YGQ2_SETIT/180-290        AC K3YGQ2.1
#=GS A0A059B316_EUCGR/76-187     AC A0A059B316.1
#=GS M5W3G9_PRUPE/70-160         AC M5W3G9.1
#=GS A0A363RW93_9GAMM/44-139     AC A0A363RW93.1
#=GS I1GVF8_BRADI/58-149         AC I1GVF8.1
#=GS A0A1M5UWB1_9BURK/32-114     AC A0A1M5UWB1.1
#=GS A0A453RMW2_AEGTS/102-224    AC A0A453RMW2.1
#=GS A0A2V4WKS2_9BACL/35-135     AC A0A2V4WKS2.1
#=GS A0A371G643_MUCPR/179-287    AC A0A371G643.1
#=GS A0A0E0M336_ORYPU/185-293    AC A0A0E0M336.1
#=GS A0A2G9H0R6_9LAMI/168-276    AC A0A2G9H0R6.1
#=GS H2QG98_PANTR/32-125         AC H2QG98.2
#=GS A0A061E9T4_THECC/139-243    AC A0A061E9T4.1
#=GS A0A1U8JTH3_GOSHI/70-161     AC A0A1U8JTH3.1
#=GS A0A0X3WXD8_9ACTN/84-189     AC A0A0X3WXD8.1
#=GS A0A3M6TMI4_9CNID/32-125     AC A0A3M6TMI4.1
#=GS A0A0S3R203_PHAAN/175-283    AC A0A0S3R203.1
#=GS A0A3N4PY62_9BACT/55-151     AC A0A3N4PY62.1
#=GS D8U202_VOLCA/218-340        AC D8U202.1
#=GS B6TKL3_MAIZE/68-155         AC B6TKL3.1
#=GS A0A194WXZ3_9HELO/31-116     AC A0A194WXZ3.1
#=GS A0A059A5M5_EUCGR/185-293    AC A0A059A5M5.1
#=GS D0NUG5_PHYIT/100-198        AC D0NUG5.1
#=GS A0A484DRY2_BRELC/240-346    AC A0A484DRY2.1
#=GS R7HAD7_9FIRM/92-188         AC R7HAD7.1
#=GS A0A0N8P242_DROAN/40-134     AC A0A0N8P242.1
#=GS A0A0A8WX00_9BACI/986-1091   AC A0A0A8WX00.1
#=GS A0A421DE62_9EURO/34-123     AC A0A421DE62.1
#=GS A0A0E3WHF2_9BACL/41-139     AC A0A0E3WHF2.1
#=GS W5WLW8_9PSEU/54-168         AC W5WLW8.1
#=GS M0S7P5_MUSAM/148-251        AC M0S7P5.1
#=GS A0A1S3USE0_VIGRR/62-153     AC A0A1S3USE0.1
#=GS W2RBY6_PHYPN/189-294        AC W2RBY6.1
#=GS A0A142YMD3_9PLAN/63-159     AC A0A142YMD3.1
#=GS A0A0R3Q331_9BILA/46-144     AC A0A0R3Q331.1
#=GS E3LNS3_CAERE/25-111         AC E3LNS3.1
#=GS A0A2J7QLU7_9NEOP/32-123     AC A0A2J7QLU7.1
#=GS A0A371GTE2_MUCPR/122-230    AC A0A371GTE2.1
#=GS A0A2P6PYZ2_ROSCH/44-136     AC A0A2P6PYZ2.1
#=GS A0A2C9UVK0_MANES/74-186     AC A0A2C9UVK0.1
#=GS A0A2C9M7R3_BIOGL/54-146     AC A0A2C9M7R3.1
#=GS R0GJP9_9BRAS/171-279        AC R0GJP9.1
#=GS A0A287XWP0_HORVV/55-146     AC A0A287XWP0.1
#=GS J3LQD1_ORYBR/76-163         AC J3LQD1.1
#=GS A0A2P7T9T7_9SPHI/25-118     AC A0A2P7T9T7.1
#=GS A0A443P8H9_9MAGN/177-285    AC A0A443P8H9.1
#=GS A0A453NAL0_AEGTS/76-168     AC A0A453NAL0.1
#=GS D3BQW1_POLPP/237-332        AC D3BQW1.1
#=GS A0A0R0HD94_SOYBN/72-174     AC A0A0R0HD94.1
#=GS A0A0E0MNX7_ORYPU/828-936    AC A0A0E0MNX7.1
#=GS A0A2H3G3E6_FUSOX/75-176     AC A0A2H3G3E6.1
#=GS A2ZI40_ORYSI/53-140         AC A2ZI40.1
#=GS A0A024GJF9_9STRA/41-144     AC A0A024GJF9.1
#=GS A0A200QFF1_9MAGN/173-276    AC A0A200QFF1.1
#=GS E1ZT85_CHLVA/185-288        AC E1ZT85.1
#=GS A0A2I4EP51_JUGRE/58-149     AC A0A2I4EP51.1
#=GS Z4WYZ2_9PORP/64-159         AC Z4WYZ2.1
#=GS A0A3G2JHV2_9ACTN/79-184     AC A0A3G2JHV2.1
#=GS A9V1G0_MONBE/141-242        AC A9V1G0.1
#=GS A0A319DJ06_9EURO/70-173     AC A0A319DJ06.1
#=GS A0A0D3VD52_9BACL/242-353    AC A0A0D3VD52.1
#=GS A0A316AP98_9BACT/31-127     AC A0A316AP98.1
#=GS E3NDP5_CAERE/20-115         AC E3NDP5.1
#=GS A0A453JWY8_AEGTS/83-191     AC A0A453JWY8.1
#=GS A0A016WRB2_9BILA/17-102     AC A0A016WRB2.1
#=GS A0A1U7ZC27_NELNU/110-201    AC A0A1U7ZC27.1
#=GS A0A2P6VID0_9CHLO/76-195     AC A0A2P6VID0.1
#=GS A0A2U1PGC2_ARTAN/60-151     AC A0A2U1PGC2.1
#=GS A0A2P6PPS1_ROSCH/15-85      AC A0A2P6PPS1.1
#=GS A0A1J7IB42_LUPAN/51-137     AC A0A1J7IB42.1
#=GS A0A0C3I1V4_9PEZI/31-116     AC A0A0C3I1V4.1
#=GS A0A2P6MX36_9MYCE/950-1051   AC A0A2P6MX36.1
#=GS A0A059B221_EUCGR/75-187     AC A0A059B221.1
#=GS A7SXA0_NEMVE/100-220        AC A7SXA0.1
#=GS A0A0B2XIK8_METRA/69-171     AC A0A0B2XIK8.1
#=GS A0A443QL82_9ACAR/1-78       AC A0A443QL82.1
#=GS A0A3P6TSS4_LITSI/51-142     AC A0A3P6TSS4.1
#=GS A0A061EU97_THECC/111-198    AC A0A061EU97.1
#=GS A0A067CXD4_SAPPC/195-286    AC A0A067CXD4.1
#=GS A0A2G3BW65_CAPCH/61-151     AC A0A2G3BW65.1
#=GS A0A0E4HFZ8_9BACL/1090-1189  AC A0A0E4HFZ8.1
#=GS A0A428PZ10_9HYPO/33-122     AC A0A428PZ10.1
#=GS A0A1V1P206_9DELT/29-115     AC A0A1V1P206.1
#=GS A0A2K1JC64_PHYPA/243-343    AC A0A2K1JC64.1
#=GS A0A067L7L1_JATCU/216-318    AC A0A067L7L1.1
#=GS L8H124_ACACA/143-245        AC L8H124.1
#=GS A0A1V9YH41_9STRA/24-118     AC A0A1V9YH41.1
#=GS A0A239AR20_9ACTN/38-136     AC A0A239AR20.1
#=GS I1KXK7_SOYBN/173-281        AC I1KXK7.1
#=GS A0A0Q9CC69_9CELL/241-332    AC A0A0Q9CC69.1
#=GS A0A287R090_HORVV/88-206     AC A0A287R090.1
#=GS A0A1D6G9W5_MAIZE/218-321    AC A0A1D6G9W5.1
#=GS A0A401I514_9BACL/598-704    AC A0A401I514.1
#=GS A0A0A0K128_CUCSA/85-176     AC A0A0A0K128.1
#=GS A0A2K3NU97_TRIPR/58-169     AC A0A2K3NU97.1
#=GS A0A0Q5C8R1_9MICO/56-171     AC A0A0Q5C8R1.1
#=GS D8LSG1_ECTSI/215-307        AC D8LSG1.1
#=GS A0A2I9DP87_9FLAO/30-114     AC A0A2I9DP87.1
#=GS A0A3B0C433_9FLAO/55-161     AC A0A3B0C433.1
#=GS A0A067GUF4_CITSI/216-319    AC A0A067GUF4.1
#=GS A0A0Q3JIL2_BRADI/121-234    AC A0A0Q3JIL2.1
#=GS R8VU84_9CLOT/55-155         AC R8VU84.1
#=GS A0A0E0R4B7_ORYRU/171-260    AC A0A0E0R4B7.1
#=GS A0A2T7Q3Q3_9BACT/37-133     AC A0A2T7Q3Q3.1
#=GS A0A1R3HZB4_9ROSI/58-149     AC A0A1R3HZB4.1
#=GS A0A1S3EHU0_CICAR/79-191     AC A0A1S3EHU0.1
#=GS R9PH34_AGAAL/242-332        AC R9PH34.1
#=GS A0A0M8VFT9_9ACTN/50-148     AC A0A0M8VFT9.1
#=GS A0A445E1P9_ARAHY/69-160     AC A0A445E1P9.1
#=GS A0A1S4BAI7_TOBAC/46-134     AC A0A1S4BAI7.1
#=GS A0A0L9TR78_PHAAN/62-153     AC A0A0L9TR78.1
#=GS A0A2U9CKR6_SCOMX/28-121     AC A0A2U9CKR6.1
#=GS A0A3Q9IFP0_9BACL/32-132     AC A0A3Q9IFP0.1
#=GS R0I1R1_9BRAS/64-176         AC R0I1R1.1
#=GS Q176W6_AEDAE/34-125         AC Q176W6.1
#=GS M4D254_BRARP/49-144         AC M4D254.1
#=GS A0A4D9C645_SALSN/53-156     AC A0A4D9C645.1
#=GS A0A445I5P9_GLYSO/60-151     AC A0A445I5P9.1
#=GS A0A1U7V4F3_TARSY/31-124     AC A0A1U7V4F3.1
#=GS A0A0A2IQY6_PENEN/33-122     AC A0A0A2IQY6.1
#=GS A0A103XHP6_CYNCS/72-186     AC A0A103XHP6.1
#=GS A0A1K1P4P5_9BACL/1073-1172  AC A0A1K1P4P5.1
#=GS A0A0W7WWI4_9ACTN/83-188     AC A0A0W7WWI4.1
#=GS A0A1Y4NQ93_9FIRM/59-151     AC A0A1Y4NQ93.1
#=GS A0A072UZV1_MEDTR/129-237    AC A0A072UZV1.1
#=GS D7FWJ2_ECTSI/62-167         AC D7FWJ2.1
#=GS D7SUZ1_VITVI/91-152         AC D7SUZ1.1
#=GS A0A445A6R4_ARAHY/56-147     AC A0A445A6R4.1
#=GS A0A061DNA0_THECC/72-184     AC A0A061DNA0.1
#=GS A0A0M8TU07_9ACTN/73-178     AC A0A0M8TU07.1
#=GS D8SDQ9_SELML/163-271        AC D8SDQ9.1
#=GS A0A2L2THU4_9HYPO/34-123     AC A0A2L2THU4.1
#=GS A0A367K1J2_9FUNG/59-160     AC A0A367K1J2.1
#=GS A0A3N1CSF8_9ACTN/47-141     AC A0A3N1CSF8.1
#=GS A0A0K0FW23_STRVS/28-124     AC A0A0K0FW23.1
#=GS I1K0B0_SOYBN/181-289        AC I1K0B0.2
#=GS A0A151X6Z2_9HYME/25-116     AC A0A151X6Z2.1
#=GS A0A2P5SJ95_GOSBA/60-151     AC A0A2P5SJ95.1
#=GS A0A4D9BNC1_SALSN/179-289    AC A0A4D9BNC1.1
#=GS A0A1Y1V6P7_9FUNG/145-236    AC A0A1Y1V6P7.1
#=GS A0A2V2PX63_9ACTN/970-1063   AC A0A2V2PX63.1
#=GS A0A0A2M0G3_9FLAO/20-110     AC A0A0A2M0G3.1
#=GS A0A250KTX0_9GAMM/33-116     AC A0A250KTX0.1
#=GS A0A251ST19_HELAN/49-136     AC A0A251ST19.1
#=GS E1TIH7_BURSG/54-150         AC E1TIH7.1
#=GS F4QBY0_CAVFA/143-245        AC F4QBY0.1
#=GS C5YQC5_SORBI/176-284        AC C5YQC5.1
#=GS A0A2M9R664_9FLAO/18-110     AC A0A2M9R664.1
#=GS A0A2U1P7Z1_ARTAN/1160-1269  AC A0A2U1P7Z1.1
#=GS I9LA22_9FIRM/2-76           AC I9LA22.1
#=GS A0A3Q0ICF6_PHODC/194-302    AC A0A3Q0ICF6.1
#=GS Q2J4R2_FRACC/106-200        AC Q2J4R2.1
#=GS A0A199VMG0_ANACO/50-144     AC A0A199VMG0.1
#=GS A0A022R2W2_ERYGU/53-144     AC A0A022R2W2.1
#=GS A0A2G5L2J9_9BACT/254-347    AC A0A2G5L2J9.1
#=GS A0A2D0NCF9_9BACT/32-128     AC A0A2D0NCF9.1
#=GS A0A445LMP2_GLYSO/197-305    AC A0A445LMP2.1
#=GS A0A1U8IR33_GOSHI/171-279    AC A0A1U8IR33.1
#=GS A0A140LJ99_MOUSE/32-107     AC A0A140LJ99.1
#=GS A0A059BMV1_EUCGR/44-131     AC A0A059BMV1.1
#=GS B2HNA0_MYCMM/63-157         AC B2HNA0.1
#=GS A0A1T4YJB0_9BACT/2416-2498  AC A0A1T4YJB0.1
#=GS A0A0D6Z4J3_9BACI/986-1091   AC A0A0D6Z4J3.1
#=GS A0A103YGQ3_CYNCS/48-142     AC A0A103YGQ3.1
#=GS W9QMY5_9ROSA/51-138         AC W9QMY5.1
#=GS C6VTQ4_DYAFD/1497-1589      AC C6VTQ4.1
#=GS A0A287LQX8_HORVV/1-90       AC A0A287LQX8.1
#=GS A0A287LTF6_HORVV/1-95       AC A0A287LTF6.1
#=GS A0A498JKT7_MALDO/213-315    AC A0A498JKT7.1
#=GS V7C6D6_PHAVU/175-283        AC V7C6D6.1
#=GS A0A1E3PX46_LIPST/32-123     AC A0A1E3PX46.1
#=GS A0A3B6LHE3_WHEAT/174-282    AC A0A3B6LHE3.1
#=GS A0A183GY11_9BILA/46-137     AC A0A183GY11.1
#=GS A0A445J4V6_GLYSO/54-145     AC A0A445J4V6.1
#=GS A0A2P8DDB9_9BACT/23-116     AC A0A2P8DDB9.1
#=GS A0A2H5WYF5_9BACT/322-408    AC A0A2H5WYF5.1
#=GS A0A327X781_9BACT/42-139     AC A0A327X781.1
#=GS A0A1Y4S5G6_9FIRM/366-453    AC A0A1Y4S5G6.1
#=GS A0A078IAH2_BRANA/54-148     AC A0A078IAH2.1
#=GS A0A3B3RCU0_9TELE/27-120     AC A0A3B3RCU0.1
#=GS A0A1B0FHK1_GLOMM/5-97       AC A0A1B0FHK1.1
#=GS A0A2I0VLR6_9ASPA/55-143     AC A0A2I0VLR6.1
#=GS A0A1C4I528_9ACTN/48-143     AC A0A1C4I528.1
#=GS A0A058Z1P2_FONAL/353-450    AC A0A058Z1P2.1
#=GS A0A1L9REL0_ASPWE/64-168     AC A0A1L9REL0.1
#=GS A0A432MNA2_9BACT/57-153     AC A0A432MNA2.1
#=GS A0A1K1MAZ0_9FLAO/30-126     AC A0A1K1MAZ0.1
#=GS A0A150GFP5_GONPE/199-324    AC A0A150GFP5.1
#=GS A0A1H8WCE9_9FIRM/41-135     AC A0A1H8WCE9.1
#=GS A0A287PHA8_HORVV/94-202     AC A0A287PHA8.1
#=GS A0A3B4H7J5_9CICH/28-121     AC A0A3B4H7J5.1
#=GS D7WDW6_9CORY/85-174         AC D7WDW6.1
#=GS A0A059BG82_EUCGR/175-283    AC A0A059BG82.1
#=GS A0A395RSW5_FUSSP/76-177     AC A0A395RSW5.1
#=GS A0A314UE14_PRUYE/66-156     AC A0A314UE14.1
#=GS A0A453K9C8_AEGTS/108-196    AC A0A453K9C8.1
#=GS W7MET3_GIBM7/69-173         AC W7MET3.1
#=GS A0A0S7E1Z5_9EURO/70-173     AC A0A0S7E1Z5.1
#=GS A0A2H5NVQ5_CITUN/169-277    AC A0A2H5NVQ5.1
#=GS A0A498KNG7_MALDO/17-113     AC A0A498KNG7.1
#=GS A0A3B6KKV7_WHEAT/18-101     AC A0A3B6KKV7.1
#=GS R0F4G6_9BRAS/56-147         AC R0F4G6.1
#=GS G2NQD5_STREK/48-143         AC G2NQD5.1
#=GS A0A0A1TP43_9HYPO/30-121     AC A0A0A1TP43.1
#=GS A0A287RUU2_HORVV/88-196     AC A0A287RUU2.1
#=GS A0A3F3PP40_9EURO/70-173     AC A0A3F3PP40.1
#=GS V7CE31_PHAVU/182-290        AC V7CE31.1
#=GS A0A2K2ZBY8_9FLAO/821-899    AC A0A2K2ZBY8.1
#=GS A0A430HZG0_9CORY/75-231     AC A0A430HZG0.1
#=GS A0A2H5QLU1_CITUN/53-165     AC A0A2H5QLU1.1
#=GS A0A0N4ZIJ6_PARTI/26-121     AC A0A0N4ZIJ6.1
#=GS A0A250X7H9_9CHLO/61-198     AC A0A250X7H9.1
#=GS A0A238F4G2_9BASI/58-151     AC A0A238F4G2.1
#=GS A0A089JVC8_9BACL/346-457    AC A0A089JVC8.1
#=GS A0A1Q3AYF3_CEPFO/1-86       AC A0A1Q3AYF3.1
#=GS A0A0C3N8P4_PISTI/50-139     AC A0A0C3N8P4.1
#=GS A0A1U7Z6Q8_NELNU/176-284    AC A0A1U7Z6Q8.1
#=GS A0A2T7D5P6_9POAL/110-227    AC A0A2T7D5P6.1
#=GS A0A0N5C003_STREA/28-121     AC A0A0N5C003.1
#=GS T1IAF1_RHOPR/25-116         AC T1IAF1.1
#=GS F7KVT4_9FIRM/689-796        AC F7KVT4.1
#=GS S2CYC9_9BACT/38-142         AC S2CYC9.1
#=GS K7JHQ3_NASVI/26-123         AC K7JHQ3.1
#=GS A0A314UM52_PRUYE/58-150     AC A0A314UM52.1
#=GS A0A1U7YRW7_NICSY/146-249    AC A0A1U7YRW7.1
#=GS A0A078H7T4_BRANA/146-249    AC A0A078H7T4.1
#=GS A0A0M9Y7Z5_9ACTN/64-157     AC A0A0M9Y7Z5.1
#=GS D8RA20_SELML/204-301        AC D8RA20.1
#=GS A0A022S424_ERYGU/216-319    AC A0A022S424.1
#=GS D3IJN0_9BACT/35-125         AC D3IJN0.1
#=GS A0A2U3PHP9_9MYCO/63-156     AC A0A2U3PHP9.1
#=GS A0A0E0Q0Q7_ORYRU/54-145     AC A0A0E0Q0Q7.1
#=GS A0A0D2R5W2_GOSRA/173-281    AC A0A0D2R5W2.1
#=GS A0A1R3GUF1_COCAP/60-151     AC A0A1R3GUF1.1
#=GS A0A0G3HID1_9CORY/58-152     AC A0A0G3HID1.1
#=GS A0A1P8WNF9_9PLAN/56-152     AC A0A1P8WNF9.1
#=GS E4RXB1_LEAB4/24-120         AC E4RXB1.1
#=GS A0A395T3A2_9HYPO/76-178     AC A0A395T3A2.1
#=GS A0A1M4YKR4_9BACT/89-191     AC A0A1M4YKR4.1
#=GS A0A2U1LRL8_ARTAN/493-580    AC A0A2U1LRL8.1
#=GS K3XHB2_SETIT/67-158         AC K3XHB2.1
#=GS A0A3B6LL58_WHEAT/82-200     AC A0A3B6LL58.1
#=GS A0A2I0JBM1_PUNGR/139-230    AC A0A2I0JBM1.1
#=GS A0A3Q2ZCG0_KRYMA/50-143     AC A0A3Q2ZCG0.1
#=GS K3Y6Q4_SETIT/112-199        AC K3Y6Q4.1
#=GS A0A0D3DPK8_BRAOL/148-251    AC A0A0D3DPK8.1
#=GS A0A1C7NND8_9FUNG/64-162     AC A0A1C7NND8.1
#=GS A0A225X663_9STRA/184-289    AC A0A225X663.1
#=GS A0A199UH13_ANACO/55-142     AC A0A199UH13.1
#=GS I0YV31_COCSC/53-158         AC I0YV31.1
#=GS V4T9Z4_9ROSI/1-71           AC V4T9Z4.1
#=GS A0A453PW50_AEGTS/71-162     AC A0A453PW50.1
#=GS A0A2G5DFP7_AQUCA/58-149     AC A0A2G5DFP7.1
#=GS A0A2H3XSP7_PHODC/120-207    AC A0A2H3XSP7.1
#=GS A0A453KLR7_AEGTS/84-202     AC A0A453KLR7.1
#=GS A0A445FBH9_GLYSO/72-183     AC A0A445FBH9.1
#=GS A0A1B8UVM8_9BACL/1079-1178  AC A0A1B8UVM8.1
#=GS A0A2A9CVI4_9ACTN/49-144     AC A0A2A9CVI4.1
#=GS A0A2G5C393_AQUCA/69-181     AC A0A2G5C393.1
#=GS A0A0K9NPI8_ZOSMR/185-289    AC A0A0K9NPI8.1
#=GS R5HYU8_9BACT/44-141         AC R5HYU8.1
#=GS M4RVC4_9ALTE/43-156         AC M4RVC4.1
#=GS R6RSQ2_9FIRM/59-150         AC R6RSQ2.1
#=GS A0A093ZSN0_9PEZI/37-128     AC A0A093ZSN0.1
#=GS A0A2P6PU94_ROSCH/78-190     AC A0A2P6PU94.1
#=GS A0A287JUF0_HORVV/26-120     AC A0A287JUF0.1
#=GS A6LC45_PARD8/276-373        AC A6LC45.1
#=GS A0A2H5NW33_CITUN/777-882    AC A0A2H5NW33.1
#=GS A0A1S3UEK2_VIGRR/74-185     AC A0A1S3UEK2.1
#=GS W3XIX8_PESFW/31-122         AC W3XIX8.1
#=GS A0A430AT34_9ENTE/223-318    AC A0A430AT34.1
#=GS A0A1H4RUX4_9FLAO/17-108     AC A0A1H4RUX4.1
#=GS A0A1H7V5L1_9BACT/37-120     AC A0A1H7V5L1.1
#=GS J3MYZ9_ORYBR/175-283        AC J3MYZ9.1
#=GS I1MU35_SOYBN/92-183         AC I1MU35.1
#=GS A0A1S3Y201_TOBAC/76-167     AC A0A1S3Y201.1
#=GS E9H0F5_DAPPU/38-132         AC E9H0F5.1
#=GS A0A371GAL4_MUCPR/98-185     AC A0A371GAL4.1
#=GS A0A316E3I6_9FLAO/29-113     AC A0A316E3I6.1
#=GS A0A1V6SKW2_9EURO/33-120     AC A0A1V6SKW2.1
#=GS A0A1I7SXR9_9PELO/20-115     AC A0A1I7SXR9.1
#=GS A0A2U3A106_9ACTN/71-188     AC A0A2U3A106.1
#=GS A0A089K2C8_9BACL/44-141     AC A0A089K2C8.1
#=GS A0A498KAY6_MALDO/44-131     AC A0A498KAY6.1
#=GS A0A453KLW0_AEGTS/84-202     AC A0A453KLW0.1
#=GS F4Q454_CAVFA/209-306        AC F4Q454.1
#=GS A0A0M8VPX6_9ACTN/985-1077   AC A0A0M8VPX6.1
#=GS E9ED37_METAQ/26-116         AC E9ED37.1
#=GS R4SYL9_9PSEU/56-161         AC R4SYL9.1
#=GS A0A453L843_AEGTS/1-95       AC A0A453L843.1
#=GS A0A118K3N8_CYNCS/192-300    AC A0A118K3N8.1
#=GS V7B9L1_PHAVU/49-137         AC V7B9L1.1
#=GS A0A453J668_AEGTS/174-282    AC A0A453J668.1
#=GS A0A118K694_CYNCS/51-138     AC A0A118K694.1
#=GS A0A238ZFA7_9ACTN/48-143     AC A0A238ZFA7.1
#=GS A0A2J6L6N9_LACSA/10-80      AC A0A2J6L6N9.1
#=GS A0A084VHC1_ANOSI/39-130     AC A0A084VHC1.1
#=GS V4LS82_EUTSA/52-149         AC V4LS82.1
#=GS A0A1G9F2G3_9ACTN/48-142     AC A0A1G9F2G3.1
#=GS A0A1S4DAM2_TOBAC/146-249    AC A0A1S4DAM2.1
#=GS A0A3N7G454_POPTR/70-182     AC A0A3N7G454.1
#=GS A0A178AJV5_9PLEO/34-122     AC A0A178AJV5.1
#=GS A0A1M6Y668_9FLAO/27-112     AC A0A1M6Y668.1
#=GS A0A452HD18_9SAUR/29-122     AC A0A452HD18.1
#=GS A0A2H3I9R4_9EURO/74-178     AC A0A2H3I9R4.1
#=GS A0A0U1KTL6_9FIRM/37-133     AC A0A0U1KTL6.1
#=GS A0A0R3NY95_DROPS/42-135     AC A0A0R3NY95.1
#=GS A0A0E0IM37_ORYNI/186-294    AC A0A0E0IM37.1
#=GS A0A162IHP0_9HYPO/34-123     AC A0A162IHP0.1
#=GS A0A2Z2KJ03_9BACL/607-706    AC A0A2Z2KJ03.1
#=GS A0A395H6B0_9EURO/70-173     AC A0A395H6B0.1
#=GS A0A346XTR9_9ACTN/63-184     AC A0A346XTR9.1
#=GS A0A453KLR3_AEGTS/84-202     AC A0A453KLR3.1
#=GS H3GKX7_PHYRM/195-301        AC H3GKX7.1
#=GS A0A1X7V7A8_AMPQE/154-256    AC A0A1X7V7A8.1
#=GS A0A1S4BBQ4_TOBAC/71-183     AC A0A1S4BBQ4.1
#=GS V4SZR4_9ROSI/174-282        AC V4SZR4.1
#=GS A0A397LQ36_9MICO/702-795    AC A0A397LQ36.1
#=GS A0A1M6BH62_9BACT/26-109     AC A0A1M6BH62.1
#=GS A0A1I3WLY6_9PSEU/46-139     AC A0A1I3WLY6.1
#=GS W1P2U4_AMBTC/52-145         AC W1P2U4.1
#=GS A0A329MTH6_9BACL/37-137     AC A0A329MTH6.1
#=GS A0A2I4EMZ5_JUGRE/220-322    AC A0A2I4EMZ5.1
#=GS A0A287S1T4_HORVV/63-176     AC A0A287S1T4.1
#=GS A0A287QKG9_HORVV/1-95       AC A0A287QKG9.1
#=GS A0A251VNS9_HELAN/225-327    AC A0A251VNS9.1
#=GS A0A495JVF0_9ACTN/70-169     AC A0A495JVF0.1
#=GS A0A2G5DFJ5_AQUCA/75-166     AC A0A2G5DFJ5.1
#=GS A0A259UG36_9FIRM/63-152     AC A0A259UG36.1
#=GS D7U680_VITVI/65-177         AC D7U680.1
#=GS A0A398A6F1_BRACM/56-147     AC A0A398A6F1.1
#=GS M0ZWN5_SOLTU/60-151         AC M0ZWN5.1
#=GS A0A3Q0I940_PHODC/69-181     AC A0A3Q0I940.1
#=GS A0A0E0QLL2_ORYRU/247-358    AC A0A0E0QLL2.1
#=GS A0A0W8CAC0_PHYNI/63-160     AC A0A0W8CAC0.1
#=GS A0A142XHK5_9BACT/47-149     AC A0A142XHK5.1
#=GS A0A0R0EHK7_SOYBN/30-114     AC A0A0R0EHK7.1
#=GS A0A1V8TJN9_9PEZI/29-116     AC A0A1V8TJN9.1
#=GS A0A287PHY0_HORVV/124-232    AC A0A287PHY0.1
#=GS C0Q8W1_DESAH/50-147         AC C0Q8W1.1
#=GS D5XF61_THEPJ/754-837        AC D5XF61.1
#=GS C6XSI9_PEDHD/23-117         AC C6XSI9.1
#=GS A0A0D9ZKF7_9ORYZ/52-141     AC A0A0D9ZKF7.1
#=GS A0A430K6P1_9FLAO/30-114     AC A0A430K6P1.1
#=GS A0A3B6MR23_WHEAT/84-202     AC A0A3B6MR23.1
#=GS A0A2R6RBV1_ACTCH/56-147     AC A0A2R6RBV1.1
#=GS A0A1G7ITI3_9BACL/305-397    AC A0A1G7ITI3.1
#=GS A0A345XWR3_9ACTN/89-194     AC A0A345XWR3.1
#=GS A0A1W4WV21_AGRPL/33-124     AC A0A1W4WV21.1
#=GS A0A078G2U7_BRANA/43-130     AC A0A078G2U7.1
#=GS F2UK05_SALR5/155-257        AC F2UK05.1
#=GS A0A251SEP6_HELAN/50-137     AC A0A251SEP6.1
#=GS A0A2K1X3N6_POPTR/69-181     AC A0A2K1X3N6.1
#=GS A0A397YVR7_BRACM/145-248    AC A0A397YVR7.1
#=GS A0A0A2EW49_9PORP/53-149     AC A0A0A2EW49.1
#=GS A0A151UCZ6_CAJCA/168-276    AC A0A151UCZ6.1
#=GS A0A3M6V9K0_9STRA/133-231    AC A0A3M6V9K0.1
#=GS A0A2S4XT76_9ACTN/66-171     AC A0A2S4XT76.1
#=GS A0A2P6QC72_ROSCH/42-132     AC A0A2P6QC72.1
#=GS A0A132B8R0_9HELO/25-112     AC A0A132B8R0.1
#=GS A0A2M9AAS4_9BACT/760-847    AC A0A2M9AAS4.1
#=GS A0A287RUW5_HORVV/75-183     AC A0A287RUW5.1
#=GS F9FIR6_FUSOF/50-139         AC F9FIR6.1
#=GS A0A0K9RRU8_SPIOL/62-153     AC A0A0K9RRU8.1
#=GS A0A2G2Z1X7_CAPAN/196-304    AC A0A2G2Z1X7.1
#=GS A0A3B6N006_WHEAT/145-252    AC A0A3B6N006.1
#=GS A0A0D2R6A6_GOSRA/60-151     AC A0A0D2R6A6.1
#=GS A0A2R6R8S8_ACTCH/69-181     AC A0A2R6R8S8.1
#=GS A0A453LGQ0_AEGTS/67-180     AC A0A453LGQ0.1
#=GS A0A2G7FEI5_9EURO/67-171     AC A0A2G7FEI5.1
#=GS A0A164MYV6_9NOCA/80-174     AC A0A164MYV6.1
#=GS A0A0E0DDT7_9ORYZ/132-221    AC A0A0E0DDT7.1
#=GS A0A2N7WCI4_9BURK/56-152     AC A0A2N7WCI4.1
#=GS A0A3D8RXV3_9EURO/71-161     AC A0A3D8RXV3.1
#=GS A0A067KT19_JATCU/65-177     AC A0A067KT19.1
#=GS A0A0M9DVX9_9DELT/25-116     AC A0A0M9DVX9.1
#=GS R5CRB4_9BACT/56-170         AC R5CRB4.1
#=GS A0A225WR63_9STRA/108-206    AC A0A225WR63.1
#=GS U4KA86_9VIBR/25-159         AC U4KA86.1
#=GS D7U5K4_VITVI/64-155         AC D7U5K4.1
#=GS A0A3B6PIG4_WHEAT/69-161     AC A0A3B6PIG4.1
#=GS A0A453FQR8_AEGTS/205-308    AC A0A453FQR8.1
#=GS A0A087U155_9ARAC/28-119     AC A0A087U155.1
#=GS F4W5K7_ACREC/217-308        AC F4W5K7.1
#=GS A0A4P1R993_LUPAN/57-149     AC A0A4P1R993.1
#=GS M4DT56_BRARP/145-248        AC M4DT56.1
#=GS A0A061FD96_THECC/58-156     AC A0A061FD96.1
#=GS A0A368KQT5_9PLAN/46-142     AC A0A368KQT5.1
#=GS A0A0D3FRC6_9ORYZ/63-176     AC A0A0D3FRC6.1
#=GS V7CA77_PHAVU/53-144         AC V7CA77.1
#=GS A0A1H6WFK9_9SPHN/39-135     AC A0A1H6WFK9.1
#=GS A0A0L9TQ27_PHAAN/179-287    AC A0A0L9TQ27.1
#=GS A0A2C9VXM7_MANES/41-149     AC A0A2C9VXM7.1
#=GS A0A1C4M5X1_9ACTN/65-158     AC A0A1C4M5X1.1
#=GS A0A453K9B9_AEGTS/3-90       AC A0A453K9B9.1
#=GS A0A2U3VN14_ODORO/32-125     AC A0A2U3VN14.1
#=GS F2EFJ2_HORVV/209-312        AC F2EFJ2.1
#=GS A0A3A9E0N2_9CLOT/211-288    AC A0A3A9E0N2.1
#=GS A0A2T4ZDB6_9BACL/51-149     AC A0A2T4ZDB6.1
#=GS A0A445A7A9_ARAHY/201-304    AC A0A445A7A9.1
#=GS A0A124I9A5_9ACTN/77-182     AC A0A124I9A5.1
#=GS J3MYZ8_ORYBR/190-299        AC J3MYZ8.1
#=GS A0A1Q3BZM3_CEPFO/57-148     AC A0A1Q3BZM3.1
#=GS A4DA60_ASPFU/34-123         AC A4DA60.1
#=GS G7JHG7_MEDTR/144-247        AC G7JHG7.2
#=GS G0J149_CYCMS/229-325        AC G0J149.1
#=GS A0A1S4AFU8_TOBAC/70-163     AC A0A1S4AFU8.1
#=GS A0A059ADK5_EUCGR/219-322    AC A0A059ADK5.1
#=GS K1VYK9_TRIAC/69-172         AC K1VYK9.1
#=GS A0A200Q6A9_9MAGN/55-142     AC A0A200Q6A9.1
#=GS A0A067H5X3_CITSI/101-204    AC A0A067H5X3.1
#=GS A0A3M6V9F8_9STRA/197-303    AC A0A3M6V9F8.1
#=GS A0A022RK57_ERYGU/53-144     AC A0A022RK57.1
#=GS A0A2I4EMZ9_JUGRE/222-325    AC A0A2I4EMZ9.1
#=GS A0A1Q5UMH9_9EURO/67-171     AC A0A1Q5UMH9.1
#=GS W2PPR6_PHYPN/90-188         AC W2PPR6.1
#=GS A0A3A4KGJ3_9NOCA/65-177     AC A0A3A4KGJ3.1
#=GS A0A452F212_CAPHI/32-125     AC A0A452F212.1
#=GS A0A371JGA9_9FIRM/98-192     AC A0A371JGA9.1
#=GS A0A1S3Z7F8_TOBAC/56-147     AC A0A1S3Z7F8.1
#=GS A0A200QE03_9MAGN/55-149     AC A0A200QE03.1
#=GS W2RHX2_PHYPN/61-158         AC W2RHX2.1
#=GS A0A2P6TBN9_CHLSO/168-271    AC A0A2P6TBN9.1
#=GS A0A1B6PEN8_SORBI/47-135     AC A0A1B6PEN8.1
#=GS A0A368QPJ0_SETIT/168-276    AC A0A368QPJ0.1
#=GS A0A397XSQ3_BRACM/53-147     AC A0A397XSQ3.1
#=GS A0A1V6P6W3_PENDC/32-119     AC A0A1V6P6W3.1
#=GS A0A0X3S725_9ACTN/42-140     AC A0A0X3S725.1
#=GS A0A0R3SYY7_HYMDI/18-105     AC A0A0R3SYY7.1
#=GS A0A1N7FY15_9EURY/6-100      AC A0A1N7FY15.1
#=GS A0A2J6JHF9_LACSA/58-128     AC A0A2J6JHF9.1
#=GS A0A2T7C4C1_9POAL/80-167     AC A0A2T7C4C1.1
#=GS A0A2H5NWK6_CITUN/778-883    AC A0A2H5NWK6.1
#=GS A0A1G9T3W1_9FIRM/54-143     AC A0A1G9T3W1.1
#=GS A0A2U1NPD1_ARTAN/48-142     AC A0A2U1NPD1.1
#=GS A0A3P7CGY6_SCHSO/1-73       AC A0A3P7CGY6.1
#=GS A0A445IJ77_GLYSO/47-134     AC A0A445IJ77.1
#=GS A7S4Y3_NEMVE/29-123         AC A7S4Y3.1
#=GS M7Z3U5_TRIUA/77-167         AC M7Z3U5.1
#=GS A0A1J6KAQ0_NICAT/56-147     AC A0A1J6KAQ0.1
#=GS A0A1B1G1D8_9BACT/42-145     AC A0A1B1G1D8.1
#=GS A0A0B0HYC1_9BACL/607-706    AC A0A0B0HYC1.1
#=GS M1CR75_SOLTU/168-276        AC M1CR75.1
#=GS I1MY91_SOYBN/94-206         AC I1MY91.2
#=GS A0A2I4DKS3_JUGRE/54-141     AC A0A2I4DKS3.1
#=GS A9V9Z9_MONBE/24-119         AC A9V9Z9.1
#=GS Q8ES41_OCEIH/55-153         AC Q8ES41.1
#=GS A0A2P5CYP0_TREOI/49-160     AC A0A2P5CYP0.1
#=GS A0A3B6EDM2_WHEAT/62-175     AC A0A3B6EDM2.1
#=GS V4NV26_EUTSA/15-109         AC V4NV26.1
#=GS A0A117DXS8_ASPNG/798-901    AC A0A117DXS8.1
#=GS A0A3M6UKC2_9CNID/27-120     AC A0A3M6UKC2.1
#=GS A0A1Y2D214_9FUNG/232-323    AC A0A1Y2D214.1
#=GS A0A094GRD8_9PEZI/34-124     AC A0A094GRD8.1
#=GS E6WSA1_PSEUU/46-141         AC E6WSA1.1
#=GS A0A372PHZ1_9ACTN/47-141     AC A0A372PHZ1.1
#=GS A0A287KQH3_HORVV/68-181     AC A0A287KQH3.1
#=GS A0A2S7U671_9BACT/40-141     AC A0A2S7U671.1
#=GS A0A251P8R8_PRUPE/179-287    AC A0A251P8R8.1
#=GS A0A1G4W9A1_9FIRM/999-1104   AC A0A1G4W9A1.1
#=GS W9RXW9_9ROSA/60-152         AC W9RXW9.1
#=GS A0A1Y4NKS5_9FIRM/35-130     AC A0A1Y4NKS5.1
#=GS A0A2I4EMZ8_JUGRE/220-322    AC A0A2I4EMZ8.1
#=GS A0A3E2YKX3_9ACTN/47-149     AC A0A3E2YKX3.1
#=GS A0A3B6EMC1_WHEAT/209-312    AC A0A3B6EMC1.1
#=GS A0A151TF71_CAJCA/176-284    AC A0A151TF71.1
#=GS T0QEN4_SAPDV/126-233        AC T0QEN4.1
#=GS A0A287R020_HORVV/1-117      AC A0A287R020.1
#=GS A0A210PFM7_MIZYE/63-156     AC A0A210PFM7.1
#=GS A0A1Y2BYA8_9FUNG/97-189     AC A0A1Y2BYA8.1
#=GS A0A329SAH5_9STRA/67-164     AC A0A329SAH5.1
#=GS A0A0E0R4B8_ORYRU/56-143     AC A0A0E0R4B8.1
#=GS A0A127A1I5_9MICC/62-155     AC A0A127A1I5.1
#=GS A0A1G9V8T5_9BACT/31-128     AC A0A1G9V8T5.1
#=GS A0A136PQG1_9ACTN/49-151     AC A0A136PQG1.1
#=GS A0A0P1AUY5_PLAHL/240-346    AC A0A0P1AUY5.1
#=GS A0A3N7FIN4_POPTR/96-204     AC A0A3N7FIN4.1
#=GS A0A2K5YDL8_MANLE/32-125     AC A0A2K5YDL8.1
#=GS A0A067FSN4_CITSI/169-277    AC A0A067FSN4.1
#=GS V7CXH5_PHAVU/47-135         AC V7CXH5.1
#=GS W7LTK1_GIBM7/28-117         AC W7LTK1.1
#=GS A0A453BXM6_AEGTS/52-139     AC A0A453BXM6.1
#=GS A0A1U8I1G0_GOSHI/46-133     AC A0A1U8I1G0.1
#=GS F4PLI1_CAVFA/142-245        AC F4PLI1.1
#=GS A0A1B8EHK3_9PEZI/35-127     AC A0A1B8EHK3.1
#=GS L1IIC8_GUITC/48-173         AC L1IIC8.1
#=GS A0A194VMU3_9PEZI/34-123     AC A0A194VMU3.1
#=GS A0A0D3AF73_BRAOL/77-188     AC A0A0D3AF73.1
#=GS A0A158R903_TAEAS/1-83       AC A0A158R903.1
#=GS A0A2T3HQE7_9SPHI/49-146     AC A0A2T3HQE7.1
#=GS A0A0D3HW08_9ORYZ/120-228    AC A0A0D3HW08.1
#=GS A0A2P8YTV3_BLAGE/22-110     AC A0A2P8YTV3.1
#=GS A0A1X7VAQ1_AMPQE/240-340    AC A0A1X7VAQ1.1
#=GS A9TI15_PHYPA/58-148         AC A9TI15.1
#=GS A0A3Q9G4D6_STRLT/59-152     AC A0A3Q9G4D6.1
#=GS A5B1B3_VITVI/58-149         AC A5B1B3.1
#=GS A0A2G2YPC6_CAPAN/2-82       AC A0A2G2YPC6.1
#=GS W5P7J9_SHEEP/38-131         AC W5P7J9.1
#=GS A0A1R3J795_COCAP/69-181     AC A0A1R3J795.1
#=GS W2UNE5_9FLAO/23-108         AC W2UNE5.1
#=GS A6GMQ1_9BURK/72-175         AC A6GMQ1.1
#=GS A0A397Y4H4_BRACM/145-248    AC A0A397Y4H4.1
#=GS A0A2I1CFK3_9EURO/70-173     AC A0A2I1CFK3.1
#=GS A0A068TSY0_COFCA/15-126     AC A0A068TSY0.1
#=GS A0A2G7F9U7_9ACTN/53-145     AC A0A2G7F9U7.1
#=GS A0A0E0BUF1_9ORYZ/164-272    AC A0A0E0BUF1.1
#=GS A0A2P8H3B7_9BACL/42-131     AC A0A2P8H3B7.1
#=GS R7PB23_9BACT/10-113         AC R7PB23.1
#=GS B9RP16_RICCO/54-145         AC B9RP16.1
#=GS A0A0D2QEW0_GOSRA/71-183     AC A0A0D2QEW0.1
#=GS A0A251QT20_PRUPE/69-180     AC A0A251QT20.1
#=GS A0A3Q7ETE4_SOLLC/61-152     AC A0A3Q7ETE4.1
#=GS H1CY34_9FIRM/44-136         AC H1CY34.1
#=GS J9JN10_ACYPI/26-117         AC J9JN10.1
#=GS A0A0K9R972_SPIOL/67-179     AC A0A0K9R972.1
#=GS A0A1U7X7I4_NICSY/12-93      AC A0A1U7X7I4.1
#=GS D2VFX2_NAEGR/23-130         AC D2VFX2.1
#=GS A0A498HZL2_MALDO/1-89       AC A0A498HZL2.1
#=GS A0A2P6PDL2_ROSCH/89-200     AC A0A2P6PDL2.1
#=GS A0A1H9XI40_9BACI/49-145     AC A0A1H9XI40.1
#=GS E6U2K9_ETHHY/322-411        AC E6U2K9.1
#=GS A0A1G7AMT5_9ACTN/59-156     AC A0A1G7AMT5.1
#=GS A0A2I4DZC7_JUGRE/145-249    AC A0A2I4DZC7.1
#=GS A0A1H8UN36_9FIRM/55-154     AC A0A1H8UN36.1
#=GS A0A1M6WCN4_9BACT/51-149     AC A0A1M6WCN4.1
#=GS A0A3P8ZKK9_ESOLU/28-122     AC A0A3P8ZKK9.1
#=GS A0A0A8EDH5_9ACTN/53-146     AC A0A0A8EDH5.1
#=GS A0A2G9HDD6_9LAMI/68-179     AC A0A2G9HDD6.1
#=GS A0A1B8U044_9FLAO/56-165     AC A0A1B8U044.1
#=GS A0A3Q0HYJ9_PHODC/210-310    AC A0A3Q0HYJ9.1
#=GS A7RLE4_NEMVE/3-69           AC A7RLE4.1
#=GS A0A179G7V2_METCM/70-172     AC A0A179G7V2.1
#=GS A0A453FQM0_AEGTS/205-308    AC A0A453FQM0.1
#=GS A0A427Y3J2_9TREE/39-132     AC A0A427Y3J2.1
#=GS Q01RC9_SOLUE/487-572        AC Q01RC9.1
#=GS A0A225W7W4_9STRA/1-82       AC A0A225W7W4.1
#=GS A0A2G2YVJ7_CAPAN/53-144     AC A0A2G2YVJ7.1
#=GS A0A1R4IKI3_9MICO/1198-1293  AC A0A1R4IKI3.1
#=GS A0A0G3AMP4_9ACTN/74-179     AC A0A0G3AMP4.1
#=GS A0A2M9C407_9MICO/49-142     AC A0A2M9C407.1
#=GS A0A1Y4CKZ9_9FIRM/55-145     AC A0A1Y4CKZ9.1
#=GS A9SQV9_PHYPA/158-260        AC A9SQV9.1
#=GS A0A345SRI6_9ACTN/88-187     AC A0A345SRI6.1
#=GS A0A2K3NEB0_TRIPR/60-151     AC A0A2K3NEB0.1
#=GS A0A2G5E5B3_AQUCA/45-137     AC A0A2G5E5B3.1
#=GS F4Q0B9_CAVFA/1-86           AC F4Q0B9.1
#=GS M5GFE0_DACPD/169-272        AC M5GFE0.1
#=GS A0A316I3F9_9GAMM/60-153     AC A0A316I3F9.1
#=GS A0A151GPZ6_9HYPO/18-101     AC A0A151GPZ6.1
#=GS B6QA84_TALMQ/74-178         AC B6QA84.1
#=GS A0A0E0D9J4_9ORYZ/65-178     AC A0A0E0D9J4.1
#=GS A0A1D6LBV8_MAIZE/66-179     AC A0A1D6LBV8.1
#=GS A0A194UXM6_9PEZI/66-169     AC A0A194UXM6.1
#=GS A0A2T0BQH2_9CLOT/61-158     AC A0A2T0BQH2.1
#=GS A0A3M6TYW8_9CNID/31-125     AC A0A3M6TYW8.1
#=GS A0A3L6RXY1_PANMI/78-168     AC A0A3L6RXY1.1
#=GS A0A285ZT54_9SPHI/34-132     AC A0A285ZT54.1
#=GS A0A2G2WS03_CAPBA/144-247    AC A0A2G2WS03.1
#=GS W2PH43_PHYPN/199-305        AC W2PH43.1
#=GS A0A0N0AMK2_9ACTN/48-142     AC A0A0N0AMK2.1
#=GS A0A1G9P4J0_9SPHI/33-131     AC A0A1G9P4J0.1
#=GS A0A1H1URE7_9ACTN/43-139     AC A0A1H1URE7.1
#=GS A0A1X7UTT1_AMPQE/196-298    AC A0A1X7UTT1.1
#=GS A0A175YJ96_DAUCS/67-179     AC A0A175YJ96.1
#=GS A0A3L8JS25_9ACTN/88-193     AC A0A3L8JS25.1
#=GS A0A2C9WCH6_MANES/50-143     AC A0A2C9WCH6.1
#=GS A0A371FBW1_MUCPR/64-155     AC A0A371FBW1.1
#=GS A0A101NCC5_9ACTN/73-178     AC A0A101NCC5.1
#=GS A0A0F6YH76_9DELT/17-100     AC A0A0F6YH76.1
#=GS R9AG81_WALI9/23-118         AC R9AG81.1
#=GS A0A2A3GZE3_9ACTN/79-184     AC A0A2A3GZE3.1
#=GS A0A1Q3BL48_CEPFO/46-133     AC A0A1Q3BL48.1
#=GS A0A1G5LU51_9ACTN/59-152     AC A0A1G5LU51.1
#=GS A0A445FSK6_GLYSO/173-281    AC A0A445FSK6.1
#=GS A0A484E3B0_BRELC/189-295    AC A0A484E3B0.1
#=GS A0A0S9E099_9MICO/44-140     AC A0A0S9E099.1
#=GS A0A225AUW2_9EURO/475-563    AC A0A225AUW2.1
#=GS A0A287KQI4_HORVV/63-177     AC A0A287KQI4.1
#=GS A0A094EEB1_9PEZI/555-641    AC A0A094EEB1.1
#=GS A0A370B983_9ACTN/69-174     AC A0A370B983.1
#=GS A0A1U8MBT3_GOSHI/70-182     AC A0A1U8MBT3.1
#=GS W2KHB3_PHYPR/100-198        AC W2KHB3.1
#=GS A0A1C4K7C4_9ACTN/88-193     AC A0A1C4K7C4.1
#=GS B5X2H7_SALSA/29-123         AC B5X2H7.1
#=GS A0A2I4EMY8_JUGRE/220-322    AC A0A2I4EMY8.1
#=GS A0A0N4V7Z2_ENTVE/3-87       AC A0A0N4V7Z2.1
#=GS A0A317V609_9EURO/70-173     AC A0A317V609.1
#=GS A0A0D2P9T7_GOSRA/97-209     AC A0A0D2P9T7.1
#=GS A0A494X774_9BACL/57-159     AC A0A494X774.1
#=GS A0A250IGH4_9DELT/227-306    AC A0A250IGH4.1
#=GS A0A4D9BIB1_SALSN/84-175     AC A0A4D9BIB1.1
#=GS A0A453KLS1_AEGTS/85-203     AC A0A453KLS1.1
#=GS E1SU92_FERBD/227-315        AC E1SU92.1
#=GS A0A1I7V1P3_9PELO/21-105     AC A0A1I7V1P3.1
#=GS A0A365N111_GIBIN/76-176     AC A0A365N111.1
#=GS A1CGH8_ASPCL/32-119         AC A1CGH8.1
#=GS A0A2K8PSU9_STRLA/82-188     AC A0A2K8PSU9.1
#=GS A0A2G9G1M8_9LAMI/49-146     AC A0A2G9G1M8.1
#=GS A0A0D3VHW7_9BACL/37-137     AC A0A0D3VHW7.1
#=GS B9GRH6_POPTR/79-170         AC B9GRH6.2
#=GS A0A087SMN3_AUXPR/149-252    AC A0A087SMN3.1
#=GS Q2S0Z7_SALRD/59-160         AC Q2S0Z7.1
#=GS A0A1A2MZ38_9MYCO/64-157     AC A0A1A2MZ38.1
#=GS A0A1H3QWE7_9BACI/124-221    AC A0A1H3QWE7.1
#=GS A0A1Z1WK39_9ACTN/85-190     AC A0A1Z1WK39.1
#=GS A0A327WA70_9ACTN/72-202     AC A0A327WA70.1
#=GS A0A2P5DVX2_TREOI/69-160     AC A0A2P5DVX2.1
#=GS A0A2Z4GE74_9BACT/28-112     AC A0A2Z4GE74.1
#=GS A0A2C9VWM5_MANES/213-321    AC A0A2C9VWM5.1
#=GS A0A1Y1VCW2_9FUNG/139-246    AC A0A1Y1VCW2.1
#=GS G0T427_SOYBN/79-166         AC G0T427.1
#=GS E9DXE4_METAQ/34-122         AC E9DXE4.1
#=GS A0A2R6RD54_ACTCH/213-316    AC A0A2R6RD54.1
#=GS A0A1V2RBB3_9ACTN/1004-1094  AC A0A1V2RBB3.1
#=GS A0A0X3S990_9ACTN/48-143     AC A0A0X3S990.1
#=GS F0ZUP3_DICPU/137-242        AC F0ZUP3.1
#=GS A9V737_MONBE/109-206        AC A9V737.1
#=GS A0A066Z754_9ACTN/105-210    AC A0A066Z754.1
#=GS A0A200QDY9_9MAGN/472-563    AC A0A200QDY9.1
#=GS K3YGX2_SETIT/84-205         AC K3YGX2.1
#=GS S2JBI5_MUCC1/58-156         AC S2JBI5.1
#=GS G4ZC61_PHYSP/40-134         AC G4ZC61.1
#=GS A0A498KBH2_MALDO/64-155     AC A0A498KBH2.1
#=GS A0A078HHJ6_BRANA/141-244    AC A0A078HHJ6.1
#=GS A0A1J1IW33_9DIPT/29-120     AC A0A1J1IW33.1
#=GS G8UKJ6_TANFA/52-148         AC G8UKJ6.1
#=GS A0A285JYQ3_9ACTN/40-135     AC A0A285JYQ3.1
#=GS A0A2S2DT83_9BACT/27-108     AC A0A2S2DT83.1
#=GS A0A2L2XC27_9FIRM/71-168     AC A0A2L2XC27.1
#=GS A0A2K2B0R6_POPTR/51-138     AC A0A2K2B0R6.1
#=GS A0A200Q5V7_9MAGN/62-153     AC A0A200Q5V7.1
#=GS A0A445A6R5_ARAHY/526-618    AC A0A445A6R5.1
#=GS A0A1U7Z2E9_NELNU/73-185     AC A0A1U7Z2E9.1
#=GS A0A0X3SCB0_9ACTN/58-151     AC A0A0X3SCB0.1
#=GS A0A2P7TIM8_9SPHI/23-108     AC A0A2P7TIM8.1
#=GS A0A2P6NLP3_9MYCE/435-533    AC A0A2P6NLP3.1
#=GS A0A0C5XG27_NOCSI/58-155     AC A0A0C5XG27.1
#=GS F4PFX3_BATDJ/210-307        AC F4PFX3.1
#=GS A0A068UBB4_COFCA/50-137     AC A0A068UBB4.1
#=GS A0A498HWG6_MALDO/120-212    AC A0A498HWG6.1
#=GS A0A445H0I1_GLYSO/70-160     AC A0A445H0I1.1
#=GS A0A3S4DAE9_9PEZI/537-592    AC A0A3S4DAE9.1
#=GS V4LEY0_EUTSA/60-131         AC V4LEY0.1
#=GS A0A1U8HIA1_GOSHI/184-292    AC A0A1U8HIA1.1
#=GS A0A090LJA9_STRRB/56-152     AC A0A090LJA9.1
#=GS D7SV33_VITVI/62-153         AC D7SV33.1
#=GS M4BU77_HYAAE/69-166         AC M4BU77.1
#=GS A0A0C2AJA3_9ACTN/48-143     AC A0A0C2AJA3.1
#=GS A0A2G9GQE3_9LAMI/178-286    AC A0A2G9GQE3.1
#=GS A0A285QUT6_9ACTN/45-138     AC A0A285QUT6.1
#=GS A0A087SN35_AUXPR/77-189     AC A0A087SN35.1
#=GS A0A323VBZ2_9RHOO/29-116     AC A0A323VBZ2.1
#=GS W4H495_9STRA/111-216        AC W4H495.1
#=GS M0YKM9_HORVV/54-145         AC M0YKM9.1
#=GS A0A2R6PBK4_ACTCH/174-282    AC A0A2R6PBK4.1
#=GS A0A1J7IS25_9PEZI/19-109     AC A0A1J7IS25.1
#=GS A0A1M5DVZ6_9FLAO/21-112     AC A0A1M5DVZ6.1
#=GS A0A3P1XSX6_9MICO/168-273    AC A0A3P1XSX6.1
#=GS K3YGQ6_SETIT/176-286        AC K3YGQ6.1
#=GS A0A0A0LBF2_CUCSA/44-138     AC A0A0A0LBF2.1
#=GS A0A1J6IN14_NICAT/47-138     AC A0A1J6IN14.1
#=GS A0A3S1BH03_9BACL/42-139     AC A0A3S1BH03.1
#=GS A0A2S9JV28_9SPHI/29-128     AC A0A2S9JV28.1
#=GS A0A2H3ZP16_PHODC/89-176     AC A0A2H3ZP16.2
#=GS A0A094G6X4_9PEZI/37-128     AC A0A094G6X4.1
#=GS A0A327VMN6_9ACTN/77-182     AC A0A327VMN6.1
#=GS A0A314XKU3_PRUYE/89-196     AC A0A314XKU3.1
#=GS A0A3B6B6U6_WHEAT/149-240    AC A0A3B6B6U6.1
#=GS A0A2P6N9W2_9MYCE/158-261    AC A0A2P6N9W2.1
#=GS A0A1N7JUK8_9CORY/37-125     AC A0A1N7JUK8.1
#=GS A0A061ELY4_THECC/68-179     AC A0A061ELY4.1
#=GS Q6C4F6_YARLI/37-127         AC Q6C4F6.1
#=GS A0A1G4FIL4_9FIRM/61-160     AC A0A1G4FIL4.1
#=GS A0A2K1YUW9_POPTR/143-246    AC A0A2K1YUW9.1
#=GS A0A3N6X6Y8_9ACTN/231-327    AC A0A3N6X6Y8.1
#=GS A0A0U1M5S7_TALIS/69-173     AC A0A0U1M5S7.1
#=GS A0A445B2Y7_ARAHY/83-183     AC A0A445B2Y7.1
#=GS A0A1Y2A9A6_9FUNG/163-253    AC A0A1Y2A9A6.1
#=GS A0A2W2EYQ3_9ACTN/48-142     AC A0A2W2EYQ3.1
#=GS A0A1S2YB39_CICAR/65-177     AC A0A1S2YB39.1
#=GS A0A2H3YLV0_PHODC/74-186     AC A0A2H3YLV0.1
#=GS A0A117NKW2_9EURO/33-120     AC A0A117NKW2.1
#=GS K9EBA4_9LACT/244-345        AC K9EBA4.1
#=GS ACP7_DANRE/31-124           AC A5D6U8.1
#=GS A0A2J6MCT9_LACSA/145-248    AC A0A2J6MCT9.1
#=GS A0A371GI87_MUCPR/71-182     AC A0A371GI87.1
#=GS F2TXS7_SALR5/40-134         AC F2TXS7.1
#=GS F9FAU2_FUSOF/69-173         AC F9FAU2.1
#=GS A0A2I3HCF7_NOMLE/32-125     AC A0A2I3HCF7.1
#=GS A0A1Q2M321_9GAMM/42-138     AC A0A1Q2M321.1
#=GS A0A1D6KW37_MAIZE/68-155     AC A0A1D6KW37.1
#=GS A0A2T1NFM3_9FLAO/23-119     AC A0A2T1NFM3.1
#=GS A0A3N4UC30_9ACTN/74-179     AC A0A3N4UC30.1
#=GS A0A1Q4W8W6_9ACTN/57-150     AC A0A1Q4W8W6.1
#=GS A0A316UP88_9BASI/35-123     AC A0A316UP88.1
#=GS E2AEF0_CAMFO/207-298        AC E2AEF0.1
#=GS A0A3N4UHC0_9ACTN/81-186     AC A0A3N4UHC0.1
#=GS A0A162MFU4_9BACL/43-142     AC A0A162MFU4.1
#=GS A0A1H6TQG8_9FIRM/12-98      AC A0A1H6TQG8.1
#=GS A0A287QYQ6_HORVV/29-116     AC A0A287QYQ6.1
#=GS A0A2P6QWG6_ROSCH/72-184     AC A0A2P6QWG6.1
#=GS A0A2P8Q9A3_9ACTN/49-144     AC A0A2P8Q9A3.1
#=GS A0A2T4AXF2_9HYPO/34-120     AC A0A2T4AXF2.1
#=GS T0KU54_9HELI/36-118         AC T0KU54.1
#=GS A0A0D3HX63_9ORYZ/66-157     AC A0A0D3HX63.1
#=GS A0A0D3FRC8_9ORYZ/63-176     AC A0A0D3FRC8.1
#=GS A0A059DG30_EUCGR/1-75       AC A0A059DG30.1
#=GS G0T433_SOYBN/54-145         AC G0T433.1
#=GS A0A2V1EBP8_9PLEO/31-121     AC A0A2V1EBP8.1
#=GS E6U629_ETHHY/57-152         AC E6U629.1
#=GS M2LE39_BAUPA/32-121         AC M2LE39.1
#=GS A0A3S5WGV5_9ACAR/25-115     AC A0A3S5WGV5.1
#=GS G4YN62_PHYSP/202-307        AC G4YN62.1
#=GS D8T2Y4_SELML/65-175         AC D8T2Y4.1
#=GS A0A327X3H4_9GAMM/50-146     AC A0A327X3H4.1
#=GS M7ZLD8_TRIUA/238-329        AC M7ZLD8.1
#=GS A0A0K8LRC2_9EURO/34-121     AC A0A0K8LRC2.1
#=GS A0A117NXR3_9ACTN/74-179     AC A0A117NXR3.1
#=GS A0A1B6BHE3_9FIRM/400-500    AC A0A1B6BHE3.1
#=GS A0A0D2VRX2_CAPO3/51-157     AC A0A0D2VRX2.1
#=GS PPA1_ARATH/170-278          AC Q9LMX4.1
#=GS G5AM94_HETGA/28-121         AC G5AM94.1
#=GS W4FFI7_9STRA/85-182         AC W4FFI7.1
#=GS A0A1B6Q6L4_SORBI/263-366    AC A0A1B6Q6L4.1
#=GS A0A1S2YKX3_CICAR/63-154     AC A0A1S2YKX3.1
#=GS A0A174HSX0_9CLOT/257-351    AC A0A174HSX0.1
#=GS A0A2G2Y7W1_CAPAN/69-181     AC A0A2G2Y7W1.1
#=GS V4KNZ0_EUTSA/141-244        AC V4KNZ0.1
#=GS A0A0J6XJW8_9ACTN/79-185     AC A0A0J6XJW8.1
#=GS A0A2P6PDL6_ROSCH/86-197     AC A0A2P6PDL6.1
#=GS A0A1G4G4H8_9PORP/723-822    AC A0A1G4G4H8.1
#=GS A0A1I2AFR7_9FIRM/59-152     AC A0A1I2AFR7.1
#=GS B9HXJ3_POPTR/171-279        AC B9HXJ3.1
#=GS A0A0F0HZ57_9PSEU/55-148     AC A0A0F0HZ57.1
#=GS A0A1R3J1D9_9ROSI/49-154     AC A0A1R3J1D9.1
#=GS A0A395HK29_ASPHC/70-173     AC A0A395HK29.1
#=GS A0A067DML7_CITSI/50-162     AC A0A067DML7.1
#=GS A0A3B6MVT4_WHEAT/178-287    AC A0A3B6MVT4.1
#=GS A0A2J6LUM6_LACSA/44-131     AC A0A2J6LUM6.1
#=GS Q0IUK0_ORYSJ/56-144         AC Q0IUK0.2
#=GS I7KZ36_METBM/30-107         AC I7KZ36.1
#=GS A0A2H5X6W2_9BACT/51-147     AC A0A2H5X6W2.1
#=GS A0A314Y4J2_PRUYE/62-152     AC A0A314Y4J2.1
#=GS A0A1U8KUM3_GOSHI/216-324    AC A0A1U8KUM3.1
#=GS A0A371G6U8_MUCPR/56-143     AC A0A371G6U8.1
#=GS A0A200PVA7_9MAGN/169-278    AC A0A200PVA7.1
#=GS A0A0E0BFD7_9ORYZ/146-235    AC A0A0E0BFD7.1
#=GS A0A2I2YE92_GORGO/32-125     AC A0A2I2YE92.1
#=GS R0H2Y3_9BRAS/142-245        AC R0H2Y3.1
#=GS A0A1A9ZZB7_GLOPL/28-121     AC A0A1A9ZZB7.1
#=GS A0A1H9F9M4_9ACTN/80-185     AC A0A1H9F9M4.1
#=GS A0A2C9JLL8_BIOGL/23-116     AC A0A2C9JLL8.1
#=GS A0A2W1LIN7_9BACL/1083-1180  AC A0A2W1LIN7.1
#=GS A0A0D2U9F6_CAPO3/156-258    AC A0A0D2U9F6.1
#=GS A0A1F8AHW5_9EURO/34-123     AC A0A1F8AHW5.1
#=GS A0A3D8QHC4_9EURO/67-171     AC A0A3D8QHC4.1
#=GS A0A3D8Q3U6_9HELO/30-121     AC A0A3D8Q3U6.1
#=GS A0A2S9BL85_9MICO/241-332    AC A0A2S9BL85.1
#=GS A0A4D8Y3J9_SALSN/1-80       AC A0A4D8Y3J9.1
#=GS A0A1E3QE98_LIPST/34-131     AC A0A1E3QE98.1
#=GS A0A3Q7EGU6_SOLLC/1022-1124  AC A0A3Q7EGU6.1
#=GS A0A2I0B4T4_9ASPA/62-153     AC A0A2I0B4T4.1
#=GS A0A1A9WFZ6_9MUSC/30-115     AC A0A1A9WFZ6.1
#=GS C5YRS3_SORBI/85-178         AC C5YRS3.1
#=GS A0A0E0EWP6_9ORYZ/153-255    AC A0A0E0EWP6.1
#=GS A0A345PMK1_9BACI/30-127     AC A0A345PMK1.1
#=GS A0A200Q8S8_9MAGN/67-179     AC A0A200Q8S8.1
#=GS A0A0F0H5K9_NOCAE/76-186     AC A0A0F0H5K9.1
#=GS A0A1H1WYY7_9MICO/78-174     AC A0A1H1WYY7.1
#=GS A0A0K0FFV4_STRVS/22-115     AC A0A0K0FFV4.1
#=GS A0A1S3VTG3_VIGRR/77-189     AC A0A1S3VTG3.1
#=GS A0A1V9ZEX7_9STRA/161-271    AC A0A1V9ZEX7.1
#=GS A0A2J6LB67_LACSA/60-151     AC A0A2J6LB67.1
#=GS A0A1S3TJ80_VIGRR/54-145     AC A0A1S3TJ80.1
#=GS A0A2P6PPM7_ROSCH/67-157     AC A0A2P6PPM7.1
#=GS A0A1Y1XJT9_9FUNG/175-266    AC A0A1Y1XJT9.1
#=GS A0A162XPG6_9FLAO/21-112     AC A0A162XPG6.1
#=GS A0A3B6SKJ2_WHEAT/55-146     AC A0A3B6SKJ2.1
#=GS A0A444YPG5_ARAHY/50-139     AC A0A444YPG5.1
#=GS Q7PUN5_ANOGA/32-123         AC Q7PUN5.5
#=GS A0A0L6JMR4_9FIRM/49-154     AC A0A0L6JMR4.1
#=GS A0A178A5A6_9BACI/481-586    AC A0A178A5A6.1
#=GS A0A397ZVJ6_BRACM/70-181     AC A0A397ZVJ6.1
#=GS A0A2K0WSP6_GIBNY/28-117     AC A0A2K0WSP6.1
#=GS PPA20_ARATH/44-133          AC Q9LXI7.1
#=GS A0A118K3N8_CYNCS/717-826    AC A0A118K3N8.1
#=GS R5DB92_9FIRM/73-172         AC R5DB92.1
#=GS A0A2P5SQ78_GOSBA/47-140     AC A0A2P5SQ78.1
#=GS A0A067G4K3_CITSI/169-277    AC A0A067G4K3.1
#=GS R5BKC1_9FIRM/57-148         AC R5BKC1.1
#=GS A0A317WVH8_9EURO/33-122     AC A0A317WVH8.1
#=GS A0A0C3GGU4_9PEZI/71-175     AC A0A0C3GGU4.1
#=GS A0A1I3B4L8_9PLAN/46-131     AC A0A1I3B4L8.1
#=GS A0A498D4V0_9BACI/30-127     AC A0A498D4V0.1
#=GS A0A067G4J9_CITSI/169-277    AC A0A067G4J9.1
#=GS A0A081PAP6_9BACL/341-452    AC A0A081PAP6.1
#=GS A0A329KBH3_9BACL/58-157     AC A0A329KBH3.1
#=GS A0A1S4AYF3_TOBAC/168-276    AC A0A1S4AYF3.1
#=GS A0A059D6I5_EUCGR/75-174     AC A0A059D6I5.1
#=GS A0A433XCU1_9BACL/353-451    AC A0A433XCU1.1
#=GS A0A059AW24_EUCGR/64-176     AC A0A059AW24.1
#=GS A0A2H5N999_CITUN/142-245    AC A0A2H5N999.1
#=GS A0A1R1D0S8_9BACL/667-764    AC A0A1R1D0S8.1
#=GS E2BHF9_HARSA/24-115         AC E2BHF9.1
#=GS A0A067G3U9_CITSI/169-277    AC A0A067G3U9.1
#=GS E1ZL81_CHLVA/71-190         AC E1ZL81.1
#=GS F1A3B9_DICPU/38-138         AC F1A3B9.1
#=GS A0A2H5Q4V7_CITUN/43-130     AC A0A2H5Q4V7.1
#=GS A0A0D3BDY9_BRAOL/57-148     AC A0A0D3BDY9.1
#=GS A0A103EM25_9BURK/62-158     AC A0A103EM25.1
#=GS A0A1Q5E3G3_9ACTN/78-184     AC A0A1Q5E3G3.1
#=GS A0A2K5Q8X0_CEBCA/32-125     AC A0A2K5Q8X0.1
#=GS A0A1U7XFC1_NICSY/71-183     AC A0A1U7XFC1.1
#=GS V4LZ80_EUTSA/47-134         AC V4LZ80.1
#=GS A0A1Y2E545_9BASI/39-131     AC A0A1Y2E545.1
#=GS A0A0B4HW35_METMF/69-171     AC A0A0B4HW35.1
#=GS A0A151JQI4_9HYME/141-224    AC A0A151JQI4.1
#=GS A0A2S0WHQ4_9ACTN/226-317    AC A0A2S0WHQ4.1
#=GS I9B344_9FIRM/35-127         AC I9B344.1
#=GS PPA18_ARATH/47-134          AC Q9LJU7.1
#=GS A0A1I0PJB9_9FIRM/83-180     AC A0A1I0PJB9.1
#=GS M0R045_HUMAN/32-125         AC M0R045.1
#=GS A0A1D6IWU3_MAIZE/62-133     AC A0A1D6IWU3.1
#=GS A0A419XWB6_9ACTN/953-1038   AC A0A419XWB6.1
#=GS A9V0H8_MONBE/27-124         AC A9V0H8.1
#=GS A0A078JHQ7_BRANA/43-130     AC A0A078JHQ7.1
#=GS A0A3L6PCE5_PANMI/147-252    AC A0A3L6PCE5.1
#=GS A0A0R3XBX0_HYDTA/20-102     AC A0A0R3XBX0.1
#=GS A0A0D2TT47_GOSRA/216-324    AC A0A0D2TT47.1
#=GS A0A2Z5EFQ1_9SPHN/70-166     AC A0A2Z5EFQ1.1
#=GS W9RVL4_9ROSA/184-293        AC W9RVL4.1
#=GS A0A1C4II16_9ACTN/85-190     AC A0A1C4II16.1
#=GS B8BMN6_ORYSI/168-276        AC B8BMN6.1
#=GS A0A0B4XR11_9GAMM/1135-1228  AC A0A0B4XR11.1
#=GS A0A3S1JKJ2_9BACT/47-142     AC A0A3S1JKJ2.1
#=GS A0A2V4PFE5_9ACTN/74-167     AC A0A2V4PFE5.1
#=GS A0A0E0GWH6_ORYNI/63-176     AC A0A0E0GWH6.1
#=GS A0A2W5YD52_9MICO/37-154     AC A0A2W5YD52.1
#=GS A0A445E7P3_ARAHY/58-146     AC A0A445E7P3.1
#=GS A0A287KQG1_HORVV/64-177     AC A0A287KQG1.1
#=GS Q2RJB5_MOOTA/40-136         AC Q2RJB5.1
#=GS A0A239GIK2_9ACTN/59-152     AC A0A239GIK2.1
#=GS A0A2G9GCY7_9LAMI/213-316    AC A0A2G9GCY7.1
#=GS H3GKX6_PHYRM/195-301        AC H3GKX6.1
#=GS A0A1I0QB08_9BACT/25-110     AC A0A1I0QB08.1
#=GS A2Z2W2_ORYSI/192-303        AC A2Z2W2.1
#=GS A0A287PGY1_HORVV/207-315    AC A0A287PGY1.1
#=GS F0SF10_PSESL/42-120         AC F0SF10.1
#=GS A0A314UE39_PRUYE/66-156     AC A0A314UE39.1
#=GS A0A397ZF68_BRACM/71-183     AC A0A397ZF68.1
#=GS A0A287LQV8_HORVV/27-118     AC A0A287LQV8.1
#=GS A0A371QTA1_9BACT/46-147     AC A0A371QTA1.1
#=GS A0A0E0P3W7_ORYRU/8-89       AC A0A0E0P3W7.1
#=GS A0A3M9NLM8_9BACT/236-331    AC A0A3M9NLM8.1
#=GS A0A239TEE3_9FIRM/47-138     AC A0A239TEE3.1
#=GS L1QCP3_9CLOT/62-150         AC L1QCP3.1
#=GS I3K264_ORENI/31-124         AC I3K264.1
#=GS PPA19_ARATH/54-134          AC Q9LX83.1
#=GS A0A1B1BP79_9MICO/60-156     AC A0A1B1BP79.1
#=GS A0A445AP86_ARAHY/44-133     AC A0A445AP86.1
#=GS A0A4D8ZGJ3_SALSN/144-247    AC A0A4D8ZGJ3.1
#=GS G3T978_LOXAF/15-108         AC G3T978.1
#=GS A0A2P5HKA3_9PEZI/34-124     AC A0A2P5HKA3.1
#=GS A0A183K6E6_9TREM/6-111      AC A0A183K6E6.1
#=GS A0A152A1C3_9MYCE/25-125     AC A0A152A1C3.1
#=GS F6GSV7_VITVI/176-269        AC F6GSV7.1
#=GS A0A0P7A371_9FLAO/51-160     AC A0A0P7A371.1
#=GS I2EY97_EMTOG/35-116         AC I2EY97.1
#=GS M0TDV4_MUSAM/60-151         AC M0TDV4.1
#=GS A0A2G5C7B1_AQUCA/53-145     AC A0A2G5C7B1.1
#=GS A6P1K6_9FIRM/1122-1220      AC A6P1K6.1
#=GS A0A1T5NWC3_9BACT/36-115     AC A0A1T5NWC3.1
#=GS Q55F12_DICDI/265-365        AC Q55F12.1
#=GS A0A0E0J6R6_ORYNI/52-145     AC A0A0E0J6R6.1
#=GS A0A0F8UYX3_9EURO/39-125     AC A0A0F8UYX3.1
#=GS A0A0H4C4M8_9ACTN/79-184     AC A0A0H4C4M8.1
#=GS A0A1I1P2W2_9GAMM/5-87       AC A0A1I1P2W2.1
#=GS A0A0Q3KG55_BRADI/60-145     AC A0A0Q3KG55.1
#=GS A0A445LVK7_GLYSO/52-144     AC A0A445LVK7.1
#=GS A0A225W288_9STRA/1-82       AC A0A225W288.1
#=GS A0A068URS0_COFCA/69-181     AC A0A068URS0.1
#=GS W1NS96_AMBTC/165-268        AC W1NS96.1
#=GS A0A103YBT2_CYNCS/121-229    AC A0A103YBT2.1
#=GS A0A0D2UQJ7_GOSRA/61-152     AC A0A0D2UQJ7.1
#=GS A0A022QQR8_ERYGU/147-250    AC A0A022QQR8.1
#=GS A0A0N1NSL9_9ACTN/76-181     AC A0A0N1NSL9.1
#=GS A0A1Q9K481_9FIRM/59-150     AC A0A1Q9K481.1
#=GS J3MI39_ORYBR/1-92           AC J3MI39.1
#=GS C6W736_DYAFD/37-134         AC C6W736.1
#=GS A0A0S3T7X7_PHAAN/74-185     AC A0A0S3T7X7.1
#=GS E6U966_ETHHY/1003-1104      AC E6U966.1
#=GS A0A2P5SHQ1_GOSBA/99-194     AC A0A2P5SHQ1.1
#=GS A0A1N7JZX1_9CORY/82-238     AC A0A1N7JZX1.1
#=GS F2UE49_SALR5/70-162         AC F2UE49.1
#=GS A0A199UA72_MANES/49-136     AC A0A199UA72.1
#=GS A0A3B6MLY3_WHEAT/204-312    AC A0A3B6MLY3.1
#=GS A0A2G3CQC2_CAPCH/60-151     AC A0A2G3CQC2.1
#=GS A0A1L9S6J4_9EURO/68-172     AC A0A1L9S6J4.1
#=GS A0A0S3SEL0_PHAAN/226-328    AC A0A0S3SEL0.1
#=GS W9QW82_9ROSA/68-176         AC W9QW82.1
#=GS E6ZZR1_SPORE/35-121         AC E6ZZR1.1
#=GS A0A0C2B9W2_9ACTN/48-143     AC A0A0C2B9W2.1
#=GS A0A0Q2UDS4_MYCGO/59-152     AC A0A0Q2UDS4.1
#=GS A0A2U1B9N9_9FIRM/468-561    AC A0A2U1B9N9.1
#=GS U5N093_CLOSA/53-184         AC U5N093.1
#=GS A0A0D9X687_9ORYZ/191-320    AC A0A0D9X687.1
#=GS A0A0W8CEX6_PHYNI/61-158     AC A0A0W8CEX6.1
#=GS A0A1Y3NJJ4_PIRSE/136-234    AC A0A1Y3NJJ4.1
#=GS R5TSN0_9FIRM/58-150         AC R5TSN0.1
#=GS A0A0S3RZ29_PHAAN/58-150     AC A0A0S3RZ29.1
#=GS A0A1Y1XJ59_9FUNG/173-264    AC A0A1Y1XJ59.1
#=GS F6HCG3_VITVI/64-155         AC F6HCG3.1
#=GS G0J158_CYCMS/31-116         AC G0J158.1
#=GS V4LVF1_EUTSA/43-130         AC V4LVF1.1
#=GS A0A084A305_9GAMM/1295-1387  AC A0A084A305.1
#=GS A0A1U7MAJ6_9FIRM/37-133     AC A0A1U7MAJ6.1
#=GS A0A4D9BMJ6_SALSN/62-153     AC A0A4D9BMJ6.1
#=GS A0A1B8F932_9PEZI/70-174     AC A0A1B8F932.1
#=GS A0A443N7R2_9MAGN/177-285    AC A0A443N7R2.1
#=GS A0A0N4Z850_PARTI/85-181     AC A0A0N4Z850.1
#=GS PPA22_ARATH/47-134          AC Q8S340.1
#=GS A0A0M8TGT8_9ACTN/77-182     AC A0A0M8TGT8.1
#=GS H2NYR2_PONAB/32-125         AC H2NYR2.1
#=GS A0A151RJ06_CAJCA/48-135     AC A0A151RJ06.1
#=GS PPA23_ARATH/65-176          AC Q6TPH1.2
#=GS M1D309_SOLTU/64-176         AC M1D309.1
#=GS A0A453J4H1_AEGTS/52-144     AC A0A453J4H1.1
#=GS A0A0R3T710_HYMNN/1-83       AC A0A0R3T710.1
#=GS R5V6E3_9FIRM/61-152         AC R5V6E3.1
#=GS A0A151TM13_CAJCA/69-172     AC A0A151TM13.1
#=GS A0A0E0GPQ6_ORYNI/68-155     AC A0A0E0GPQ6.1
#=GS A0A327X253_9BACT/229-325    AC A0A327X253.1
#=GS A0A2I0B7Q8_9ASPA/177-286    AC A0A2I0B7Q8.1
#=GS M4EZR3_BRARP/53-144         AC M4EZR3.1
#=GS A0A2T5LW21_9EURO/69-173     AC A0A2T5LW21.1
#=GS A0A368S3T2_SETIT/151-238    AC A0A368S3T2.1
#=GS A0A1Z5S6B0_SORBI/97-184     AC A0A1Z5S6B0.1
#=GS A0A418KP39_9ACTN/58-160     AC A0A418KP39.1
#=GS Q558S4_DICDI/64-211         AC Q558S4.1
#=GS A0A1U8HHP2_GOSHI/169-277    AC A0A1U8HHP2.1
#=GS A0A0D9QV89_CHLSB/36-129     AC A0A0D9QV89.1
#=GS A0A2A2LRS8_9BILA/24-111     AC A0A2A2LRS8.1
#=GS A0A0E0BFE2_9ORYZ/81-168     AC A0A0E0BFE2.1
#=GS S2YZM2_9CORY/32-121         AC S2YZM2.1
#=GS A0A1W2FIZ4_KIBAR/61-160     AC A0A1W2FIZ4.1
#=GS A0A445HTP7_GLYSO/62-153     AC A0A445HTP7.1
#=GS W7YGM9_9BACL/505-616        AC W7YGM9.1
#=GS A0A0J6ZPB5_9FIRM/31-125     AC A0A0J6ZPB5.1
#=GS M1LNG2_9CLOT/52-184         AC M1LNG2.1
#=GS A0A2G2ZZQ2_CAPAN/168-276    AC A0A2G2ZZQ2.1
#=GS A0A2M8T791_9CLOT/33-147     AC A0A2M8T791.1
#=GS A0A067CHC5_SAPPC/146-256    AC A0A067CHC5.1
#=GS A0A162K7R7_CORDF/1-75       AC A0A162K7R7.1
#=GS V7D128_PHAVU/94-181         AC V7D128.1
#=GS A0A395M6D1_9HYPO/56-142     AC A0A395M6D1.1
#=GS A0A1R3HN16_9ROSI/177-285    AC A0A1R3HN16.1
#=GS A0A176KZE7_9ACTN/79-184     AC A0A176KZE7.1
#=GS A0A101JTV9_9ACTN/39-135     AC A0A101JTV9.1
#=GS A0A1G6AN18_9GAMM/60-156     AC A0A1G6AN18.1
#=GS A0A0D3DL36_BRAOL/58-149     AC A0A0D3DL36.1
#=GS W2GZY7_PHYPR/127-222        AC W2GZY7.1
#=GS D0P2U5_PHYIT/68-166         AC D0P2U5.1
#=GS F2CQQ2_HORVV/59-150         AC F2CQQ2.1
#=GS A0A072V0S0_MEDTR/190-295    AC A0A072V0S0.1
#=GS L7FIU4_9ACTN/50-149         AC L7FIU4.1
#=GS A0A199UZM6_ANACO/1887-1995  AC A0A199UZM6.1
#=GS A0A1C4Z003_MICEC/56-158     AC A0A1C4Z003.1
#=GS A0A3P1ZCX8_9BACT/45-136     AC A0A3P1ZCX8.1
#=GS A0A498JX46_MALDO/75-187     AC A0A498JX46.1
#=GS A0A2J6KEY1_LACSA/56-147     AC A0A2J6KEY1.1
#=GS A0A2P5FP23_TREOI/51-141     AC A0A2P5FP23.1
#=GS A0A0C1HJ00_9BACT/26-113     AC A0A0C1HJ00.1
#=GS A0A1I8H1P7_9PLAT/60-157     AC A0A1I8H1P7.1
#=GS A0A103YF19_CYNCS/43-130     AC A0A103YF19.1
#=GS A9V290_MONBE/158-252        AC A9V290.1
#=GS A0A1T5IYV1_9MICO/248-343    AC A0A1T5IYV1.1
#=GS A0A1B6QE87_SORBI/223-331    AC A0A1B6QE87.1
#=GS A0A1S3G0R5_DIPOR/33-126     AC A0A1S3G0R5.1
#=GS A0A0D9XP49_9ORYZ/191-280    AC A0A0D9XP49.1
#=GS A0A2T7NW89_POMCA/25-119     AC A0A2T7NW89.1
#=GS A0A0P0Y702_ORYSJ/52-145     AC A0A0P0Y702.1
#=GS A0A1I6V4P8_9SPHI/233-328    AC A0A1I6V4P8.1
#=GS K3Z4N2_SETIT/170-278        AC K3Z4N2.1
#=GS A0A399V7J1_9ACTN/36-151     AC A0A399V7J1.1
#=GS G0MR96_CAEBE/22-117         AC G0MR96.1
#=GS A0A2P5QZ49_GOSBA/56-147     AC A0A2P5QZ49.1
#=GS A0A2G9FVX8_9LAMI/45-134     AC A0A2G9FVX8.1
#=GS G7JFF6_MEDTR/55-146         AC G7JFF6.1
#=GS U5C492_9BACT/32-128         AC U5C492.1
#=GS A0A1Z5TKY9_HORWE/71-175     AC A0A1Z5TKY9.1
#=GS A0A0M8N1P0_9HYPO/1-78       AC A0A0M8N1P0.1
#=GS G7PXI5_MACFA/32-125         AC G7PXI5.1
#=GS A0A1S2YQR1_CICAR/56-147     AC A0A1S2YQR1.1
#=GS A0A2I4H897_JUGRE/192-300    AC A0A2I4H897.1
#=GS A0A287RUK5_HORVV/246-354    AC A0A287RUK5.1
#=GS A0A3Q7ETE4_SOLLC/476-567    AC A0A3Q7ETE4.1
#=GS W2K5J1_PHYPR/67-164         AC W2K5J1.1
#=GS A0A2D0NA75_9BACT/34-130     AC A0A2D0NA75.1
#=GS A0A1E3BAG0_9EURO/35-124     AC A0A1E3BAG0.1
#=GS Q7S852_NEUCR/37-123         AC Q7S852.1
#=GS PPA26_ARATH/54-145          AC Q949Y3.1
#=GS Q5GZX0_XANOR/14-120         AC Q5GZX0.1
#=GS A0A3Q0IHV7_DIACI/3-57       AC A0A3Q0IHV7.1
#=GS A0A2K1Z6S3_POPTR/80-171     AC A0A2K1Z6S3.1
#=GS Q2QXM4_ORYSJ/55-142         AC Q2QXM4.2
#=GS A0A1U7WIB4_NICSY/171-279    AC A0A1U7WIB4.1
#=GS A0A3N4PA28_9BACT/27-117     AC A0A3N4PA28.1
#=GS A0A2D0N8B1_9BACT/199-277    AC A0A2D0N8B1.1
#=GS A0A2J6L0Z1_LACSA/58-149     AC A0A2J6L0Z1.1
#=GS Q0RB83_FRAAA/29-123         AC Q0RB83.1
#=GS A0A2V2Z451_9BACL/57-153     AC A0A2V2Z451.1
#=GS A0A2G9H1R0_9LAMI/1-90       AC A0A2G9H1R0.1
#=GS D1PWN8_9BACT/159-243        AC D1PWN8.1
#=GS W2LXT0_PHYPR/61-158         AC W2LXT0.1
#=GS A0A3N7EPV3_POPTR/71-182     AC A0A3N7EPV3.1
#=GS A0A067RQT9_ZOONE/26-117     AC A0A067RQT9.1
#=GS V5FXX8_BYSSN/72-175         AC V5FXX8.1
#=GS A0A1W4V1H7_DROFC/34-127     AC A0A1W4V1H7.1
#=GS A0A182PRK1_9DIPT/33-124     AC A0A182PRK1.1
#=GS D3BNV5_POLPP/26-122         AC D3BNV5.1
#=GS A0A2H5NIV5_CITUN/76-188     AC A0A2H5NIV5.1
#=GS V4VFD2_9ROSI/169-277        AC V4VFD2.1
#=GS A0A1U8LIQ6_GOSHI/70-161     AC A0A1U8LIQ6.1
#=GS A0A061FDT9_THECC/58-149     AC A0A061FDT9.1
#=GS A0A1R3KEH3_COCAP/7-97       AC A0A1R3KEH3.1
#=GS A0A1S9DGG5_ASPOZ/68-171     AC A0A1S9DGG5.1
#=GS A0A1V1P0R3_9DELT/26-117     AC A0A1V1P0R3.1
#=GS A0A3M0I629_9ACTN/45-164     AC A0A3M0I629.1
#=GS R5NYR9_9BACT/165-252        AC R5NYR9.1
#=GS L0DPB6_SINAD/41-130         AC L0DPB6.1
#=GS A0A0E0GWH3_ORYNI/63-176     AC A0A0E0GWH3.1
#=GS K1VCE8_TRIAC/65-157         AC K1VCE8.1
#=GS A0A0N9UTU7_SPHMC/57-153     AC A0A0N9UTU7.1
#=GS K7KSQ8_SOYBN/64-155         AC K7KSQ8.1
#=GS M4CRV6_BRARP/43-132         AC M4CRV6.1
#=GS A0A168C0A1_CORDF/71-172     AC A0A168C0A1.1
#=GS A0A1H9RC17_9BACI/45-141     AC A0A1H9RC17.1
#=GS A0A068VN19_COFCA/143-246    AC A0A068VN19.1
#=GS A0A1W2TN67_ROSNE/37-126     AC A0A1W2TN67.1
#=GS A0A1I8M653_MUSDO/34-126     AC A0A1I8M653.1
#=GS A0A397YLJ3_BRACM/52-139     AC A0A397YLJ3.1
#=GS A0A0L0C031_LUCCU/782-876    AC A0A0L0C031.1
#=GS A0A0B2RDB8_GLYSO/54-145     AC A0A0B2RDB8.1
#=GS A0A2I0WT47_9ASPA/78-178     AC A0A2I0WT47.1
#=GS A0A1L9R7W5_ASPWE/26-113     AC A0A1L9R7W5.1
#=GS A0A3B6QB89_WHEAT/63-155     AC A0A3B6QB89.1
#=GS A0A2P5DE25_PARAD/54-144     AC A0A2P5DE25.1
#=GS A0A399T099_9BACT/239-334    AC A0A399T099.1
#=GS A0A0D9ZFS9_9ORYZ/63-176     AC A0A0D9ZFS9.1
#=GS A0A1F8A571_9EURO/68-171     AC A0A1F8A571.1
#=GS A0A0L9TDY1_PHAAN/1-76       AC A0A0L9TDY1.1
#=GS A0A3F3PQ07_9EURO/33-122     AC A0A3F3PQ07.1
#=GS A0A0L9VA09_PHAAN/42-132     AC A0A0L9VA09.1
#=GS A0A2P6NDB2_9MYCE/900-991    AC A0A2P6NDB2.1
#=GS A0A318ZAV6_9EURO/70-173     AC A0A318ZAV6.1
#=GS A0A287PYX6_HORVV/8-116      AC A0A287PYX6.1
#=GS A0A2G5ETN3_AQUCA/52-139     AC A0A2G5ETN3.1
#=GS V4TY65_9ROSI/43-130         AC V4TY65.1
#=GS A0A0D9YFQ5_9ORYZ/57-148     AC A0A0D9YFQ5.1
#=GS A0A089ICS5_9BACL/241-351    AC A0A089ICS5.1
#=GS A0A1U8AXB1_NELNU/58-150     AC A0A1U8AXB1.1
#=GS B9I3R0_POPTR/186-294        AC B9I3R0.2
#=GS A0A093XQ33_9PEZI/70-174     AC A0A093XQ33.1
#=GS A0A285QF37_9ACTN/63-156     AC A0A285QF37.1
#=GS B8B930_ORYSI/177-288        AC B8B930.1
#=GS G7MAH7_9CLOT/52-184         AC G7MAH7.1
#=GS A0A0L0DAM6_THETB/132-227    AC A0A0L0DAM6.1
#=GS A0A366SC55_9HYPO/27-115     AC A0A366SC55.1
#=GS A0A287KQI9_HORVV/151-264    AC A0A287KQI9.1
#=GS A0A250X1J2_9CHLO/109-223    AC A0A250X1J2.1
#=GS A0A0E0M6L2_ORYPU/151-257    AC A0A0E0M6L2.1
#=GS W9RCP7_9ROSA/148-251        AC W9RCP7.1
#=GS A0A1H3L5W0_9MICO/65-157     AC A0A1H3L5W0.1
#=GS C5X792_SORBI/144-249        AC C5X792.1
#=GS A0A3D8RLK6_9HELO/34-123     AC A0A3D8RLK6.1
#=GS A0A067KYN6_JATCU/169-277    AC A0A067KYN6.1
#=GS A0A2I4G9X8_JUGRE/90-202     AC A0A2I4G9X8.1
#=GS A0A2U1NAI3_ARTAN/148-251    AC A0A2U1NAI3.1
#=GS C5YHP9_SORBI/177-295        AC C5YHP9.1
#=GS B5DL04_DROPS/42-135         AC B5DL04.2
#=GS A0A316VFT2_9BASI/31-118     AC A0A316VFT2.1
#=GS A0A423W4S9_9PEZI/34-122     AC A0A423W4S9.1
#=GS A0A2A7MCH4_9CLOT/61-158     AC A0A2A7MCH4.1
#=GS A0A1R4KS05_9MICO/239-330    AC A0A1R4KS05.1
#=GS A0A101NH64_9ACTN/73-178     AC A0A101NH64.1
#=GS A0A1N7M651_9FLAO/19-110     AC A0A1N7M651.1
#=GS A0A1Y2A8N5_9FUNG/162-243    AC A0A1Y2A8N5.1
#=GS A0A2K9PU26_9FLAO/27-111     AC A0A2K9PU26.1
#=GS A0A1M5APN5_9BACT/32-132     AC A0A1M5APN5.1
#=GS A0A094F5E5_9PEZI/35-126     AC A0A094F5E5.1
#=GS A0A373ISW6_9BACE/260-355    AC A0A373ISW6.1
#=GS A0A1Y2UXQ5_9PEZI/34-121     AC A0A1Y2UXQ5.1
#=GS A0A3Q7TYB7_VULVU/29-122     AC A0A3Q7TYB7.1
#=GS A0A0E0J6R9_ORYNI/55-142     AC A0A0E0J6R9.1
#=GS A0A078HHZ8_BRANA/169-278    AC A0A078HHZ8.1
#=GS A0A2W1LE63_9BACL/84-181     AC A0A2W1LE63.1
#=GS A0A2J6THN9_9HELO/35-119     AC A0A2J6THN9.1
#=GS A0A0D2PZ78_GOSRA/70-161     AC A0A0D2PZ78.1
#=GS A0A0G4IMQ6_PLABS/125-232    AC A0A0G4IMQ6.1
#=GS M5WPE3_PRUPE/44-131         AC M5WPE3.1
#=GS A0A0D9XP52_9ORYZ/56-143     AC A0A0D9XP52.1
#=GS A0A078GJQ4_BRANA/60-151     AC A0A078GJQ4.1
#=GS M5G7A8_DACPD/34-125         AC M5G7A8.1
#=GS A0A016V9N2_9BILA/21-106     AC A0A016V9N2.1
#=GS A0A0W8C2W9_PHYNI/198-304    AC A0A0W8C2W9.1
#=GS A0A093YXR7_9PEZI/36-127     AC A0A093YXR7.1
#=GS A0A329T3M8_9STRA/174-279    AC A0A329T3M8.1
#=GS B4GTD5_DROPE/5-87           AC B4GTD5.1
#=GS A0A3B6JPH0_WHEAT/174-282    AC A0A3B6JPH0.1
#=GS A6EKR3_9SPHI/41-139         AC A6EKR3.1
#=GS C0XQQ7_CORLD/51-139         AC C0XQQ7.1
#=GS A0A1U8Q5P1_NELNU/68-179     AC A0A1U8Q5P1.1
#=GS A0A1S3YIE2_TOBAC/61-152     AC A0A1S3YIE2.1
#=GS J3MUP7_ORYBR/128-244        AC J3MUP7.1
#=GS A0A059D7S0_EUCGR/142-244    AC A0A059D7S0.1
#=GS C5YRR5_SORBI/67-157         AC C5YRR5.1
#=GS A0A1S3UGB0_VIGRR/49-141     AC A0A1S3UGB0.1
#=GS A0A316BWZ0_9FIRM/249-342    AC A0A316BWZ0.1
#=GS A0A2J6JKA9_LACSA/80-194     AC A0A2J6JKA9.1
#=GS A0A314Z2G8_PRUYE/223-325    AC A0A314Z2G8.1
#=GS A0A1U8IQI6_GOSHI/118-205    AC A0A1U8IQI6.1
#=GS A0A1D6EVQ6_MAIZE/216-324    AC A0A1D6EVQ6.1
#=GS A0A3N4NGB7_9FLAO/43-139     AC A0A3N4NGB7.1
#=GS A0A024FT75_9STRA/1069-1175  AC A0A024FT75.1
#=GS A0A1S4BBR3_TOBAC/71-183     AC A0A1S4BBR3.1
#=GS A0A3L6RAP6_PANMI/17-113     AC A0A3L6RAP6.1
#=GS A0A2K1KH54_PHYPA/146-249    AC A0A2K1KH54.1
#=GS A0A3B6LPZ0_WHEAT/1-95       AC A0A3B6LPZ0.1
#=GS A0A0D3BDY7_BRAOL/60-155     AC A0A0D3BDY7.1
#=GS A0A0K8JH14_9FIRM/23-115     AC A0A0K8JH14.1
#=GS A0A162L636_9PEZI/39-128     AC A0A162L636.1
#=GS A0A151SQL0_CAJCA/64-175     AC A0A151SQL0.1
#=GS A0A2I0WEI0_9ASPA/62-153     AC A0A2I0WEI0.1
#=GS A0A250VMG5_STROL/67-160     AC A0A250VMG5.1
#=GS A0A3B6TJ98_WHEAT/173-286    AC A0A3B6TJ98.1
#=GS A0A0E0I9N1_ORYNI/78-204     AC A0A0E0I9N1.1
#=GS A0A0L0C031_LUCCU/403-493    AC A0A0L0C031.1
#=GS M5W8W6_PRUPE/49-136         AC M5W8W6.1
#=GS A0A1S2YQQ3_CICAR/56-147     AC A0A1S2YQQ3.1
#=GS A0A1Y4M361_9FIRM/45-141     AC A0A1Y4M361.1
#=GS L8H0Q3_ACACA/147-249        AC L8H0Q3.1
#=GS R5W6W1_9BACE/45-137         AC R5W6W1.1
#=GS A0A416A1E8_9BACT/61-175     AC A0A416A1E8.1
#=GS A0A167JUQ1_9HYPO/73-174     AC A0A167JUQ1.1
#=GS A0A0D9XWY5_9ORYZ/54-149     AC A0A0D9XWY5.1
#=GS A0A394D992_LUPAN/1-80       AC A0A394D992.1
#=GS A0A1S1R2X8_9ACTN/64-157     AC A0A1S1R2X8.1
#=GS A0A445NFE4_STRNE/78-183     AC A0A445NFE4.1
#=GS A0A0A3IDC1_9BACI/37-135     AC A0A0A3IDC1.1
#=GS A0A3N7G7Z6_POPTR/214-316    AC A0A3N7G7Z6.1
#=GS A0A0D9ZFS7_9ORYZ/63-176     AC A0A0D9ZFS7.1
#=GS A0A1C4M309_9ACTN/81-187     AC A0A1C4M309.1
#=GS W2KFL6_PHYPR/95-193         AC W2KFL6.1
#=GS A0A432Z467_9GAMM/62-158     AC A0A432Z467.1
#=GS A0A1T4VC60_9FIRM/192-292    AC A0A1T4VC60.1
#=GS B8BJ49_ORYSI/141-230        AC B8BJ49.1
#=GS A0A2K6BX24_MACNE/32-125     AC A0A2K6BX24.1
#=GS A0A0B8NWN3_9VIBR/540-628    AC A0A0B8NWN3.1
#=GS A0A0W0GK24_9CHLR/38-130     AC A0A0W0GK24.1
#=GS A0A287LTG8_HORVV/260-363    AC A0A287LTG8.1
#=GS A0A0F2TCC9_STRR3/62-155     AC A0A0F2TCC9.1
#=GS A0A1S3VHJ4_VIGRR/42-129     AC A0A1S3VHJ4.1
#=GS A0A2G9DYE6_9ACTN/77-182     AC A0A2G9DYE6.1
#=GS A0A1I5WC78_9BACT/35-118     AC A0A1I5WC78.1
#=GS J5JZ65_BEAB2/73-174         AC J5JZ65.1
#=GS A0A2P6VH12_9CHLO/37-144     AC A0A2P6VH12.1
#=GS A0A1S3IPU2_LINUN/26-117     AC A0A1S3IPU2.1
#=GS A0A2H2HW63_CAEJA/22-117     AC A0A2H2HW63.1
#=GS A0A257J0L7_9BACT/184-266    AC A0A257J0L7.1
#=GS A0A371HTX4_MUCPR/46-135     AC A0A371HTX4.1
#=GS A0A1J7GDG2_LUPAN/55-147     AC A0A1J7GDG2.1
#=GS D3BTA9_POLPP/135-238        AC D3BTA9.1
#=GS A0A3M6UK94_9CNID/46-139     AC A0A3M6UK94.1
#=GS D7M101_ARALL/60-151         AC D7M101.1
#=GS A0A1D6PZG0_MAIZE/83-201     AC A0A1D6PZG0.1
#=GS A0A1G4G5D3_9PORP/29-129     AC A0A1G4G5D3.1
#=GS A0A0D3FRC7_9ORYZ/8-89       AC A0A0D3FRC7.1
#=GS A0A1S3X0M4_TOBAC/146-249    AC A0A1S3X0M4.1
#=GS A0A3B6MUG0_WHEAT/112-220    AC A0A3B6MUG0.1
#=GS F0Z8P6_DICPU/176-291        AC F0Z8P6.1
#=GS A0A453J6B6_AEGTS/1-95       AC A0A453J6B6.1
#=GS A0A287QYZ9_HORVV/1-90       AC A0A287QYZ9.1
#=GS A0A3B6FNN2_WHEAT/63-176     AC A0A3B6FNN2.1
#=GS S0EED1_GIBF5/76-176         AC S0EED1.1
#=GS I1R876_ORYGL/57-151         AC I1R876.1
#=GS A0A1I8Q1U7_STOCA/29-121     AC A0A1I8Q1U7.1
#=GS A0A1H3JJ05_9MICO/42-138     AC A0A1H3JJ05.1
#=GS A0A329SIR5_9STRA/126-219    AC A0A329SIR5.1
#=GS A0A421GS15_9STRA/405-502    AC A0A421GS15.1
#=GS A0A2N6U5X7_9MICO/43-141     AC A0A2N6U5X7.1
#=GS R6PYW3_9CLOT/47-142         AC R6PYW3.1
#=GS A0A453D6X9_AEGTS/152-243    AC A0A453D6X9.1
#=GS D6CY00_9BACE/262-356        AC D6CY00.1
#=GS A9FKC4_SORC5/30-113         AC A9FKC4.1
#=GS A0A0K9RDF3_SPIOL/62-153     AC A0A0K9RDF3.1
#=GS K0CG74_ALCDB/71-171         AC K0CG74.1
#=GS A0A0C3HKY7_9PEZI/35-124     AC A0A0C3HKY7.1
#=GS A0A151SRK1_CAJCA/171-279    AC A0A151SRK1.1
#=GS A0A2M9J0V9_9ACTN/80-206     AC A0A2M9J0V9.1
#=GS W2QD59_PHYPN/127-222        AC W2QD59.1
#=GS A0A2R6PXR6_ACTCH/44-131     AC A0A2R6PXR6.1
#=GS A0A1I2AEQ5_9ACTN/72-165     AC A0A1I2AEQ5.1
#=GS A0A094J6Z3_9PEZI/555-641    AC A0A094J6Z3.1
#=GS G0IXD9_CYCMS/1-82           AC G0IXD9.1
#=GS A0A1T3NMS8_9ACTN/87-196     AC A0A1T3NMS8.1
#=GS S0G254_9DELT/38-135         AC S0G254.1
#=GS A0A229ULZ1_9BACL/41-141     AC A0A229ULZ1.1
#=GS A0A2A2JJL5_9BILA/21-106     AC A0A2A2JJL5.1
#=GS A0A1L9SDH3_9EURO/18-107     AC A0A1L9SDH3.1
#=GS K7KG05_SOYBN/49-137         AC K7KG05.1
#=GS A0A1U8HWM4_GOSHI/71-183     AC A0A1U8HWM4.1
#=GS R6SY00_9BACE/27-115         AC R6SY00.1
#=GS B8BMN5_ORYSI/160-268        AC B8BMN5.1
#=GS A0A1Y2D221_9FUNG/249-340    AC A0A1Y2D221.1
#=GS A0A0M4F8U3_DROBS/1-82       AC A0A0M4F8U3.1
#=GS A0A285QXM3_9ACTN/81-186     AC A0A285QXM3.1
#=GS A0A1V8V8G7_9PEZI/29-116     AC A0A1V8V8G7.1
#=GS A0A168QBF4_9BACL/340-447    AC A0A168QBF4.1
#=GS A0A0E0CIX0_9ORYZ/142-234    AC A0A0E0CIX0.1
#=GS M7ZN35_TRIUA/7-89           AC M7ZN35.1
#=GS W4UYD8_9BACE/46-137         AC W4UYD8.1
#=GS R6NKZ8_9CLOT/42-131         AC R6NKZ8.1
#=GS A0A078I3K3_BRANA/77-188     AC A0A078I3K3.1
#=GS A0A2H5QLT9_CITUN/6-103      AC A0A2H5QLT9.1
#=GS A5GAH4_GEOUR/35-130         AC A5GAH4.1
#=GS A0A1M7IK26_9STAP/74-226     AC A0A1M7IK26.1
#=GS A0A117I4Y7_9MYCO/55-148     AC A0A117I4Y7.1
#=GS Q2QN73_ORYSJ/166-274        AC Q2QN73.1
#=GS A0A3E0HEZ9_9PSEU/62-174     AC A0A3E0HEZ9.1
#=GS A0A2U1LRJ0_ARTAN/46-133     AC A0A2U1LRJ0.1
#=GS Q8P863_XANCP/50-145         AC Q8P863.1
#=GS A0A1U7VBZ0_NICSY/47-135     AC A0A1U7VBZ0.1
#=GS I1Q416_ORYGL/54-145         AC I1Q416.1
#=GS A0A453K9X4_AEGTS/1-76       AC A0A453K9X4.1
#=GS A0A2A4GFC5_9FLAO/28-113     AC A0A2A4GFC5.1
#=GS Q16FY3_AEDAE/997-1090       AC Q16FY3.1
#=GS A0A1D6IWU4_MAIZE/1-77       AC A0A1D6IWU4.1
#=GS R5SI63_9BACE/28-138         AC R5SI63.1
#=GS M7ZG61_TRIUA/228-336        AC M7ZG61.1
#=GS A0A133ZMJ6_9CORY/33-120     AC A0A133ZMJ6.1
#=GS A0A1H6YYF1_9BACT/33-130     AC A0A1H6YYF1.1
#=GS A0A287QKV9_HORVV/1-95       AC A0A287QKV9.1
#=GS A0A1R3IHW9_COCAP/36-124     AC A0A1R3IHW9.1
#=GS A0A395NRP6_TRIAR/22-112     AC A0A395NRP6.1
#=GS L8GXY1_ACACA/36-124         AC L8GXY1.1
#=GS A0A068TYH5_COFCA/1-90       AC A0A068TYH5.1
#=GS A0A2T7DG04_9POAL/66-157     AC A0A2T7DG04.1
#=GS A0A3L6TE60_PANMI/63-176     AC A0A3L6TE60.1
#=GS A0A287RUL0_HORVV/20-128     AC A0A287RUL0.1
#=GS A0A158Q835_9BILA/50-141     AC A0A158Q835.1
#=GS A0A0E0BFD6_9ORYZ/171-260    AC A0A0E0BFD6.1
#=GS A0A1Y2E5T2_9FUNG/132-223    AC A0A1Y2E5T2.1
#=GS A0A368SDQ3_SETIT/61-174     AC A0A368SDQ3.1
#=GS A0A3N7HT85_POPTR/70-182     AC A0A3N7HT85.1
#=GS A0A1U8KRW0_GOSHI/59-150     AC A0A1U8KRW0.1
#=GS A0A421GQE3_9STRA/1599-1696  AC A0A421GQE3.1
#=GS A0A068RF20_9FUNG/33-133     AC A0A068RF20.1
#=GS A0A3Q0FUL7_ALLSI/1-33       AC A0A3Q0FUL7.1
#=GS A0A287WJC2_HORVV/173-287    AC A0A287WJC2.1
#=GS A0A182U4X1_9DIPT/32-123     AC A0A182U4X1.1
#=GS H2FLJ4_CAEEL/47-140         AC H2FLJ4.1
#=GS A0A0E0QGQ8_ORYRU/77-203     AC A0A0E0QGQ8.1
#=GS A0A1H0BUV4_9FIRM/68-160     AC A0A1H0BUV4.1
#=GS A0A0K9QTC1_SPIOL/151-260    AC A0A0K9QTC1.1
#=GS A0A0A7CMP7_9STRA/20-117     AC A0A0A7CMP7.1
#=GS A0A1H6R760_9BACT/241-337    AC A0A1H6R760.1
#=GS A0A0R4IZ62_DANRE/31-124     AC A0A0R4IZ62.1
#=GS R6JE32_9CLOT/55-151         AC R6JE32.1
#=GS J3LXL2_ORYBR/50-137         AC J3LXL2.1
#=GS Q2UII9_ASPOR/34-123         AC Q2UII9.1
#=GS A0A2H3HDF4_FUSOX/566-655    AC A0A2H3HDF4.1
#=GS A0A093V4R7_TALMA/74-178     AC A0A093V4R7.1
#=GS A0A0D2TZM9_GOSRA/118-205    AC A0A0D2TZM9.1
#=GS A0A2H5MYW6_CITUN/92-179     AC A0A2H5MYW6.1
#=GS F7VZS1_SORMK/35-124         AC F7VZS1.1
#=GS A0A0D3H2H3_9ORYZ/244-355    AC A0A0D3H2H3.1
#=GS A0A2G5CXZ5_AQUCA/68-179     AC A0A2G5CXZ5.1
#=GS A0A445FIR0_GLYSO/1-75       AC A0A445FIR0.1
#=GS A0A0D2PM84_GOSRA/1-81       AC A0A0D2PM84.1
#=GS A0A2G7F6B0_9ACTN/114-219    AC A0A2G7F6B0.1
#=GS A0A067K7B9_JATCU/177-285    AC A0A067K7B9.1
#=GS A0A0A1MFY0_9BACI/311-408    AC A0A0A1MFY0.1
#=GS A0A2H3IRS7_9EURO/20-107     AC A0A2H3IRS7.1
#=GS A0A150GWH6_GONPE/73-186     AC A0A150GWH6.1
#=GS A0A151Z8J6_9MYCE/213-315    AC A0A151Z8J6.1
#=GS A0A2K3LH33_TRIPR/1-95       AC A0A2K3LH33.1
#=GS A0A2H3YCI9_PHODC/61-152     AC A0A2H3YCI9.1
#=GS A0A0M9E5Y5_9DELT/25-115     AC A0A0M9E5Y5.1
#=GS A0A0C9YWB9_9AGAM/50-141     AC A0A0C9YWB9.1
#=GS A0A182VHN1_ANOME/32-123     AC A0A182VHN1.1
#=GS W1PBU4_AMBTC/213-315        AC W1PBU4.1
#=GS E2ZE76_9FIRM/68-159         AC E2ZE76.1
#=GS A0A024TDL7_9STRA/129-242    AC A0A024TDL7.1
#=GS A0A2V2YFE1_9BACL/35-134     AC A0A2V2YFE1.1
#=GS A0A2P5BQZ2_TREOI/222-323    AC A0A2P5BQZ2.1
#=GS E8LGX2_9FIRM/41-130         AC E8LGX2.1
#=GS A0A443NCB0_9MAGN/48-135     AC A0A443NCB0.1
#=GS A0A3B3RAT3_9TELE/55-148     AC A0A3B3RAT3.1
#=GS I1QH65_ORYGL/78-204         AC I1QH65.1
#=GS A0A1M4VCE8_9CLOT/249-345    AC A0A1M4VCE8.1
#=GS A0A2S4HJ38_9GAMM/75-175     AC A0A2S4HJ38.1
#=GS D7LQH9_ARALL/142-245        AC D7LQH9.1
#=GS C9Z464_STRSW/85-190         AC C9Z464.1
#=GS A0A067D0N8_SAPPC/27-121     AC A0A067D0N8.1
#=GS F9Z4Z5_ODOSD/226-308        AC F9Z4Z5.1
#=GS A0A3E2GVF3_SCYLI/70-174     AC A0A3E2GVF3.1
#=GS A0A2J6LU81_LACSA/39-128     AC A0A2J6LU81.1
#=GS A0A1T5NM85_9BACT/52-150     AC A0A1T5NM85.1
#=GS A0A3B0K571_DROGU/5-93       AC A0A3B0K571.1
#=GS A0A329MLB8_9BACL/1077-1176  AC A0A329MLB8.1
#=GS G0J1L0_CYCMS/41-142         AC G0J1L0.1
#=GS A0A101UBD5_9ACTN/78-175     AC A0A101UBD5.1
#=GS G2GE39_9ACTN/54-173         AC G2GE39.1
#=GS A1ZX61_9BACT/24-119         AC A1ZX61.1
#=GS A0A1U8GCE5_CAPAN/72-184     AC A0A1U8GCE5.1
#=GS A0A0E0E8Q1_9ORYZ/192-303    AC A0A0E0E8Q1.1
#=GS A0A498HXB8_MALDO/48-135     AC A0A498HXB8.1
#=GS A0A2P5CIF2_TREOI/66-178     AC A0A2P5CIF2.1
#=GS A0A166GFF2_DAUCS/798-889    AC A0A166GFF2.1
#=GS A0A419XI82_9ACTN/46-140     AC A0A419XI82.1
#=GS A0A0S4PFY8_9BACT/12-101     AC A0A0S4PFY8.1
#=GS A0A2T3ATK5_AMORE/30-121     AC A0A2T3ATK5.1
#=GS A0A0E0NXB3_ORYRU/68-155     AC A0A0E0NXB3.1
#=GS A0A022R4J7_ERYGU/2-50       AC A0A022R4J7.1
#=GS A0A1D6PZG2_MAIZE/83-201     AC A0A1D6PZG2.1
#=GS W9RDX2_9ROSA/140-231        AC W9RDX2.1
#=GS A0A094CKQ9_9PEZI/36-127     AC A0A094CKQ9.1
#=GS A0A1X7LPQ6_9BURK/57-156     AC A0A1X7LPQ6.1
#=GS PPA12_ARATH/60-150          AC Q38924.3
#=GS A0A496AL46_9BACT/172-253    AC A0A496AL46.1
#=GS A0A417Y2C0_9ACTN/65-161     AC A0A417Y2C0.1
#=GS A0A2K5ELX0_AOTNA/32-124     AC A0A2K5ELX0.1
#=GS A0A251PS37_PRUPE/44-131     AC A0A251PS37.1
#=GS A0A2K3MWC0_TRIPR/157-265    AC A0A2K3MWC0.1
#=GS A0A0C3I260_9PEZI/70-174     AC A0A0C3I260.1
#=GS E1ZMF3_CHLVA/157-259        AC E1ZMF3.1
#=GS A0A078K1E6_BRANA/54-148     AC A0A078K1E6.1
#=GS A0A3Q1AHN5_AMPOC/28-121     AC A0A3Q1AHN5.1
#=GS K6U261_9CLOT/48-152         AC K6U261.1
#=GS B9RWM5_RICCO/68-179         AC B9RWM5.1
#=GS A0A3B6LW33_WHEAT/58-149     AC A0A3B6LW33.1
#=GS A0A371WDV4_9RHIZ/60-153     AC A0A371WDV4.1
#=GS W2QC13_PHYPN/174-279        AC W2QC13.1
#=GS A0A0R3NYA0_DROPS/42-143     AC A0A0R3NYA0.1
#=GS W3WV72_PESFW/34-123         AC W3WV72.1
#=GS A0A251TP24_HELAN/77-168     AC A0A251TP24.1
#=GS A0A103XN43_CYNCS/64-156     AC A0A103XN43.1
#=GS A0A2H3TUC6_FUSOX/75-176     AC A0A2H3TUC6.1
#=GS A0A3B6N0B8_WHEAT/58-149     AC A0A3B6N0B8.1
#=GS A0A287KQG2_HORVV/25-108     AC A0A287KQG2.1
#=GS A0A1P9WX30_9BACT/28-107     AC A0A1P9WX30.1
#=GS R5CVL7_9FIRM/1065-1160      AC R5CVL7.1
#=GS Q7UIH3_RHOBA/36-128         AC Q7UIH3.1
#=GS A0A3S3RR17_9ACAR/1-78       AC A0A3S3RR17.1
#=GS C5YDS8_SORBI/167-275        AC C5YDS8.1
#=GS A0A0E0BFE0_9ORYZ/171-260    AC A0A0E0BFE0.1
#=GS A0A3M0I7P8_9ACTN/77-182     AC A0A3M0I7P8.1
#=GS A0A072U6M0_MEDTR/71-182     AC A0A072U6M0.1
#=GS A0A453M703_AEGTS/58-149     AC A0A453M703.1
#=GS A0A0F4GTH6_9PEZI/1-75       AC A0A0F4GTH6.1
#=GS M4EDL4_BRARP/145-248        AC M4EDL4.1
#=GS A0A2S4D4T9_9BACT/31-120     AC A0A2S4D4T9.1
#=GS A0A067FD35_CITSI/54-141     AC A0A067FD35.1
#=GS A0A1X6WUK7_9MICO/235-328    AC A0A1X6WUK7.1
#=GS A0A2U1T6P3_9CORY/92-248     AC A0A2U1T6P3.1
#=GS A0A0L9V9D4_PHAAN/54-145     AC A0A0L9V9D4.1
#=GS A0A182K2F8_9DIPT/32-123     AC A0A182K2F8.1
#=GS A0A2J6JTY2_LACSA/190-297    AC A0A2J6JTY2.1
#=GS A0A2A4K1R1_HELVI/33-124     AC A0A2A4K1R1.1
#=GS K4R292_STRDJ/76-181         AC K4R292.1
#=GS A0A016V8J0_9BILA/17-103     AC A0A016V8J0.1
#=GS A0A2W2EAX9_9ACTN/2-104      AC A0A2W2EAX9.1
#=GS A0A1R3IHW1_COCAP/58-145     AC A0A1R3IHW1.1
#=GS A0A0D3HW06_9ORYZ/173-281    AC A0A0D3HW06.1
#=GS A0A1C3N322_9ACTN/47-141     AC A0A1C3N322.1
#=GS M1AIC8_SOLTU/168-276        AC M1AIC8.1
#=GS A0A0D3CI07_BRAOL/43-130     AC A0A0D3CI07.1
#=GS A0A444YF14_ARAHY/51-141     AC A0A444YF14.1
#=GS D9WCQ7_9ACTN/82-187         AC D9WCQ7.1
#=GS A0A1S3BYE7_CUCME/44-138     AC A0A1S3BYE7.1
#=GS A0A0S3R2M5_PHAAN/149-252    AC A0A0S3R2M5.1
#=GS A0A2H5NS70_CITUN/62-153     AC A0A2H5NS70.1
#=GS A0A1J6WU52_9BACI/341-446    AC A0A1J6WU52.1
#=GS A0A1H4DQA8_9BACT/50-148     AC A0A1H4DQA8.1
#=GS E3LNV3_CAERE/25-110         AC E3LNV3.1
#=GS C3ZMT7_BRAFL/37-127         AC C3ZMT7.1
#=GS D0P2U6_PHYIT/97-195         AC D0P2U6.1
#=GS A0A2J6L6J8_LACSA/59-150     AC A0A2J6L6J8.1
#=GS G5A0U3_PHYSP/66-163         AC G5A0U3.1
#=GS A0A1Q4WGL1_9ACTN/78-183     AC A0A1Q4WGL1.1
#=GS R6NFW2_9CLOT/686-801        AC R6NFW2.1
#=GS V9NC54_MANES/69-180         AC V9NC54.1
#=GS A0A2I9DWI0_9FLAO/51-130     AC A0A2I9DWI0.1
#=GS A0A2K5NLS1_CERAT/32-125     AC A0A2K5NLS1.1
#=GS A0A0P0NHK2_9SPHI/50-133     AC A0A0P0NHK2.1
#=GS A0A259URZ9_9FIRM/37-133     AC A0A259URZ9.1
#=GS A0A1B8GV10_9PEZI/70-174     AC A0A1B8GV10.1
#=GS A0A1H4U9I6_9ACTN/57-151     AC A0A1H4U9I6.1
#=GS A0A368N671_9GAMM/255-345    AC A0A368N671.1
#=GS M2Y0C9_DOTSN/29-119         AC M2Y0C9.1
#=GS A0A068UG42_COFCA/17-108     AC A0A068UG42.1
#=GS A0A2H9ZZE8_9ASPA/51-138     AC A0A2H9ZZE8.1
#=GS A0A1V9X837_9ACAR/28-122     AC A0A1V9X837.1
#=GS A0A3R7KZB0_9STRA/189-267    AC A0A3R7KZB0.1
#=GS S0FLP3_CLOCB/32-141         AC S0FLP3.1
#=GS A0A2K3MRU4_TRIPR/1-78       AC A0A2K3MRU4.1
#=GS A0A0K9NKL2_ZOSMR/168-277    AC A0A0K9NKL2.1
#=GS A0A251R5M5_PRUPE/86-193     AC A0A251R5M5.1
#=GS A0A2P6S8J6_ROSCH/218-321    AC A0A2P6S8J6.1
#=GS A0A2G5IL66_9ACTN/77-182     AC A0A2G5IL66.1
#=GS A0A1W1XNZ7_9CLOT/49-144     AC A0A1W1XNZ7.1
#=GS D0MUK6_PHYIT/61-158         AC D0MUK6.1
#=GS T1KY41_TETUR/31-122         AC T1KY41.1
#=GS A0A251TN46_HELAN/55-146     AC A0A251TN46.1
#=GS A0A3P9BSB2_9CICH/28-121     AC A0A3P9BSB2.1
#=GS A0A3R9SMR5_9ACTN/78-183     AC A0A3R9SMR5.1
#=GS A0A0E0EJS7_9ORYZ/78-204     AC A0A0E0EJS7.1
#=GS A0A077S0P4_WHEAT/59-150     AC A0A077S0P4.1
#=GS A0A2P5DDG7_PARAD/60-151     AC A0A2P5DDG7.1
#=GS A0A453L815_AEGTS/190-299    AC A0A453L815.1
#=GS A0A2G3BZE6_CAPCH/196-304    AC A0A2G3BZE6.1
#=GS A0A1B7LHP2_9FIRM/21-98      AC A0A1B7LHP2.1
#=GS A0A445C231_ARAHY/187-295    AC A0A445C231.1
#=GS A0A143ZS48_9FIRM/974-1067   AC A0A143ZS48.1
#=GS A0A2C9UF30_MANES/117-160    AC A0A2C9UF30.1
#=GS A0A1V9GAQ4_9BACT/54-151     AC A0A1V9GAQ4.1
#=GS A0A2P5DBZ6_PARAD/66-178     AC A0A2P5DBZ6.1
#=GS A0A059CLT2_EUCGR/55-146     AC A0A059CLT2.1
#=GS A0A3B6MRZ2_WHEAT/84-202     AC A0A3B6MRZ2.1
#=GS A0A445EMZ6_ARAHY/53-144     AC A0A445EMZ6.1
#=GS R4K654_CLOPA/61-157         AC R4K654.1
#=GS A0A090Z5Z4_PAEMA/721-832    AC A0A090Z5Z4.1
#=GS A0A267DIT8_9PLAT/56-151     AC A0A267DIT8.1
#=GS G2FUL4_9FIRM/652-750        AC G2FUL4.1
#=GS A0A498JJC2_MALDO/20-128     AC A0A498JJC2.1
#=GS I1IG28_BRADI/54-147         AC I1IG28.1
#=GS A0A2K3D861_CHLRE/208-343    AC A0A2K3D861.1
#=GS A0A2Y9C685_9FIRM/107-200    AC A0A2Y9C685.1
#=GS A0A2P6TG45_CHLSO/63-178     AC A0A2P6TG45.1
#=GS A0A067F911_CITSI/43-130     AC A0A067F911.1
#=GS A0A2G5SI89_9PELO/46-139     AC A0A2G5SI89.1
#=GS K7LSE2_SOYBN/217-319        AC K7LSE2.1
#=GS A0A061GNY5_THECC/56-147     AC A0A061GNY5.1
#=GS A0A1Q5M8G6_9ACTN/80-186     AC A0A1Q5M8G6.1
#=GS A0A0X3XU29_9ACTN/49-144     AC A0A0X3XU29.1
#=GS A0A1T2WZL2_9BACL/558-668    AC A0A1T2WZL2.1
#=GS A0A3L7AFY3_9MICO/258-353    AC A0A3L7AFY3.1
#=GS A0A329RLV4_9STRA/63-160     AC A0A329RLV4.1
#=GS U7UE06_9FIRM/68-160         AC U7UE06.1
#=GS A0A373BIL8_9FIRM/66-156     AC A0A373BIL8.1
#=GS A0A3E2H9S2_SCYLI/52-141     AC A0A3E2H9S2.1
#=GS A0A1I2HTV2_9BACT/233-328    AC A0A1I2HTV2.1
#=GS A0A0X3V4Y3_9ACTN/91-196     AC A0A0X3V4Y3.1
#=GS A0A1J7GXE3_LUPAN/146-249    AC A0A1J7GXE3.1
#=GS A0A0A0LRK5_CUCSA/60-151     AC A0A0A0LRK5.1
#=GS A0A1B9EMH5_9ACTN/1003-1096  AC A0A1B9EMH5.1
#=GS A0A2R6RFN8_ACTCH/142-245    AC A0A2R6RFN8.1
#=GS A0A2U1KPC3_ARTAN/190-298    AC A0A2U1KPC3.1
#=GS W9RXZ3_9ROSA/15-96          AC W9RXZ3.1
#=GS PPA2_ARATH/145-247          AC Q9LMG7.1
#=GS A0A1F1KYH8_9CORY/38-127     AC A0A1F1KYH8.1
#=GS A0A445G577_GLYSO/92-183     AC A0A445G577.1
#=GS A0A2C9W8D2_MANES/95-182     AC A0A2C9W8D2.1
#=GS A0A0D3VD52_9BACL/752-849    AC A0A0D3VD52.1
#=GS A0A3S3M4B1_9MAGN/144-247    AC A0A3S3M4B1.1
#=GS A0A1N6LU29_9BURK/55-151     AC A0A1N6LU29.1
#=GS A0A287RAU8_HORVV/1-105      AC A0A287RAU8.1
#=GS R6I8M7_9FIRM/700-815        AC R6I8M7.1
#=GS A0A445G564_GLYSO/57-148     AC A0A445G564.1
#=GS A0A0D2VCQ9_GOSRA/141-245    AC A0A0D2VCQ9.1
#=GS A0A133V6R0_9EURY/42-167     AC A0A133V6R0.1
#=GS A0A176TDZ5_9FLAO/24-110     AC A0A176TDZ5.1
#=GS A0A0E0RKH3_ORYRU/444-538    AC A0A0E0RKH3.1
#=GS A0A0D9Z9N8_9ORYZ/68-155     AC A0A0D9Z9N8.1
#=GS A0A3B6LHH5_WHEAT/174-282    AC A0A3B6LHH5.1
#=GS A0A2P6RBQ7_ROSCH/50-137     AC A0A2P6RBQ7.1
#=GS A0A267G173_9PLAT/62-157     AC A0A267G173.1
#=GS A0A1G9VNB7_9ACTN/73-166     AC A0A1G9VNB7.1
#=GS A0A3N4RN00_9ACTN/44-137     AC A0A3N4RN00.1
#=GS A0A162JD06_9PEZI/27-118     AC A0A162JD06.1
#=GS B4F8V0_MAIZE/83-201         AC B4F8V0.1
#=GS A0A3L6QAX0_PANMI/331-439    AC A0A3L6QAX0.1
#=GS A0A1Y4D8B4_9BACT/214-327    AC A0A1Y4D8B4.1
#=GS B8ANS7_ORYSI/63-176         AC B8ANS7.1
#=GS A0A061FK56_THECC/60-151     AC A0A061FK56.1
#=GS A0A2I0HJ07_PUNGR/1-95       AC A0A2I0HJ07.1
#=GS M1BDJ4_SOLTU/15-127         AC M1BDJ4.1
#=GS A0A2A3EMU6_APICC/27-118     AC A0A2A3EMU6.1
#=GS A0A453QNY5_AEGTS/99-212     AC A0A453QNY5.1
#=GS A0A2P8YTV8_BLAGE/390-488    AC A0A2P8YTV8.1
#=GS M5TC38_9PLAN/36-128         AC M5TC38.1
#=GS A0A287QMK2_HORVV/64-155     AC A0A287QMK2.1
#=GS G0RUS8_HYPJQ/23-113         AC G0RUS8.1
#=GS R0GHY0_9BRAS/54-166         AC R0GHY0.1
#=GS A0A2P5A888_PARAD/72-183     AC A0A2P5A888.1
#=GS M4D9B2_BRARP/17-108         AC M4D9B2.1
#=GS H2MQS4_ORYLA/47-140         AC H2MQS4.2
#=GS A0A3D8YAW4_9BACT/229-325    AC A0A3D8YAW4.1
#=GS A0A1H3ZUN1_9BACT/29-116     AC A0A1H3ZUN1.1
#=GS A0A0U5JEZ4_9BACT/27-116     AC A0A0U5JEZ4.1
#=GS A0A1M7IFL3_9FIRM/64-194     AC A0A1M7IFL3.1
#=GS A0A2R6PZP7_ACTCH/58-149     AC A0A2R6PZP7.1
#=GS A0A2C9VWI2_MANES/55-146     AC A0A2C9VWI2.1
#=GS A0A0C2ALL4_9ACTN/62-155     AC A0A0C2ALL4.1
#=GS A0A3B6C5M9_WHEAT/142-247    AC A0A3B6C5M9.1
#=GS A0A2G5TFN2_9PELO/21-107     AC A0A2G5TFN2.1
#=GS A0A0D2P070_GOSRA/184-292    AC A0A0D2P070.1
#=GS A0A1V0DH10_9BACT/32-121     AC A0A1V0DH10.1
#=GS A0A287V077_HORVV/59-150     AC A0A287V077.1
#=GS A0A0N4TSS9_BRUPA/46-134     AC A0A0N4TSS9.1
#=GS E8NAG2_MICTS/48-143         AC E8NAG2.1
#=GS A0A1U8QCY2_NELNU/73-185     AC A0A1U8QCY2.1
#=GS A0A089ICS5_9BACL/753-850    AC A0A089ICS5.1
#=GS A0A3A4KH86_9NOCA/56-153     AC A0A3A4KH86.1
#=GS A0A078H7E5_BRANA/145-248    AC A0A078H7E5.1
#=GS A0A259UA35_9FIRM/38-134     AC A0A259UA35.1
#=GS A0A371DZM1_MUCPR/63-175     AC A0A371DZM1.1
#=GS A0A2D0ND83_9BACT/11-100     AC A0A2D0ND83.1
#=GS M1D1Z7_SOLTU/56-147         AC M1D1Z7.1
#=GS A0A024TEA4_9STRA/129-242    AC A0A024TEA4.1
#=GS A0A2H2I5Z2_CAEJA/24-108     AC A0A2H2I5Z2.1
#=GS A0A1S2Z715_CICAR/54-141     AC A0A1S2Z715.1
#=GS A0A2K6T426_SAIBB/32-125     AC A0A2K6T426.1
#=GS A0A3B6DLH9_WHEAT/147-238    AC A0A3B6DLH9.1
#=GS A0A0D2ZV86_BRAOL/60-151     AC A0A0D2ZV86.1
#=GS B4JMN6_DROGR/2-89           AC B4JMN6.1
#=GS A0A3M8HFU4_9BACI/47-143     AC A0A3M8HFU4.1
#=GS A0A252F5Q2_9CLOT/39-125     AC A0A252F5Q2.1
#=GS A0A1Z5S4E0_SORBI/8-89       AC A0A1Z5S4E0.1
#=GS A0A0P0VUV1_ORYSJ/41-149     AC A0A0P0VUV1.1
#=GS A0A1V9Z4I3_9STRA/20-120     AC A0A1V9Z4I3.1
#=GS J3NFB3_ORYBR/53-144         AC J3NFB3.1
#=GS A0A1S4CAQ1_TOBAC/171-279    AC A0A1S4CAQ1.1
#=GS A0A1E3Q8J2_LIPST/32-123     AC A0A1E3Q8J2.1
#=GS K1RZH9_CRAGI/3-74           AC K1RZH9.1
#=GS A0A0B5DD86_9ACTN/48-143     AC A0A0B5DD86.1
#=GS A0A1R3HSG1_COCAP/62-153     AC A0A1R3HSG1.1
#=GS D8TBR4_SELML/77-168         AC D8TBR4.1
#=GS A0A1S2Z8P5_CICAR/1-75       AC A0A1S2Z8P5.1
#=GS A0A287IF17_HORVV/51-139     AC A0A287IF17.1
#=GS A0A1J7FP93_LUPAN/1-79       AC A0A1J7FP93.1
#=GS A0A1M5C1I4_9THEO/39-135     AC A0A1M5C1I4.1
#=GS A0A1G8F112_9MICO/227-320    AC A0A1G8F112.1
#=GS K0C6Y0_ALCDB/1124-1217      AC K0C6Y0.1
#=GS A0A0M2VT08_9BACL/1076-1175  AC A0A0M2VT08.1
#=GS K7H7C8_CAEJA/22-105         AC K7H7C8.1
#=GS W5N439_LEPOC/28-121         AC W5N439.1
#=GS A0A1S4B581_TOBAC/168-276    AC A0A1S4B581.1
#=GS A0A3S5CBM4_9MICO/54-150     AC A0A3S5CBM4.1
#=GS A0A1G9XN14_9BACT/37-133     AC A0A1G9XN14.1
#=GS A0A2H2YWF1_9HYPO/65-169     AC A0A2H2YWF1.1
#=GS A0A2G5SHQ0_9PELO/46-139     AC A0A2G5SHQ0.1
#=GS A0A316AIE7_9BACT/50-127     AC A0A316AIE7.1
#=GS A0A1Y1XJ06_9FUNG/141-232    AC A0A1Y1XJ06.1
#=GS A0A401HZ12_9BACL/83-191     AC A0A401HZ12.1
#=GS A0A0J1CTG6_9BURK/54-151     AC A0A0J1CTG6.1
#=GS A0A1P8B627_ARATH/65-176     AC A0A1P8B627.1
#=GS D3BN02_POLPP/144-247        AC D3BN02.1
#=GS A0A453JUX1_AEGTS/65-162     AC A0A453JUX1.1
#=GS A0A0D9WUQ9_9ORYZ/146-252    AC A0A0D9WUQ9.1
#=GS G0T435_SOYBN/60-151         AC G0T435.1
#=GS S2Y8N8_9BACL/986-1091       AC S2Y8N8.1
#=GS A0A1V1SR45_9FUNG/34-122     AC A0A1V1SR45.1
#=GS A0A384BXK0_URSMA/28-121     AC A0A384BXK0.1
#=GS M1AWF5_SOLTU/165-273        AC M1AWF5.1
#=GS A0A1V1P8Q6_9DELT/25-115     AC A0A1V1P8Q6.1
#=GS A0A0B7N9E8_9FUNG/59-156     AC A0A0B7N9E8.1
#=GS A0A2H2ZK42_9HYPO/34-120     AC A0A2H2ZK42.1
#=GS A0A239P796_9ACTN/52-142     AC A0A239P796.1
#=GS A0A0E0P3W6_ORYRU/63-176     AC A0A0E0P3W6.1
#=GS T0HMP1_9SPHN/40-140         AC T0HMP1.1
#=GS R5T6U2_9FIRM/41-133         AC R5T6U2.1
#=GS A0A498IBW8_MALDO/146-249    AC A0A498IBW8.1
#=GS A0A0E0BUF2_9ORYZ/173-281    AC A0A0E0BUF2.1
#=GS B9SXP6_RICCO/60-151         AC B9SXP6.1
#=GS A0A3L6PWS6_PANMI/168-276    AC A0A3L6PWS6.1
#=GS R6MVT1_9BACE/45-136         AC R6MVT1.1
#=GS A0A2J6RTX5_9HELO/70-174     AC A0A2J6RTX5.1
#=GS A0A2J6RUT7_9HELO/34-121     AC A0A2J6RUT7.1
#=GS A0A0E0R4B3_ORYRU/171-260    AC A0A0E0R4B3.1
#=GS A0A072VQW8_MEDTR/56-148     AC A0A072VQW8.1
#=GS A0A167VXE9_9HYPO/28-117     AC A0A167VXE9.1
#=GS A0A1V1P0P9_9DELT/10-101     AC A0A1V1P0P9.1
#=GS A0A094ERD0_9PEZI/39-130     AC A0A094ERD0.1
#=GS A0A3G2G429_9FLAO/20-109     AC A0A3G2G429.1
#=GS A0A1V6PG88_PENDC/34-121     AC A0A1V6PG88.1
#=GS A0A0P0W5I6_ORYSJ/7-89       AC A0A0P0W5I6.1
#=GS A0A2P8WG89_9CYAN/48-166     AC A0A2P8WG89.1
#=GS F1A0C3_DICPU/214-317        AC F1A0C3.1
#=GS A0A2P5DVJ6_PARAD/176-285    AC A0A2P5DVJ6.1
#=GS A0A1S4D8A7_TOBAC/53-144     AC A0A1S4D8A7.1
#=GS A0A1M6T476_9CLOT/40-135     AC A0A1M6T476.1
#=GS U7UC34_9FIRM/57-147         AC U7UC34.1
#=GS I7A076_MELRP/24-120         AC I7A076.1
#=GS A0A2G3C2S0_CAPCH/55-142     AC A0A2G3C2S0.1
#=GS A0A2J6LBF2_LACSA/48-142     AC A0A2J6LBF2.1
#=GS A0A0A2KMS1_PENIT/33-120     AC A0A0A2KMS1.1
#=GS A0A443SMH4_9ACAR/25-116     AC A0A443SMH4.1
#=GS M5VW03_PRUPE/54-141         AC M5VW03.1
#=GS D8SVS9_SELML/141-244        AC D8SVS9.1
#=GS A0A368FAR0_ANCCA/21-107     AC A0A368FAR0.1
#=GS A0A1S3UUW4_VIGRR/149-252    AC A0A1S3UUW4.1
#=GS G7IXK7_MEDTR/43-130         AC G7IXK7.1
#=GS A0A3D9F119_9FLAO/49-150     AC A0A3D9F119.1
#=GS V4STL8_9ROSI/169-277        AC V4STL8.1
#=GS A0A364KQ76_9EURO/33-120     AC A0A364KQ76.1
#=GS A0A3N4H4W1_9BACT/40-145     AC A0A3N4H4W1.1
#=GS A0A346Y436_9ACTN/29-113     AC A0A346Y436.1
#=GS A0A2G3DAD3_CAPCH/170-278    AC A0A2G3DAD3.1
#=GS W5W597_9PSEU/58-163         AC W5W597.1
#=GS A0A2G5DGE5_AQUCA/58-149     AC A0A2G5DGE5.1
#=GS V7D3J7_PHAVU/82-194         AC V7D3J7.1
#=GS A2ZN55_ORYSI/66-157         AC A2ZN55.1
#=GS A0A0E0BVP9_9ORYZ/66-157     AC A0A0E0BVP9.1
#=GS A0A068V3M6_COFCA/51-138     AC A0A068V3M6.1
#=GS A0A0N0TDC2_9ACTN/76-181     AC A0A0N0TDC2.1
#=GS A0A1S3PAF0_SALSA/76-170     AC A0A1S3PAF0.1
#=GS A0A0D2WPG4_CAPO3/70-162     AC A0A0D2WPG4.1
#=GS A0A0N0U4G2_9HYME/25-116     AC A0A0N0U4G2.1
#=GS A0A1U7VV50_NICSY/215-317    AC A0A1U7VV50.1
#=GS A0A1B8CGV9_9PEZI/32-118     AC A0A1B8CGV9.1
#=GS A0A4D9C7V4_SALSN/1-75       AC A0A4D9C7V4.1
#=GS A0A1L7D6M0_9CORY/28-116     AC A0A1L7D6M0.1
#=GS A0A383VNJ7_TETOB/72-189     AC A0A383VNJ7.1
#=GS A0A0Q7J5F3_9BACL/1078-1178  AC A0A0Q7J5F3.1
#=GS A0A2H5QLU2_CITUN/86-198     AC A0A2H5QLU2.1
#=GS C5WST2_SORBI/175-283        AC C5WST2.1
#=GS A0A1Y5K2V1_9BACL/606-712    AC A0A1Y5K2V1.1
#=GS A0A1S3UTE0_VIGRR/176-284    AC A0A1S3UTE0.1
#=GS A0A1W7D4R6_9ACTN/1005-1095  AC A0A1W7D4R6.1
#=GS A0A0F7IFW4_9EURY/621-708    AC A0A0F7IFW4.1
#=GS A0A0L8H6Z1_OCTBM/1-85       AC A0A0L8H6Z1.1
#=GS A0A251T4G7_HELAN/148-251    AC A0A251T4G7.1
#=GS A0A453FQI2_AEGTS/9-54       AC A0A453FQI2.1
#=GS I1MU36_SOYBN/92-183         AC I1MU36.1
#=GS A0A2P6RBR2_ROSCH/49-136     AC A0A2P6RBR2.1
#=GS A0A498RG60_9FIRM/35-130     AC A0A498RG60.1
#=GS A5N8V9_CLOK5/51-136         AC A5N8V9.1
#=GS A0A453JWA8_AEGTS/177-285    AC A0A453JWA8.1
#=GS A0A078I9H0_BRANA/59-150     AC A0A078I9H0.1
#=GS A0A0U1QM85_9BACL/39-139     AC A0A0U1QM85.1
#=GS A0A0E0LDX1_ORYPU/54-145     AC A0A0E0LDX1.1
#=GS H3H2W2_PHYRM/71-168         AC H3H2W2.1
#=GS C7YXA6_NECH7/71-174         AC C7YXA6.1
#=GS A0A1E3QEL0_LIPST/23-112     AC A0A1E3QEL0.1
#=GS A0A251U205_HELAN/173-281    AC A0A251U205.1
#=GS A0A427Y3X6_9TREE/87-171     AC A0A427Y3X6.1
#=GS A0A251VS10_HELAN/45-131     AC A0A251VS10.1
#=GS A0A251SG79_HELAN/41-128     AC A0A251SG79.1
#=GS A0A255QTF0_9PLAN/42-138     AC A0A255QTF0.1
#=GS A0A0L7QV16_9HYME/25-116     AC A0A0L7QV16.1
#=GS Q01ZC1_SOLUE/47-144         AC Q01ZC1.1
#=GS A0A068UVC6_COFCA/175-283    AC A0A068UVC6.1
#=GS A0A4D8YHN5_SALSN/52-143     AC A0A4D8YHN5.1
#=GS A0A078HF42_BRANA/144-247    AC A0A078HF42.1
#=GS I0Z217_COCSC/152-255        AC I0Z217.1
#=GS A0A1Q3BW52_CEPFO/63-154     AC A0A1Q3BW52.1
#=GS A0A0J1BK20_9SPHI/32-130     AC A0A0J1BK20.1
#=GS A0A1N6K5X1_9BACT/53-148     AC A0A1N6K5X1.1
#=GS F2U8E5_SALR5/37-136         AC F2U8E5.1
#=GS A0A291QGQ8_9ACTN/88-193     AC A0A291QGQ8.1
#=GS I3IMC5_9BACT/31-117         AC I3IMC5.1
#=GS A0A151SMJ7_CAJCA/72-184     AC A0A151SMJ7.1
#=GS A0A1R3FW44_COCAP/164-266    AC A0A1R3FW44.1
#=GS A0A2M9BV18_9MICO/249-342    AC A0A2M9BV18.1
#=GS A0A445FBF5_GLYSO/72-183     AC A0A445FBF5.1
#=GS F8AZC8_FRADG/9-103          AC F8AZC8.1
#=GS A0A3B4ARR7_9GOBI/28-121     AC A0A3B4ARR7.1
#=GS W1PSR3_AMBTC/46-133         AC W1PSR3.1
#=GS S4RT80_PETMA/32-125         AC S4RT80.1
#=GS A0A0K9PLM9_ZOSMR/78-190     AC A0A0K9PLM9.1
#=GS A0A0R0BLR2_9GAMM/47-142     AC A0A0R0BLR2.1
#=GS A0A2P6R2M8_ROSCH/147-250    AC A0A2P6R2M8.1
#=GS PPA9_ARATH/143-246          AC Q9ZQ81.1
#=GS A0A398AEE2_BRACM/139-242    AC A0A398AEE2.1
#=GS A0A445EX23_ARAHY/44-132     AC A0A445EX23.1
#=GS A0A090LLM7_STRRB/1-84       AC A0A090LLM7.1
#=GS K3Y7K6_SETIT/112-199        AC K3Y7K6.1
#=GS A0A3L6SXU6_PANMI/62-153     AC A0A3L6SXU6.1
#=GS A0A0S3S1J2_PHAAN/77-189     AC A0A0S3S1J2.1
#=GS V4LMR6_EUTSA/65-168         AC V4LMR6.1
#=GS F0SQ14_RUBBR/59-173         AC F0SQ14.1
#=GS A0A1S3EER3_CICAR/175-283    AC A0A1S3EER3.1
#=GS A0A1S3C5Q8_CUCME/68-181     AC A0A1S3C5Q8.1
#=GS M0WKF6_HORVV/63-176         AC M0WKF6.1
#=GS D8S4S9_SELML/1-94           AC D8S4S9.1
#=GS A0A0L0D9T5_THETB/138-241    AC A0A0L0D9T5.1
#=GS E3LJQ2_CAERE/43-136         AC E3LJQ2.1
#=GS D0MQE1_PHYIT/65-159         AC D0MQE1.1
#=GS A0A232FM11_9HYME/39-130     AC A0A232FM11.1
#=GS A0A1I7UER1_9PELO/1-66       AC A0A1I7UER1.1
#=GS A0A090SHU6_9VIBR/310-404    AC A0A090SHU6.1
#=GS A0A2T7DFK0_9POAL/211-314    AC A0A2T7DFK0.1
#=GS A0A261GN04_9GAMM/31-116     AC A0A261GN04.1
#=GS A0A1M7QLA9_9BACT/41-142     AC A0A1M7QLA9.1
#=GS M8ARZ8_TRIUA/143-248        AC M8ARZ8.1
#=GS A0A2P5F422_TREOI/72-183     AC A0A2P5F422.1
#=GS A0A1V3P3S4_9GAMM/62-155     AC A0A1V3P3S4.1
#=GS A0A068SCY1_9FUNG/62-166     AC A0A068SCY1.1
#=GS E3NT34_CAERE/20-115         AC E3NT34.1
#=GS A0A3N8M469_9BURK/54-150     AC A0A3N8M469.1
#=GS A0A2K9PUT9_9FLAO/26-110     AC A0A2K9PUT9.1
#=GS A0A2K6KCS6_RHIBE/32-125     AC A0A2K6KCS6.1
#=GS K6YU34_9ALTE/43-156         AC K6YU34.1
#=GS A0A0D2S6J5_GOSRA/80-183     AC A0A0D2S6J5.1
#=GS W9RG64_9ROSA/50-137         AC W9RG64.1
#=GS A0A1U9NQS3_9BACT/45-141     AC A0A1U9NQS3.1
#=GS A0A372JTE3_9ACTN/40-132     AC A0A372JTE3.1
#=GS A0A1L9U557_ASPBC/70-173     AC A0A1L9U557.1
#=GS A0A327X816_9BACT/35-131     AC A0A327X816.1
#=GS A0A0A2TMD8_9FIRM/46-138     AC A0A0A2TMD8.1
#=GS A0A453L829_AEGTS/1-97       AC A0A453L829.1
#=GS W9RRF3_9ROSA/1-76           AC W9RRF3.1
#=GS A0A287QKH4_HORVV/1-95       AC A0A287QKH4.1
#=GS A0A453NAM0_AEGTS/76-168     AC A0A453NAM0.1
#=GS A0A317WAD6_9EURO/33-120     AC A0A317WAD6.1
#=GS A0A369QF08_9BACT/49-131     AC A0A369QF08.1
#=GS A0A1B0G7U2_GLOMM/1-90       AC A0A1B0G7U2.1
#=GS A0A3Q0EQ03_VIGRR/176-284    AC A0A3Q0EQ03.1
#=GS A0A0D3H2H4_9ORYZ/244-355    AC A0A0D3H2H4.1
#=GS A0A2P6NAI8_9MYCE/161-261    AC A0A2P6NAI8.1
#=GS A0A059AEB4_EUCGR/219-322    AC A0A059AEB4.1
#=GS V4TFD7_9ROSI/142-245        AC V4TFD7.1
#=GS A0A1U8KPQ7_GOSHI/216-319    AC A0A1U8KPQ7.1
#=GS A0A2P5RKK5_GOSBA/71-183     AC A0A2P5RKK5.1
#=GS A0A078FNU1_BRANA/173-280    AC A0A078FNU1.1
#=GS D2VCD2_NAEGR/31-130         AC D2VCD2.1
#=GS A0A059DFL1_EUCGR/1-75       AC A0A059DFL1.1
#=GS A0A0E0FUH4_ORYNI/206-307    AC A0A0E0FUH4.1
#=GS A0A1Y6EQZ5_9GAMM/46-142     AC A0A1Y6EQZ5.1
#=GS A0A433Y918_9BACL/9-102      AC A0A433Y918.1
#=GS W0F1M2_9BACT/49-132         AC W0F1M2.1
#=GS A0A2N0FUX0_9FLAO/53-159     AC A0A2N0FUX0.1
#=GS R0G4V5_9BRAS/57-148         AC R0G4V5.1
#=GS A0A3B6B0E6_WHEAT/65-152     AC A0A3B6B0E6.1
#=GS A0A0E0MQ19_ORYPU/564-656    AC A0A0E0MQ19.1
#=GS Q764C1_PHAVU/60-151         AC Q764C1.1
#=GS A0A3P9Q5X9_POERE/28-121     AC A0A3P9Q5X9.1
#=GS A0A1J7GAR9_LUPAN/69-181     AC A0A1J7GAR9.1
#=GS A0A1S3E7I9_CICAR/184-292    AC A0A1S3E7I9.1
#=GS D8UDV5_VOLCA/84-198         AC D8UDV5.1
#=GS A0A1R3HMH1_9ROSI/1-75       AC A0A1R3HMH1.1
#=GS A0A1I8JCV1_9PLAT/60-157     AC A0A1I8JCV1.1
#=GS A0A2U9PA29_STRAS/45-138     AC A0A2U9PA29.1
#=GS A0A2U9T8A4_9GAMM/55-150     AC A0A2U9T8A4.1
#=GS A0A3B6PJW3_WHEAT/89-181     AC A0A3B6PJW3.1
#=GS A0A373LJV7_9FIRM/1060-1166  AC A0A373LJV7.1
#=GS A0A067RT69_ZOONE/23-114     AC A0A067RT69.1
#=GS A0A0E0GI84_ORYNI/82-173     AC A0A0E0GI84.1
#=GS A0A239K9H5_9MICO/236-331    AC A0A239K9H5.1
#=GS B6IEC7_CAEBR/20-104         AC B6IEC7.1
#=GS R6EIX1_9FIRM/1-85           AC R6EIX1.1
#=GS A0A151T035_CAJCA/50-161     AC A0A151T035.1
#=GS A0A1J6I913_NICAT/55-143     AC A0A1J6I913.1
#=GS G3MA93_9CAUD/467-557        AC G3MA93.1
#=GS M4B968_HYAAE/134-239        AC M4B968.1
#=GS A0A1H8EG84_9ACTN/76-182     AC A0A1H8EG84.1
#=GS A0A1H4HDJ3_9SPHI/39-119     AC A0A1H4HDJ3.1
#=GS A0A0K9NP95_ZOSMR/73-186     AC A0A0K9NP95.1
#=GS A0A1X2H566_SYNRA/53-150     AC A0A1X2H566.1
#=GS W4XDN4_STRPU/115-208        AC W4XDN4.1
#=GS A0A151UAS9_CAJCA/1-90       AC A0A151UAS9.1
#=GS A0A2J6L7I8_LACSA/193-301    AC A0A2J6L7I8.1
#=GS A0A2N7D2Q2_9VIBR/1125-1215  AC A0A2N7D2Q2.1
#=GS A0A2P6R2J1_ROSCH/168-276    AC A0A2P6R2J1.1
#=GS U2Q764_9CLOT/55-142         AC U2Q764.1
#=GS A0A061G610_THECC/170-278    AC A0A061G610.1
#=GS A0A1U8PUX0_GOSHI/103-194    AC A0A1U8PUX0.1
#=GS A0A199VKK4_ANACO/52-139     AC A0A199VKK4.1
#=GS R0G5E0_9BRAS/48-135         AC R0G5E0.1
#=GS A0A2I0WJ16_9ASPA/194-302    AC A0A2I0WJ16.1
#=GS M0S360_MUSAM/55-146         AC M0S360.1
#=GS A0A0Q0VFN3_9SPHI/38-136     AC A0A0Q0VFN3.1
#=GS A0A1M6J7D1_9CLOT/985-1091   AC A0A1M6J7D1.1
#=GS A0A0V2F806_CAUVI/46-142     AC A0A0V2F806.1
#=GS A0A067G3U1_CITSI/176-284    AC A0A067G3U1.1
#=GS A0A0K9RS91_SPIOL/1-75       AC A0A0K9RS91.1
#=GS A0A396QFD8_9FIRM/235-341    AC A0A396QFD8.1
#=GS A0A0K9PZS7_ZOSMR/54-146     AC A0A0K9PZS7.1
#=GS R4KH61_9FIRM/48-140         AC R4KH61.1
#=GS A0A062V475_9EURY/842-928    AC A0A062V475.1
#=GS A0A1S3TRX6_VIGRR/71-183     AC A0A1S3TRX6.1
#=GS A0A1H7Q279_9FLAO/21-112     AC A0A1H7Q279.1
#=GS A0A2P7PJU8_9ACTN/95-200     AC A0A2P7PJU8.1
#=GS A0A3N2P3T4_9ACTN/569-734    AC A0A3N2P3T4.1
#=GS A0A452ZW07_AEGTS/244-357    AC A0A452ZW07.1
#=GS A0A346B5Z4_9BURK/55-151     AC A0A346B5Z4.1
#=GS A0A1U8NH35_GOSHI/130-181    AC A0A1U8NH35.1
#=GS L1KYG0_9ACTN/87-192         AC L1KYG0.1
#=GS A0A0B3VMH1_9FIRM/45-131     AC A0A0B3VMH1.1
#=GS A0A314ZFE7_PRUYE/222-324    AC A0A314ZFE7.1
#=GS A0A1G7TSQ3_9BACL/40-142     AC A0A1G7TSQ3.1
#=GS A0A0D2T8X0_GOSRA/108-219    AC A0A0D2T8X0.1
#=GS A0A4D9C1I4_SALSN/68-179     AC A0A4D9C1I4.1
#=GS A0A103XM69_CYNCS/52-143     AC A0A103XM69.1
#=GS G3GRF5_CRIGR/827-923        AC G3GRF5.1
#=GS A0A287JGM2_HORVV/9-99       AC A0A287JGM2.2
#=GS A0A1K1MFJ2_SELRU/48-136     AC A0A1K1MFJ2.1
#=GS A0A0W8C7E9_PHYNI/189-294    AC A0A0W8C7E9.1
#=GS A0A2U1PY37_ARTAN/61-153     AC A0A2U1PY37.1
#=GS A0A445JMU0_GLYSO/79-166     AC A0A445JMU0.1
#=GS M7Z6I1_TRIUA/141-254        AC M7Z6I1.1
#=GS A0A3M8EPK5_9BACT/275-374    AC A0A3M8EPK5.1
#=GS A0A1T4TND5_9BACT/48-139     AC A0A1T4TND5.1
#=GS A0A1H6XYE9_9FIRM/52-149     AC A0A1H6XYE9.1
#=GS A0A0A0LL67_CUCSA/68-181     AC A0A0A0LL67.1
#=GS D8QZ61_SELML/197-298        AC D8QZ61.1
#=GS A0A2G3AD35_CAPAN/170-278    AC A0A2G3AD35.1
#=GS W6RWG7_9CLOT/63-151         AC W6RWG7.1
#=GS A0A369B790_9BACL/724-835    AC A0A369B790.1
#=GS A0A397Y836_BRACM/77-188     AC A0A397Y836.1
#=GS A0A0D3EKQ3_9ORYZ/57-148     AC A0A0D3EKQ3.1
#=GS R0FNL8_9BRAS/48-135         AC R0FNL8.1
#=GS A0A1I0MMI6_9BACT/32-112     AC A0A1I0MMI6.1
#=GS A0A1U8KTQ1_GOSHI/171-279    AC A0A1U8KTQ1.1
#=GS A0A261BPB2_9PELO/25-111     AC A0A261BPB2.1
#=GS A0A2G3BIG2_CAPCH/47-135     AC A0A2G3BIG2.1
#=GS A0A165Y458_DAUCS/63-154     AC A0A165Y458.1
#=GS A0A1D6EDB5_MAIZE/168-276    AC A0A1D6EDB5.1
#=GS A0A1L9PR02_ASPVE/69-172     AC A0A1L9PR02.1
#=GS A0A0S3SNZ1_PHAAN/1-76       AC A0A0S3SNZ1.1
#=GS A0A2U1PY91_ARTAN/56-148     AC A0A2U1PY91.1
#=GS S3D410_OPHP1/34-119         AC S3D410.1
#=GS A0A2K5Q8X1_CEBCA/32-125     AC A0A2K5Q8X1.1
#=GS A0A287EIA1_HORVV/1-81       AC A0A287EIA1.1
#=GS A0A4D8YUT5_SALSN/53-144     AC A0A4D8YUT5.1
#=GS B8BMN4_ORYSI/164-272        AC B8BMN4.1
#=GS A0A1U7YA30_NICSY/53-141     AC A0A1U7YA30.1
#=GS A0A3S0PE41_9FLAO/28-113     AC A0A3S0PE41.1
#=GS A0A398A495_BRACM/57-148     AC A0A398A495.1
#=GS A0A2U1LUM9_ARTAN/136-244    AC A0A2U1LUM9.1
#=GS A0A3P8RP17_AMPPE/28-121     AC A0A3P8RP17.1
#=GS A0A1B6PKN0_SORBI/90-178     AC A0A1B6PKN0.1
#=GS A0A251QU79_PRUPE/69-180     AC A0A251QU79.1
#=GS A0A1S2YKX8_CICAR/203-305    AC A0A1S2YKX8.1
#=GS A0A396KLG5_9FIRM/241-335    AC A0A396KLG5.1
#=GS A0A059DFE8_EUCGR/1-85       AC A0A059DFE8.1
#=GS A0A2P5RU90_GOSBA/177-285    AC A0A2P5RU90.1
#=GS G1RWS4_NOMLE/32-125         AC G1RWS4.2
#=GS A0A0L0NG60_9HYPO/23-113     AC A0A0L0NG60.1
#=GS A0A317UMY3_ASPEC/33-122     AC A0A317UMY3.1
#=GS N1S268_FUSC4/76-176         AC N1S268.1
#=GS A0A2I0BCK9_9ASPA/65-157     AC A0A2I0BCK9.1
#=GS A0A2T7BEP8_9BACT/50-145     AC A0A2T7BEP8.1
#=GS A0A453D6Z5_AEGTS/145-236    AC A0A453D6Z5.1
#=GS W2MCV2_PHYPR/201-306        AC W2MCV2.1
#=GS M5VU99_PRUPE/66-156         AC M5VU99.1
#=GS A0A163MP35_ABSGL/52-156     AC A0A163MP35.1
#=GS A0A2P5R1U2_GOSBA/55-142     AC A0A2P5R1U2.1
#=GS D0NUN3_PHYIT/111-208        AC D0NUN3.1
#=GS A0A1S1MS63_9GAMM/23-111     AC A0A1S1MS63.1
#=GS A0A1S1Q6U0_9ACTN/33-131     AC A0A1S1Q6U0.1
#=GS A0A2U1BC88_9FIRM/45-129     AC A0A2U1BC88.1
#=GS A0A0D9XP48_9ORYZ/219-308    AC A0A0D9XP48.1
#=GS A0A0E0H0E8_ORYNI/52-141     AC A0A0E0H0E8.1
#=GS A0A453ELQ0_AEGTS/62-175     AC A0A453ELQ0.1
#=GS A0A373ZRM3_9BACT/30-116     AC A0A373ZRM3.1
#=GS A0A0S3SEQ3_PHAAN/54-145     AC A0A0S3SEQ3.1
#=GS V4AHM2_LOTGI/25-117         AC V4AHM2.1
#=GS A0A1V2EQR3_9SPHN/45-141     AC A0A1V2EQR3.1
#=GS L0G1G5_ECHVK/29-116         AC L0G1G5.1
#=GS X8FM88_MYCUL/63-157         AC X8FM88.1
#=GS A0A2P5SQ31_GOSBA/50-161     AC A0A2P5SQ31.1
#=GS A0A2A4GCA2_9FLAO/31-132     AC A0A2A4GCA2.1
#=GS U7PSI1_SPOS1/25-116         AC U7PSI1.1
#=GS A0A0S3T2L3_PHAAN/169-277    AC A0A0S3T2L3.1
#=GS B3MQN7_DROAN/40-144         AC B3MQN7.1
#=GS A0A2B4S6W9_STYPI/178-280    AC A0A2B4S6W9.1
#=GS Q9VZ58_DROME/38-132         AC Q9VZ58.1
#=GS A0A2S0WDB4_9CORY/53-142     AC A0A2S0WDB4.1
#=GS A0A1R1EFD7_9BACL/1075-1174  AC A0A1R1EFD7.1
#=GS A0A3M6VV49_9STRA/54-169     AC A0A3M6VV49.1
#=GS A0A445FIU4_GLYSO/7-94       AC A0A445FIU4.1
#=GS A0A2N6PH16_9MICO/238-330    AC A0A2N6PH16.1
#=GS D7U5K3_VITVI/63-154         AC D7U5K3.1
#=GS A0A2V3JDJ4_9EURY/272-357    AC A0A2V3JDJ4.1
#=GS W9SND1_9ROSA/52-148         AC W9SND1.1
#=GS A0A2J6KZ57_LACSA/58-149     AC A0A2J6KZ57.1
#=GS A0A3B0K4Z9_DROGU/4-92       AC A0A3B0K4Z9.1
#=GS A0A1S4ATS7_TOBAC/68-180     AC A0A1S4ATS7.1
#=GS I0RXD7_MYCXE/66-159         AC I0RXD7.1
#=GS A0A453RMK8_AEGTS/174-284    AC A0A453RMK8.1
#=GS D8RHK7_SELML/1-96           AC D8RHK7.1
#=GS A0A059A6Z4_EUCGR/185-293    AC A0A059A6Z4.1
#=GS A0A316ART0_9BACT/257-353    AC A0A316ART0.1
#=GS A0A0D9Y1T8_9ORYZ/777-873    AC A0A0D9Y1T8.1
#=GS A0A314Y0P7_PRUYE/66-156     AC A0A314Y0P7.1
#=GS A0A2V0PEF0_9CHLO/57-165     AC A0A2V0PEF0.1
#=GS R5XZJ1_9CLOT/60-148         AC R5XZJ1.1
#=GS A0A182VZ21_9DIPT/4713-4804  AC A0A182VZ21.1
#=GS Q24GM0_TETTS/267-369        AC Q24GM0.1
#=GS U6Q3A1_9CLOT/987-1097       AC U6Q3A1.1
#=GS A0A1S2XHG5_CICAR/72-183     AC A0A1S2XHG5.2
#=GS Q4WE06_ASPFU/69-173         AC Q4WE06.1
#=GS V9NC52_MANES/54-145         AC V9NC52.1
#=GS A0A2W2EYR2_9ACTN/57-159     AC A0A2W2EYR2.1
#=GS A0A0D6TIB4_9FLAO/20-110     AC A0A0D6TIB4.1
#=GS A0A246AEI2_9SPHI/33-131     AC A0A246AEI2.1
#=GS A0A484B0K2_DRONA/45-139     AC A0A484B0K2.1
#=GS A0A0Q4H5Z5_9MICO/247-338    AC A0A0Q4H5Z5.1
#=GS A0A093VSJ5_TALMA/29-116     AC A0A093VSJ5.1
#=GS A0A2B4S9P4_STYPI/26-169     AC A0A2B4S9P4.1
#=GS A0A3P8RRR4_AMPPE/28-121     AC A0A3P8RRR4.1
#=GS E6U7F2_ETHHY/48-185         AC E6U7F2.1
#=GS A0A1Y1XJX9_9FUNG/124-216    AC A0A1Y1XJX9.1
#=GS A0A251QQV9_PRUPE/68-181     AC A0A251QQV9.1
#=GS A0A0N0A428_9NOCA/41-155     AC A0A0N0A428.1
#=GS A0A3L6PJ91_PANMI/60-147     AC A0A3L6PJ91.1
#=GS A9S5K7_PHYPA/49-138         AC A9S5K7.1
#=GS A0A3N0EJE5_9FLAO/48-156     AC A0A3N0EJE5.1
#=GS A0A167G2Z7_9BACL/35-133     AC A0A167G2Z7.1
#=GS A0A287KQI2_HORVV/123-236    AC A0A287KQI2.1
#=GS A0A287RAF6_HORVV/1-105      AC A0A287RAF6.1
#=GS A0A0T6LTE4_9ACTN/82-187     AC A0A0T6LTE4.1
#=GS A0A2V0P8P5_9CHLO/37-144     AC A0A2V0P8P5.1
#=GS A0A2J6L697_LACSA/55-166     AC A0A2J6L697.1
#=GS A0A1L7CTG3_9CORY/74-230     AC A0A1L7CTG3.1
#=GS A0A453KAM0_AEGTS/132-220    AC A0A453KAM0.1
#=GS A0A1D1VHC8_RAMVA/46-138     AC A0A1D1VHC8.1
#=GS H0WY64_OTOGA/32-125         AC H0WY64.1
#=GS A0A1U8KAZ7_GOSHI/65-176     AC A0A1U8KAZ7.1
#=GS A0A371JQ27_9FLAO/54-164     AC A0A371JQ27.1
#=GS R0HJI3_9BRAS/44-135         AC R0HJI3.1
#=GS A0A0D9P6P3_METAN/69-171     AC A0A0D9P6P3.1
#=GS R0I7R9_9BRAS/54-151         AC R0I7R9.1
#=GS Q2QLL6_ORYSJ/66-131         AC Q2QLL6.1
#=GS A0A345PK20_9BACI/237-333    AC A0A345PK20.1
#=GS A0A1H0DV83_9ACTN/33-121     AC A0A1H0DV83.1
#=GS A0A428P855_9HYPO/71-174     AC A0A428P855.1
#=GS R6E1I5_9BACE/25-132         AC R6E1I5.1
#=GS A0A1Y4S3B3_9FIRM/117-205    AC A0A1Y4S3B3.1
#=GS A0A2G5ETD4_AQUCA/52-139     AC A0A2G5ETD4.1
#=GS A9PF43_POPTR/77-192         AC A9PF43.1
#=GS A0A0S2TEK9_9GAMM/575-676    AC A0A0S2TEK9.1
#=GS D3F6U4_CONWI/47-163         AC D3F6U4.1
#=GS A0A0D1WYJ2_9EURO/69-172     AC A0A0D1WYJ2.1
#=GS A0A094GZQ4_9PEZI/37-130     AC A0A094GZQ4.1
#=GS A0A2H1ZED5_ARATH/15-109     AC A0A2H1ZED5.1
#=GS A2WW15_ORYSI/85-186         AC A2WW15.1
#=GS A0A089IRM8_9BACL/316-426    AC A0A089IRM8.1
#=GS A0A2G5DFN7_AQUCA/58-131     AC A0A2G5DFN7.1
#=GS A0A074XFE4_AURPU/71-174     AC A0A074XFE4.1
#=GS A0A0P1AWD5_PLAHL/1-83       AC A0A0P1AWD5.1
#=GS M7YZ57_TRIUA/181-284        AC M7YZ57.1
#=GS A0A445FIL6_GLYSO/99-186     AC A0A445FIL6.1
#=GS A0A453M725_AEGTS/58-149     AC A0A453M725.1
#=GS A0A2I4F354_JUGRE/182-290    AC A0A2I4F354.1
#=GS A0A329S8J8_9STRA/198-304    AC A0A329S8J8.1
#=GS A0A2N0IZJ1_9ACTN/78-183     AC A0A2N0IZJ1.1
#=GS A0A1U8M2A3_GOSHI/223-331    AC A0A1U8M2A3.1
#=GS A0A4D8ZFE6_SALSN/134-241    AC A0A4D8ZFE6.1
#=GS A0A3L6R149_PANMI/66-157     AC A0A3L6R149.1
#=GS F7BZU8_XENTR/25-113         AC F7BZU8.1
#=GS A9URA5_MONBE/27-126         AC A9URA5.1
#=GS A0A2P8HUY6_9BACT/53-151     AC A0A2P8HUY6.1
#=GS A0A2K0VXD2_GIBNY/69-173     AC A0A2K0VXD2.1
#=GS A0A4D9DNH1_9SAUR/27-120     AC A0A4D9DNH1.1
#=GS A0A0L0N0Z7_9HYPO/39-128     AC A0A0L0N0Z7.1
#=GS A0A383WMA2_TETOB/3-50       AC A0A383WMA2.1
#=GS A0A1R1I9B0_9ACTN/1463-1554  AC A0A1R1I9B0.1
#=GS A0A1I6V4T6_9SPHI/34-130     AC A0A1I6V4T6.1
#=GS W6QHE1_PENRF/33-122         AC W6QHE1.1
#=GS A0A423VIG1_9PEZI/67-170     AC A0A423VIG1.1
#=GS G8TEK4_NIAKG/34-115         AC G8TEK4.1
#=GS A0A395T920_9HYPO/27-115     AC A0A395T920.1
#=GS A0A3N0EJM9_9FLAO/24-114     AC A0A3N0EJM9.1
#=GS A0A3G9J2R7_9BACL/610-708    AC A0A3G9J2R7.1
#=GS A0A1Q3BRV7_CEPFO/69-181     AC A0A1Q3BRV7.1
#=GS G9YFZ7_9FIRM/29-124         AC G9YFZ7.1
#=GS H3NKV8_9LACT/94-260         AC H3NKV8.1
#=GS B9S512_RICCO/79-191         AC B9S512.1
#=GS A0A3Q0RVD6_AMPCI/31-124     AC A0A3Q0RVD6.1
#=GS A0A0P8Y4N1_DROAN/2-52       AC A0A0P8Y4N1.1
#=GS A0A1Y2B847_9TREE/55-158     AC A0A1Y2B847.1
#=GS V7AD87_PHAVU/217-319        AC V7AD87.1
#=GS A0A0D3H8N5_9ORYZ/178-289    AC A0A0D3H8N5.1
#=GS A0A3L6T0W1_PANMI/168-276    AC A0A3L6T0W1.1
#=GS M2XHJ6_GALSU/118-231        AC M2XHJ6.1
#=GS A0A0K9QJ04_SPIOL/176-284    AC A0A0K9QJ04.1
#=GS A0A2P5AUK7_PARAD/1-81       AC A0A2P5AUK7.1
#=GS B8BN70_ORYSI/57-151         AC B8BN70.1
#=GS A0A1Z5R9T8_SORBI/84-201     AC A0A1Z5R9T8.1
#=GS A0A103XZT5_CYNCS/48-135     AC A0A103XZT5.1
#=GS A0A2I4E2M5_JUGRE/1-75       AC A0A2I4E2M5.1
#=GS A0A2U1QMQ3_ARTAN/54-145     AC A0A2U1QMQ3.1
#=GS A0A0C1VKH4_9ACTN/81-187     AC A0A0C1VKH4.1
#=GS A0A0S3SEU4_PHAAN/54-146     AC A0A0S3SEU4.1
#=GS A0A0P0XZH6_ORYSJ/100-189    AC A0A0P0XZH6.1
#=GS J1L4T2_9EURY/29-106         AC J1L4T2.1
#=GS A0A059DG26_EUCGR/56-143     AC A0A059DG26.1
#=GS A0A1R4HU30_9MICO/242-333    AC A0A1R4HU30.1
#=GS A0A152A5S8_9MYCE/29-129     AC A0A152A5S8.1
#=GS D8RMJ0_SELML/62-153         AC D8RMJ0.1
#=GS A0A0E0FEP3_9ORYZ/505-599    AC A0A0E0FEP3.1
#=GS U4U327_DENPD/26-117         AC U4U327.1
#=GS A0A2T8HFU9_9SPHI/30-127     AC A0A2T8HFU9.1
#=GS A0A2K3K618_TRIPR/144-231    AC A0A2K3K618.1
#=GS A0A151TLN0_CAJCA/54-145     AC A0A151TLN0.1
#=GS A0A0D3HIB4_9ORYZ/171-260    AC A0A0D3HIB4.1
#=GS A0A1Y2E8F6_9FUNG/96-191     AC A0A1Y2E8F6.1
#=GS A0A452ZW14_AEGTS/178-291    AC A0A452ZW14.1
#=GS A0A367FL65_9ACTN/97-199     AC A0A367FL65.1
#=GS A0A2I4G9V8_JUGRE/90-202     AC A0A2I4G9V8.1
#=GS A0A3B6KMK4_WHEAT/63-176     AC A0A3B6KMK4.1
#=GS A0A2D1U599_9SPHI/54-152     AC A0A2D1U599.1
#=GS A0A2K1X3N5_POPTR/70-182     AC A0A2K1X3N5.1
#=GS A0A067GDK8_CITSI/59-150     AC A0A067GDK8.1
#=GS A0A2G2XNL2_CAPBA/61-151     AC A0A2G2XNL2.1
#=GS A0A368GG60_ANCCA/81-166     AC A0A368GG60.1
#=GS A0A0A2VQD4_BEABA/34-123     AC A0A0A2VQD4.1
#=GS A0A3E0GZR4_9PSEU/39-132     AC A0A3E0GZR4.1
#=GS A0A453JWS5_AEGTS/226-334    AC A0A453JWS5.1
#=GS A0A2A4JZY1_HELVI/2-56       AC A0A2A4JZY1.1
#=GS A0A1T4T9Q5_9BACT/204-287    AC A0A1T4T9Q5.1
#=GS A0A1S3AU94_CUCME/219-315    AC A0A1S3AU94.1
#=GS I1PI45_ORYGL/166-274        AC I1PI45.1
#=GS L8GNJ7_ACACA/1-75           AC L8GNJ7.1
#=GS A0A445J4V5_GLYSO/54-145     AC A0A445J4V5.1
#=GS A0A378JKQ8_9GAMM/26-118     AC A0A378JKQ8.1
#=GS A0A3L6SH72_PANMI/61-174     AC A0A3L6SH72.1
#=GS A0A445E1V5_ARAHY/61-152     AC A0A445E1V5.1
#=GS A0A200PRH3_9MAGN/171-279    AC A0A200PRH3.1
#=GS A0A2N0JMA7_9ACTN/57-150     AC A0A2N0JMA7.1
#=GS S5V3P4_STRC3/74-191         AC S5V3P4.1
#=GS A0A078FT75_BRANA/145-248    AC A0A078FT75.1
#=GS A0A0D3H8N6_9ORYZ/157-265    AC A0A0D3H8N6.1
#=GS A0A195D578_9HYME/25-116     AC A0A195D578.1
#=GS A0A179F951_METCM/38-126     AC A0A179F951.1
#=GS A0A3M7SPY2_BRAPC/26-125     AC A0A3M7SPY2.1
#=GS A0A074L068_9BACT/44-144     AC A0A074L068.1
#=GS A0A1I2K7I6_9BACT/56-146     AC A0A1I2K7I6.1
#=GS A0A1B3W6J1_9GAMM/249-343    AC A0A1B3W6J1.1
#=GS A0A1X7CYT0_CELCE/231-325    AC A0A1X7CYT0.1
#=GS F5RGY2_METUF/29-115         AC F5RGY2.1
#=GS A0A4P1RTP0_LUPAN/172-280    AC A0A4P1RTP0.1
#=GS A0A419W5E6_9BACT/45-146     AC A0A419W5E6.1
#=GS A0A2G9GJG9_9LAMI/43-130     AC A0A2G9GJG9.1
#=GS A0A0F8U0E9_9EURO/33-123     AC A0A0F8U0E9.1
#=GS A0A061EAS8_THECC/171-279    AC A0A061EAS8.1
#=GS Q2TY95_ASPOR/68-171         AC Q2TY95.1
#=GS A0A023BX03_9FLAO/21-112     AC A0A023BX03.1
#=GS G0LAW7_ZOBGA/29-113         AC G0LAW7.1
#=GS M0YS06_HORVV/47-135         AC M0YS06.1
#=GS A0A194WWR0_9HELO/34-123     AC A0A194WWR0.1
#=GS A0A2G2WCI9_CAPBA/223-331    AC A0A2G2WCI9.1
#=GS W7YV21_9BACL/102-198        AC W7YV21.1
#=GS A0A2S7U347_9BACT/407-493    AC A0A2S7U347.1
#=GS M0T9R0_MUSAM/43-130         AC M0T9R0.1
#=GS A0A0D9XWY6_9ORYZ/51-140     AC A0A0D9XWY6.1
#=GS B8AAW1_ORYSI/206-309        AC B8AAW1.1
#=GS A0A4P1RH40_LUPAN/45-131     AC A0A4P1RH40.1
#=GS M4ELF6_BRARP/71-183         AC M4ELF6.1
#=GS A0A317XJD6_9BASI/36-122     AC A0A317XJD6.1
#=GS A0A2P5AUG4_PARAD/61-153     AC A0A2P5AUG4.1
#=GS B4JMN4_DROGR/15-112         AC B4JMN4.1
#=GS A0A432C4Z9_9FLAO/20-111     AC A0A432C4Z9.1
#=GS A0A453L817_AEGTS/40-148     AC A0A453L817.1
#=GS A0A1I0YEE7_9BACT/44-145     AC A0A1I0YEE7.1
#=GS A0A016V969_9BILA/12-97      AC A0A016V969.1
#=GS Q8A3Z4_BACTN/261-356        AC Q8A3Z4.1
#=GS A0A1M6QDD3_9BACT/163-255    AC A0A1M6QDD3.1
#=GS D8SLM4_SELML/62-153         AC D8SLM4.1
#=GS A0A182I049_ANOAR/32-123     AC A0A182I049.1
#=GS A0A251VCX7_HELAN/189-297    AC A0A251VCX7.1
#=GS A0A0K1PZR4_9DELT/1144-1237  AC A0A0K1PZR4.1
#=GS A0A1T4ZZY4_9SPHI/36-133     AC A0A1T4ZZY4.1
#=GS A0A3N7FDT9_POPTR/199-307    AC A0A3N7FDT9.1
#=GS A0A443PZD1_9MAGN/68-179     AC A0A443PZD1.1
#=GS A0A2A9DQ65_9CORY/41-130     AC A0A2A9DQ65.1
#=GS B8MJR7_TALSN/36-123         AC B8MJR7.1
#=GS A0A395RSF8_FUSSP/34-123     AC A0A395RSF8.1
#=GS A0A443SR00_9ACAR/8-107      AC A0A443SR00.1
#=GS A0A2U1PQ83_ARTAN/379-465    AC A0A2U1PQ83.1
#=GS A0A1U8K172_GOSHI/69-181     AC A0A1U8K172.1
#=GS A0A394DLN9_LUPAN/57-148     AC A0A394DLN9.1
#=GS D7LUA9_ARALL/44-133         AC D7LUA9.1
#=GS A0A1V1NWU6_9DELT/99-192     AC A0A1V1NWU6.1
#=GS G4YIT8_PHYSP/197-303        AC G4YIT8.1
#=GS A0A1G6KLJ2_9BACT/40-131     AC A0A1G6KLJ2.1
#=GS A0A2P6QKY7_ROSCH/67-157     AC A0A2P6QKY7.1
#=GS C7PUL7_CHIPD/51-147         AC C7PUL7.1
#=GS A0A2S7TAY9_9FLAO/43-146     AC A0A2S7TAY9.1
#=GS B0N267_9FIRM/52-147         AC B0N267.1
#=GS A0A2K3D398_CHLRE/45-172     AC A0A2K3D398.1
#=GS A0A059A641_EUCGR/185-293    AC A0A059A641.1
#=GS A0A0H5E374_9BACT/26-113     AC A0A0H5E374.1
#=GS A0A0D2TSP5_GOSRA/4-94       AC A0A0D2TSP5.1
#=GS V4S1N1_9ROSI/86-198         AC V4S1N1.1
#=GS A0A1C2BX29_9PORP/266-361    AC A0A1C2BX29.1
#=GS A0A0A1T6V4_9HYPO/73-174     AC A0A0A1T6V4.1
#=GS A0A1S1R2D5_9ACTN/9-115      AC A0A1S1R2D5.1
#=GS R0FVU9_9BRAS/54-145         AC R0FVU9.1
#=GS Q82JN5_STRAW/105-210        AC Q82JN5.1
#=GS A0A3Q7X090_CICAR/47-134     AC A0A3Q7X090.1
#=GS A0A2P6RIN6_ROSCH/62-153     AC A0A2P6RIN6.1
#=GS A0A078BQP7_CAEEL/1-64       AC A0A078BQP7.1
#=GS A0A0L9U563_PHAAN/71-183     AC A0A0L9U563.1
#=GS A0A2G2X717_CAPBA/168-276    AC A0A2G2X717.1
#=GS A0A267DV18_9PLAT/62-159     AC A0A267DV18.1
#=GS A0A1K1QYN4_9BACL/596-702    AC A0A1K1QYN4.1
#=GS A0A0E0I9N0_ORYNI/78-204     AC A0A0E0I9N0.1
#=GS G7K8G7_MEDTR/49-138         AC G7K8G7.1
#=GS A0A3S9V6Y6_9BACL/349-457    AC A0A3S9V6Y6.1
#=GS A0A0K3CLD0_RHOTO/86-189     AC A0A0K3CLD0.1
#=GS A0A152A8H9_9MYCE/178-298    AC A0A152A8H9.1
#=GS K9QTU8_NOSS7/35-156         AC K9QTU8.1
#=GS A0A2I0B3S3_9ASPA/62-153     AC A0A2I0B3S3.1
#=GS W9ST17_9ROSA/71-183         AC W9ST17.1
#=GS A0A200QGC2_9MAGN/248-356    AC A0A200QGC2.1
#=GS A0A3R7KJU6_9STRA/198-303    AC A0A3R7KJU6.1
#=GS A0A182IVA3_9DIPT/39-130     AC A0A182IVA3.1
#=GS A0A1Y1XK63_9FUNG/107-197    AC A0A1Y1XK63.1
#=GS A0A250WZD4_9CHLO/159-247    AC A0A250WZD4.1
#=GS A0A4P1R8C6_LUPAN/54-141     AC A0A4P1R8C6.1
#=GS A0A419XWB6_9ACTN/697-782    AC A0A419XWB6.1
#=GS R5AJK2_9BACT/506-609        AC R5AJK2.1
#=GS A0A2K3L465_TRIPR/1-120      AC A0A2K3L465.1
#=GS A0A1U7XKY2_NICSY/52-143     AC A0A1U7XKY2.1
#=GS A0A495D666_9ALTE/28-111     AC A0A495D666.1
#=GS A0A0P9ETN2_RHOGW/1-80       AC A0A0P9ETN2.1
#=GS A0A1V9ZDL8_9STRA/74-173     AC A0A1V9ZDL8.1
#=GS A0A0E0RKH4_ORYRU/59-150     AC A0A0E0RKH4.1
#=GS A0A1I3SGE8_9BACL/38-126     AC A0A1I3SGE8.1
#=GS A0A2K1X3N3_POPTR/69-181     AC A0A2K1X3N3.1
#=GS A0A150MDV3_9BACI/41-137     AC A0A150MDV3.1
#=GS A0A395GIU5_9EURO/33-122     AC A0A395GIU5.1
#=GS A0A3M8EE81_9BACT/52-148     AC A0A3M8EE81.1
#=GS A0A287KQI0_HORVV/150-263    AC A0A287KQI0.1
#=GS V4M3T9_EUTSA/61-152         AC V4M3T9.1
#=GS A0A2K3PQT8_TRIPR/8-92       AC A0A2K3PQT8.1
#=GS A0A287JGF1_HORVV/33-123     AC A0A287JGF1.2
#=GS A0A0K9QN59_SPIOL/64-155     AC A0A0K9QN59.1
#=GS A0A3Q7YC85_CICAR/47-134     AC A0A3Q7YC85.1
#=GS G7XII2_ASPKW/70-173         AC G7XII2.1
#=GS A0A0M2XZA0_9SPHI/30-126     AC A0A0M2XZA0.1
#=GS A0A0L0DMA7_THETB/28-118     AC A0A0L0DMA7.1
#=GS A0A173MDS3_9BACT/33-115     AC A0A173MDS3.1
#=GS A0A4P1RR89_LUPAN/1-75       AC A0A4P1RR89.1
#=GS A0A1Q3BDJ1_CEPFO/50-137     AC A0A1Q3BDJ1.1
#=GS A0A059CL76_EUCGR/55-146     AC A0A059CL76.1
#=GS A0A2K6T454_SAIBB/32-125     AC A0A2K6T454.1
#=GS A0A0D2VHQ3_GOSRA/56-147     AC A0A0D2VHQ3.1
#=GS A0A2P6R2I6_ROSCH/186-293    AC A0A2P6R2I6.1
#=GS M0XWB1_HORVV/108-197        AC M0XWB1.1
#=GS A0A0A8EP27_9ACTN/64-169     AC A0A0A8EP27.1
#=GS A0A2P6P4X7_ROSCH/178-286    AC A0A2P6P4X7.1
#=GS F4EW18_SELS3/47-137         AC F4EW18.1
#=GS D7L636_ARALL/64-176         AC D7L636.1
#=GS A0A0D3HRH2_9ORYZ/52-145     AC A0A0D3HRH2.1
#=GS A0A194UVD0_9PEZI/34-120     AC A0A194UVD0.1
#=GS A0A1B8GQ75_9PEZI/37-130     AC A0A1B8GQ75.1
#=GS M5RHP0_9PLAN/2-98           AC M5RHP0.1
#=GS A0A2C9UCW4_MANES/69-180     AC A0A2C9UCW4.1
#=GS PPA6_ARATH/50-147           AC Q9C510.1
#=GS G2Q6P4_MYCTT/72-174         AC G2Q6P4.1
#=GS T1JVC5_TETUR/23-113         AC T1JVC5.1
#=GS A0A1G9KEI0_9ACTN/45-139     AC A0A1G9KEI0.1
#=GS A0A2A2JJC3_9BILA/21-109     AC A0A2A2JJC3.1
#=GS A0A453FND8_AEGTS/28-119     AC A0A453FND8.1
#=GS D3BNI1_POLPP/11-108         AC D3BNI1.1
#=GS A0A1S3Z6F2_TOBAC/60-151     AC A0A1S3Z6F2.1
#=GS A0A0E0RKH2_ORYRU/464-558    AC A0A0E0RKH2.1
#=GS V4U3U7_9ROSI/76-188         AC V4U3U7.1
#=GS A0A0K0FUZ8_STRVS/14-102     AC A0A0K0FUZ8.1
#=GS A0A410PZZ6_9FIRM/40-159     AC A0A410PZZ6.1
#=GS A0A329MMV2_9BACL/599-705    AC A0A329MMV2.1
#=GS A0A1J6I940_NICAT/46-134     AC A0A1J6I940.1
#=GS A0A2T2Y9E3_9BACT/46-142     AC A0A2T2Y9E3.1
#=GS A0A0D2UCQ1_GOSRA/60-151     AC A0A0D2UCQ1.1
#=GS F2UKX4_SALR5/99-190         AC F2UKX4.1
#=GS A0A3B4TL55_SERDU/28-121     AC A0A3B4TL55.1
#=GS A0A0A0LR86_CUCSA/177-285    AC A0A0A0LR86.1
#=GS H3HAI8_PHYRM/71-168         AC H3HAI8.4
#=GS A0A453DCN9_AEGTS/142-247    AC A0A453DCN9.1
#=GS A0A0E0IM36_ORYNI/131-242    AC A0A0E0IM36.1
#=GS A0A453J3Z1_AEGTS/10-102     AC A0A453J3Z1.1
#=GS A0A0D9Y1T9_9ORYZ/65-137     AC A0A0D9Y1T9.1
#=GS A0A0D2SAD0_GOSRA/73-185     AC A0A0D2SAD0.1
#=GS A0A453JV64_AEGTS/83-185     AC A0A453JV64.1
#=GS A0A078IWD1_BRANA/53-147     AC A0A078IWD1.1
#=GS A0A0E0N3Q1_ORYRU/206-309    AC A0A0E0N3Q1.1
#=GS R7UN48_CAPTE/23-116         AC R7UN48.1
#=GS M0Y7U1_HORVV/85-177         AC M0Y7U1.1
#=GS U5CYW7_AMBTC/86-177         AC U5CYW7.1
#=GS A0A2P8DX18_9ACTN/718-808    AC A0A2P8DX18.1
#=GS A0A0C2ZBS2_9AGAM/1-79       AC A0A0C2ZBS2.1
#=GS A0A1Y1VL71_9FUNG/193-285    AC A0A1Y1VL71.1
#=GS A0A445E217_ARAHY/69-160     AC A0A445E217.1
#=GS A0A287QKL0_HORVV/1-95       AC A0A287QKL0.1
#=GS A0A210PGK0_MIZYE/40-131     AC A0A210PGK0.1
#=GS A0A1J7HSI1_LUPAN/176-284    AC A0A1J7HSI1.1
#=GS A0A1W2GYH0_9BACT/35-120     AC A0A1W2GYH0.1
#=GS A0A1U8JBC6_GOSHI/61-152     AC A0A1U8JBC6.1
#=GS A0A3S0Z5R1_ELYCH/52-143     AC A0A3S0Z5R1.1
#=GS A0A3Q2DA35_CYPVA/28-121     AC A0A3Q2DA35.1
#=GS A0A0G4J5I3_PLABS/166-257    AC A0A0G4J5I3.1
#=GS R6YVF7_9BACE/45-136         AC R6YVF7.1
#=GS F0XBL4_GROCL/70-173         AC F0XBL4.1
#=GS A0A2I0BC91_9ASPA/55-146     AC A0A2I0BC91.1
#=GS A0A044UEU8_ONCVO/46-137     AC A0A044UEU8.1
#=GS A0A252F653_9CLOT/45-129     AC A0A252F653.1
#=GS U5HIV4_USTV1/56-149         AC U5HIV4.1
#=GS A0A453K9W0_AEGTS/201-289    AC A0A453K9W0.1
#=GS A0A1I6XIQ5_9FLAO/2-85       AC A0A1I6XIQ5.1
#=GS W2L157_PHYPR/198-304        AC W2L157.1
#=GS A0A380NKK9_9FIRM/59-149     AC A0A380NKK9.1
#=GS A0A3G2L198_9FLAO/50-156     AC A0A3G2L198.1
#=GS A0A0C3HPX8_9PEZI/16-103     AC A0A0C3HPX8.1
#=GS R5IYI8_9CLOT/55-151         AC R5IYI8.1
#=GS A0A251RVA5_HELAN/193-303    AC A0A251RVA5.1
#=GS A0A3N4TW60_9ACTN/70-163     AC A0A3N4TW60.1
#=GS Q54BS2_DICDI/21-117         AC Q54BS2.1
#=GS A0A0E0FM04_ORYNI/56-143     AC A0A0E0FM04.1
#=GS A0A1I8I8A5_9PLAT/56-151     AC A0A1I8I8A5.1
#=GS A0A199VKU0_ANACO/1-75       AC A0A199VKU0.1
#=GS A0A225WK54_9STRA/19-117     AC A0A225WK54.1
#=GS A0A0E0JBF2_ORYNI/120-228    AC A0A0E0JBF2.1
#=GS A0A3R8T0H8_9GAMM/48-143     AC A0A3R8T0H8.1
#=GS A0A2S4M5V2_9BURK/57-163     AC A0A2S4M5V2.1
#=GS A0A1V4SQN1_CLOHU/33-127     AC A0A1V4SQN1.1
#=GS PPA21_ARATH/51-138          AC Q9LXI4.1
#=GS A0A2A2YLF0_9ACTN/79-184     AC A0A2A2YLF0.1
#=GS M0USG3_HORVV/55-146         AC M0USG3.1
#=GS A0A2H3T1P7_FUSOX/28-117     AC A0A2H3T1P7.1
#=GS A0A0E0B509_9ORYZ/186-294    AC A0A0E0B509.1
#=GS A0A068VEX0_COFCA/49-141     AC A0A068VEX0.1
#=GS B8M2M8_TALSN/32-119         AC B8M2M8.1
#=GS A0A495RB83_SPHMI/39-135     AC A0A495RB83.1
#=GS A0A199V612_ANACO/146-249    AC A0A199V612.1
#=GS A0A2J7QLV7_9NEOP/23-114     AC A0A2J7QLV7.1
#=GS W2T0P9_NECAM/1-72           AC W2T0P9.1
#=GS A0A1A3HXV9_9MYCO/66-161     AC A0A1A3HXV9.1
#=GS A0A0E0BVP5_9ORYZ/58-149     AC A0A0E0BVP5.1
#=GS A0A2H3ZPS7_PHODC/48-135     AC A0A2H3ZPS7.1
#=GS A0A1U9NIX9_9BACT/245-332    AC A0A1U9NIX9.1
#=GS A0A1H2KR98_9ACTN/58-159     AC A0A1H2KR98.1
#=GS A0A3A1UTF5_9BACL/1086-1185  AC A0A3A1UTF5.1
#=GS A0A2P6TJU2_CHLSO/592-715    AC A0A2P6TJU2.1
#=GS A0A078H7F7_BRANA/178-286    AC A0A078H7F7.1
#=GS A0A0D2SE28_GOSRA/97-209     AC A0A0D2SE28.1
#=GS A0A1S3Y8H0_TOBAC/70-182     AC A0A1S3Y8H0.1
#=GS M7ZW23_TRIUA/161-253        AC M7ZW23.1
#=GS A0A1G9LJG3_9FLAO/25-109     AC A0A1G9LJG3.1
#=GS A0A078IC94_BRANA/61-152     AC A0A078IC94.1
#=GS A0A0D2X5D2_CAPO3/144-244    AC A0A0D2X5D2.1
#=GS A0A368S5F5_SETIT/1-75       AC A0A368S5F5.1
#=GS A0A091DBW4_FUKDA/28-121     AC A0A091DBW4.1
#=GS A0A2T7EIC2_9POAL/168-276    AC A0A2T7EIC2.1
#=GS A0A074XWF3_AURPU/33-122     AC A0A074XWF3.1
#=GS A0A3S3PT29_9MAGN/144-247    AC A0A3S3PT29.1
#=GS A0A2G8KGC4_STIJA/112-203    AC A0A2G8KGC4.1
#=GS A0A069DLN1_9BACL/1078-1177  AC A0A069DLN1.1
#=GS A0A1D5UL73_WHEAT/142-247    AC A0A1D5UL73.1
#=GS A0A2G3CWX0_CAPCH/168-276    AC A0A2G3CWX0.1
#=GS A0A249T3I9_9BACT/202-284    AC A0A249T3I9.1
#=GS A0A0N0A900_9ACTN/70-175     AC A0A0N0A900.1
#=GS A0A1J6IAD2_NICAT/60-151     AC A0A1J6IAD2.1
#=GS A0A0E0E8Q4_9ORYZ/178-286    AC A0A0E0E8Q4.1
#=GS A0A0D9ZFS6_9ORYZ/63-176     AC A0A0D9ZFS6.1
#=GS R5GK44_9BACT/27-117         AC R5GK44.1
#=GS M0ZWN4_SOLTU/17-108         AC M0ZWN4.1
#=GS A0A1Q5AZ78_9ACTN/984-1090   AC A0A1Q5AZ78.1
#=GS A0A026WWS0_OOCBI/22-113     AC A0A026WWS0.1
#=GS A0A1U8NQX0_GOSHI/184-292    AC A0A1U8NQX0.1
#=GS A0A061E9V0_THECC/171-279    AC A0A061E9V0.1
#=GS A0A2K3PN58_TRIPR/75-187     AC A0A2K3PN58.1
#=GS A0A1L9T2W7_9EURO/69-172     AC A0A1L9T2W7.1
#=GS A0A453L851_AEGTS/170-278    AC A0A453L851.1
#=GS A0A370I3T5_9NOCA/68-162     AC A0A370I3T5.1
#=GS D2VI40_NAEGR/49-149         AC D2VI40.1
#=GS B6QIV6_TALMQ/35-122         AC B6QIV6.1
#=GS A0A1S4DLK3_TOBAC/53-141     AC A0A1S4DLK3.1
#=GS U3AS85_9CAUL/150-248        AC U3AS85.1
#=GS F2UJ11_SALR5/126-227        AC F2UJ11.1
#=GS A0A2U3C190_9ACTN/68-161     AC A0A2U3C190.1
#=GS A0A067LB35_JATCU/170-278    AC A0A067LB35.1
#=GS A0A482WQV7_LAOST/63-154     AC A0A482WQV7.1
#=GS A0A0K9QP40_SPIOL/342-433    AC A0A0K9QP40.1
#=GS A0A078IFS5_BRANA/60-151     AC A0A078IFS5.1
#=GS A0A1J0LNY9_9FLAO/22-114     AC A0A1J0LNY9.1
#=GS A0A2V4NT94_9ACTN/76-181     AC A0A2V4NT94.1
#=GS L8HCK0_ACACA/307-410        AC L8HCK0.1
#=GS M4FFP5_BRARP/54-148         AC M4FFP5.1
#=GS A0A0W8C5X2_PHYNI/243-349    AC A0A0W8C5X2.1
#=GS A0A3E2HK80_SCYLI/70-173     AC A0A3E2HK80.1
#=GS A0A0W8BX37_PHYNI/201-306    AC A0A0W8BX37.1
#=GS A0A437AYM4_CHISP/19-109     AC A0A437AYM4.1
#=GS A0A2I4F1Y6_JUGRE/182-290    AC A0A2I4F1Y6.1
#=GS A0A2P5CS29_PARAD/49-160     AC A0A2P5CS29.1
#=GS A0A3Q2ZF15_KRYMA/50-143     AC A0A3Q2ZF15.1
#=GS A0A0E0EJS6_9ORYZ/78-204     AC A0A0E0EJS6.1
#=GS A0A1D7QL33_9SPHI/50-132     AC A0A1D7QL33.1
#=GS A0A1U9NK76_9BACT/47-134     AC A0A1U9NK76.1
#=GS K3XWN3_SETIT/55-145         AC K3XWN3.1
#=GS B8N7N3_ASPFN/34-123         AC B8N7N3.1
#=GS A0A2H5P0J7_CITUN/61-152     AC A0A2H5P0J7.1
#=GS A0A0F0HUV3_9PSEU/52-145     AC A0A0F0HUV3.1
#=GS A0A151TVS7_CAJCA/1-76       AC A0A151TVS7.1
#=GS A0A0Q4Q9G0_9BACL/599-705    AC A0A0Q4Q9G0.1
#=GS R9P097_PSEHS/34-120         AC R9P097.1
#=GS A0A445BYI8_ARAHY/219-312    AC A0A445BYI8.1
#=GS A0A453LGE1_AEGTS/63-176     AC A0A453LGE1.1
#=GS A0A444PYK3_9MICO/404-499    AC A0A444PYK3.1
#=GS A0A453L813_AEGTS/166-274    AC A0A453L813.1
#=GS A0A1V9ZFN6_9STRA/183-277    AC A0A1V9ZFN6.1
#=GS A0A1Y1ZYT8_9PLEO/32-119     AC A0A1Y1ZYT8.1
#=GS A0A1M5N0S4_9GAMM/230-318    AC A0A1M5N0S4.1
#=GS A0A1J7HGW5_LUPAN/1-80       AC A0A1J7HGW5.1
#=GS A0A067Q9A0_9AGAM/40-127     AC A0A067Q9A0.1
#=GS A0A2J6LUM2_LACSA/41-128     AC A0A2J6LUM2.1
#=GS Q0J0L3_ORYSJ/186-294        AC Q0J0L3.1
#=GS A0A225X3X7_9STRA/62-159     AC A0A225X3X7.1
#=GS A0A024UTB7_9STRA/1-86       AC A0A024UTB7.1
#=GS A0A2V5HIE6_9EURO/70-173     AC A0A2V5HIE6.1
#=GS D7MGL9_ARALL/172-280        AC D7MGL9.1
#=GS V4U3L0_9ROSI/78-189         AC V4U3L0.1
#=GS R5BD39_9FIRM/60-156         AC R5BD39.1
#=GS A0A0P0NI43_9SPHI/33-131     AC A0A0P0NI43.1
#=GS A0A0K1JDW6_9MICO/67-160     AC A0A0K1JDW6.1
#=GS D7B7A3_NOCDD/36-123         AC D7B7A3.1
#=GS M0WRY8_HORVV/175-288        AC M0WRY8.1
#=GS A0A2H5N9J4_CITUN/216-318    AC A0A2H5N9J4.1
#=GS Q93XG4_SOYBN/72-184         AC Q93XG4.1
#=GS A0A1W0VZT5_SORBI/68-159     AC A0A1W0VZT5.1
#=GS D7LG89_ARALL/60-151         AC D7LG89.1
#=GS A0A453ELN2_AEGTS/18-131     AC A0A453ELN2.1
#=GS F0ZSZ8_DICPU/136-240        AC F0ZSZ8.1
#=GS A0A2B4SY70_STYPI/283-386    AC A0A2B4SY70.1
#=GS A0A1Y3N189_PIRSE/36-136     AC A0A1Y3N189.1
#=GS A0A3B4ZN89_9TELE/28-121     AC A0A3B4ZN89.1
#=GS A0A445EQT8_ARAHY/184-292    AC A0A445EQT8.1
#=GS U7DZC7_POPTR/63-154         AC U7DZC7.1
#=GS A0A316DZG3_9FLAO/239-336    AC A0A316DZG3.1
#=GS A0A2A2LQ63_9BILA/27-122     AC A0A2A2LQ63.1
#=GS D7LB83_ARALL/54-148         AC D7LB83.1
#=GS A0A059ADB7_EUCGR/219-322    AC A0A059ADB7.1
#=GS I2JMH5_9GAMM/74-173         AC I2JMH5.1
#=GS A0A1R3KMA0_COCAP/177-285    AC A0A1R3KMA0.1
#=GS A0A3B6ELY7_WHEAT/59-150     AC A0A3B6ELY7.1
#=GS A0A150XF56_9BACT/31-114     AC A0A150XF56.1
#=GS H3GR12_PHYRM/205-310        AC H3GR12.1
#=GS A0A1B1AT23_9ACTN/84-189     AC A0A1B1AT23.1
#=GS A0A1Y3NBF1_PIRSE/121-212    AC A0A1Y3NBF1.1
#=GS A0A2I2L2D0_9ACTN/8-107      AC A0A2I2L2D0.1
#=GS W0F538_9BACT/38-136         AC W0F538.1
#=GS A0A059LNF5_9CHLO/20-133     AC A0A059LNF5.1
#=GS A0A3B6MNX1_WHEAT/108-196    AC A0A3B6MNX1.1
#=GS A0A2P4ZIY2_9HYPO/22-112     AC A0A2P4ZIY2.1
#=GS A0A1R3JLR8_9ROSI/71-183     AC A0A1R3JLR8.1
#=GS A6DMR8_9BACT/23-105         AC A6DMR8.1
#=GS A0A2G5ETE3_AQUCA/52-139     AC A0A2G5ETE3.1
#=GS A0A2G2W1Z0_CAPBA/72-184     AC A0A2G2W1Z0.1
#=GS A0A445G575_GLYSO/92-183     AC A0A445G575.1
#=GS A0A0X8E2Z2_9MICO/240-331    AC A0A0X8E2Z2.1
#=GS A0A1X1Q8C1_9FIRM/42-128     AC A0A1X1Q8C1.1
#=GS A0A397XZY9_BRACM/60-147     AC A0A397XZY9.1
#=GS A0A0K9PXA7_ZOSMR/51-142     AC A0A0K9PXA7.1
#=GS A0A0D3H2H5_9ORYZ/177-288    AC A0A0D3H2H5.1
#=GS A0A2P5DXN7_TREOI/1-81       AC A0A2P5DXN7.1
#=GS A0A3Q7G1T7_SOLLC/64-176     AC A0A3Q7G1T7.1
#=GS T1MCA0_TRIUA/171-300        AC T1MCA0.1
#=GS A0A1M5ZDS3_9ACTN/73-178     AC A0A1M5ZDS3.1
#=GS A0A223S7J5_9ACTN/46-132     AC A0A223S7J5.1
#=GS A0A0B8NIN9_9VIBR/47-131     AC A0A0B8NIN9.1
#=GS W6NDK4_CLOTY/53-147         AC W6NDK4.1
#=GS A0A168AV23_9HYPO/34-124     AC A0A168AV23.1
#=GS D0MX64_PHYIT/201-306        AC D0MX64.1
#=GS M9MDW8_PSEA3/85-173         AC M9MDW8.1
#=GS W1SJF4_9BACI/490-593        AC W1SJF4.1
#=GS A0A2V5KKZ0_9BACL/42-136     AC A0A2V5KKZ0.1
#=GS F0XB68_GROCL/30-120         AC F0XB68.1
#=GS A0A1E5MIG5_9MICO/233-328    AC A0A1E5MIG5.1
#=GS G2PS40_MURRD/28-112         AC G2PS40.1
#=GS A0A1R3HZW6_9ROSI/3-55       AC A0A1R3HZW6.1
#=GS A0A1S3ZN56_TOBAC/53-141     AC A0A1S3ZN56.1
#=GS A0A2I4FKA4_JUGRE/11-94      AC A0A2I4FKA4.1
#=GS ACP7_MOUSE/32-125           AC Q8BX37.2
#=GS A0A2P5E2C0_PARAD/472-580    AC A0A2P5E2C0.1
#=GS A0A2K1II72_PHYPA/50-137     AC A0A2K1II72.1
#=GS F7G9N0_MONDO/38-131         AC F7G9N0.1
#=GS A0A2P5QY92_GOSBA/58-149     AC A0A2P5QY92.1
#=GS A0A2A4GB53_9FLAO/27-116     AC A0A2A4GB53.1
#=GS A0A329SAK4_9STRA/74-171     AC A0A329SAK4.1
#=GS A0A2U0ZNJ5_9BACT/25-121     AC A0A2U0ZNJ5.1
#=GS H1YE16_9SPHI/44-142         AC H1YE16.1
#=GS A0A445BYK0_ARAHY/219-312    AC A0A445BYK0.1
#=GS A0A177BWR5_9PLEO/34-120     AC A0A177BWR5.1
#=GS A0A0E0RJ39_ORYRU/120-228    AC A0A0E0RJ39.1
#=GS A0A0A0KIN1_CUCSA/54-141     AC A0A0A0KIN1.1
#=GS E8R2J3_ISOPI/43-141         AC E8R2J3.1
#=GS A0A3B6EJQ2_WHEAT/23-114     AC A0A3B6EJQ2.1
#=GS A0A1V2SA24_9BACI/1138-1237  AC A0A1V2SA24.1
#=GS A0A0K0FUM9_STRVS/28-125     AC A0A0K0FUM9.1
#=GS A0A287V091_HORVV/62-153     AC A0A287V091.1
#=GS A0A1S3TJ87_VIGRR/54-145     AC A0A1S3TJ87.1
#=GS A0A250X476_9CHLO/96-209     AC A0A250X476.1
#=GS R5UXL6_9BACT/264-353        AC R5UXL6.1
#=GS A0A022RCP7_ERYGU/58-149     AC A0A022RCP7.1
#=GS R6ACW7_9FIRM/43-135         AC R6ACW7.1
#=GS J5JRW6_BEAB2/34-123         AC J5JRW6.1
#=GS A2ZN54_ORYSI/59-150         AC A2ZN54.1
#=GS A0A164XGH0_DAUCS/168-276    AC A0A164XGH0.1
#=GS A0A2H5X7X3_9BACT/26-115     AC A0A2H5X7X3.1
#=GS A9V8T6_MONBE/154-256        AC A9V8T6.1
#=GS A0A2I0HK98_PUNGR/52-139     AC A0A2I0HK98.1
#=GS A0A067JR67_JATCU/70-182     AC A0A067JR67.1
#=GS A0A225WP57_9STRA/235-341    AC A0A225WP57.1
#=GS F0ZTM6_DICPU/12-139         AC F0ZTM6.1
#=GS D5SQD8_PLAL2/52-138         AC D5SQD8.1
#=GS A8WMV6_CAEBR/21-116         AC A8WMV6.1
#=GS A0A1D6LBV4_MAIZE/66-200     AC A0A1D6LBV4.1
#=GS A0A498SAT0_ACAVI/15-106     AC A0A498SAT0.1
#=GS A0A1D6G9W2_MAIZE/1-89       AC A0A1D6G9W2.1
#=GS A0A3B6LN99_WHEAT/178-287    AC A0A3B6LN99.1
#=GS A0A314YFK5_PRUYE/58-150     AC A0A314YFK5.1
#=GS V6J737_9BACL/42-140         AC V6J737.1
#=GS A0A1J4P3G2_9ACTN/78-183     AC A0A1J4P3G2.1
#=GS A0A1U8L9Q3_GOSHI/69-181     AC A0A1U8L9Q3.1
#=GS A0A3Q3C717_HAPBU/28-121     AC A0A3Q3C717.1
#=GS A0A1D6PZG1_MAIZE/83-201     AC A0A1D6PZG1.1
#=GS A0A0Q4GKQ9_9SPHI/24-118     AC A0A0Q4GKQ9.1
#=GS A0A2C9JIY7_BIOGL/30-122     AC A0A2C9JIY7.1
#=GS A0A1D6G9W1_MAIZE/232-335    AC A0A1D6G9W1.1
#=GS A0A287S1T7_HORVV/63-176     AC A0A287S1T7.1
#=GS A0A0G0A094_TRIHA/22-112     AC A0A0G0A094.1
#=GS A0A0D3HIB3_9ORYZ/148-237    AC A0A0D3HIB3.1
#=GS A0A068TYK0_COFCA/168-276    AC A0A068TYK0.1
#=GS A0A0L0C031_LUCCU/44-136     AC A0A0L0C031.1
#=GS A0A397Y8K8_BRACM/43-131     AC A0A397Y8K8.1
#=GS A0A1J7I2J6_LUPAN/56-147     AC A0A1J7I2J6.1
#=GS A0A164WJW9_DAUCS/1-76       AC A0A164WJW9.1
#=GS A0A0E0MQ19_ORYPU/79-170     AC A0A0E0MQ19.1
#=GS A0A0K9RL69_SPIOL/142-245    AC A0A0K9RL69.1
#=GS A0A2T0BP98_9CLOT/221-315    AC A0A2T0BP98.1
#=GS A0A1Y6BBR7_9PROT/24-122     AC A0A1Y6BBR7.1
#=GS A0A329N6B1_9FLAO/57-165     AC A0A329N6B1.1
#=GS A0A3Q7HX22_SOLLC/47-135     AC A0A3Q7HX22.1
#=GS A0A133VF62_9EURY/407-493    AC A0A133VF62.1
#=GS A0A1V9FL50_9BACT/198-286    AC A0A1V9FL50.1
#=GS A0A2G9HB15_9LAMI/69-181     AC A0A2G9HB15.1
#=GS A0A2P4UQ71_9ACTN/47-153     AC A0A2P4UQ71.1
#=GS A0A225VI26_9STRA/82-179     AC A0A225VI26.1
#=GS A0A100IUC2_ASPNG/33-122     AC A0A100IUC2.1
#=GS A0A0E0FTW4_ORYNI/57-148     AC A0A0E0FTW4.1
#=GS A0A2H3YTL9_PHODC/50-141     AC A0A2H3YTL9.1
#=GS C7PD12_CHIPD/35-116         AC C7PD12.1
#=GS A0A0D9Y0R6_9ORYZ/1573-1681  AC A0A0D9Y0R6.1
#=GS B7QNN1_IXOSC/1-79           AC B7QNN1.1
#=GS H3NJL6_9LACT/48-200         AC H3NJL6.1
#=GS A0A199U9T7_MANES/49-136     AC A0A199U9T7.1
#=GS A0A445F010_GLYSO/145-251    AC A0A445F010.1
#=GS A0A1S4CYB9_TOBAC/215-317    AC A0A1S4CYB9.1
#=GS A0A314YSL3_PRUYE/12-87      AC A0A314YSL3.1
#=GS A0A2Y9ASU5_9MICO/1037-1130  AC A0A2Y9ASU5.1
#=GS A0A0F8VEM4_9EURO/69-173     AC A0A0F8VEM4.1
#=GS V4AW18_LOTGI/3-98           AC V4AW18.1
#=GS A0A0C1DQ58_9FLAO/51-148     AC A0A0C1DQ58.1
#=GS A0A269W9K1_9BACL/723-831    AC A0A269W9K1.1
#=GS A0A1Q5CQS8_9ACTN/5-98       AC A0A1Q5CQS8.1
#=GS R0GZI6_9BRAS/175-283        AC R0GZI6.1
#=GS A0A453K9J2_AEGTS/1-75       AC A0A453K9J2.1
#=GS A0A164T362_DAUCS/170-278    AC A0A164T362.1
#=GS A0A2I4E2M8_JUGRE/56-143     AC A0A2I4E2M8.1
#=GS A0A3L6RBR1_PANMI/54-145     AC A0A3L6RBR1.1
#=GS A0A2P5DVK6_PARAD/116-224    AC A0A2P5DVK6.1
#=GS A0A1U7VCT9_NICSY/81-172     AC A0A1U7VCT9.1
#=GS A0A2Y9P5W4_DELLE/33-128     AC A0A2Y9P5W4.1
#=GS A0A2P5E5I3_PARAD/69-160     AC A0A2P5E5I3.1
#=GS A0A1Z5R4K7_SORBI/2-87       AC A0A1Z5R4K7.1
#=GS A0A445EMV2_ARAHY/77-168     AC A0A445EMV2.1
#=GS A0A1Y3N218_PIRSE/147-255    AC A0A1Y3N218.1
#=GS A0A287QKI2_HORVV/170-278    AC A0A287QKI2.1
#=GS K7DA91_PANTR/32-125         AC K7DA91.1
#=GS A0A445K3Z7_GLYSO/64-155     AC A0A445K3Z7.1
#=GS Q63X35_BURPS/53-149         AC Q63X35.1
#=GS A0A498JND4_MALDO/45-113     AC A0A498JND4.1
#=GS A0A1S4DVR0_CUCME/99-207     AC A0A1S4DVR0.1
#=GS R7VHQ9_CAPTE/23-116         AC R7VHQ9.1
#=GS A0A1V6ZAA3_PENNA/33-120     AC A0A1V6ZAA3.1
#=GS A0A0S6X146_9SPHN/37-137     AC A0A0S6X146.1
#=GS A0A068V6N8_COFCA/223-325    AC A0A068V6N8.1
#=GS A0A1I0MRR3_9BACT/9-99       AC A0A1I0MRR3.1
#=GS A0A3B6KDS8_WHEAT/167-275    AC A0A3B6KDS8.1
#=GS A0A2I0KHF3_PUNGR/53-140     AC A0A2I0KHF3.1
#=GS B4F9L6_MAIZE/67-158         AC B4F9L6.1
#=GS V4LZM4_EUTSA/74-186         AC V4LZM4.1
#=GS W2M063_PHYPR/62-159         AC W2M063.1
#=GS A0A2G5E499_AQUCA/188-294    AC A0A2G5E499.1
#=GS C6CZ00_PAESJ/476-588        AC C6CZ00.1
#=GS A0A0R0GPB1_SOYBN/53-144     AC A0A0R0GPB1.1
#=GS A0A239ARZ7_9FIRM/397-495    AC A0A239ARZ7.1
#=GS A0A1Q3AQ41_CEPFO/85-172     AC A0A1Q3AQ41.1
#=GS A0A287V0B0_HORVV/72-163     AC A0A287V0B0.1
#=GS A0A0D3GYD7_9ORYZ/62-163     AC A0A0D3GYD7.1
#=GS A0A286IKP5_9BACT/28-109     AC A0A286IKP5.1
#=GS A0A0D3HX62_9ORYZ/66-157     AC A0A0D3HX62.1
#=GS M1D3F2_SOLTU/70-182         AC M1D3F2.1
#=GS A0A061F141_THECC/127-214    AC A0A061F141.1
#=GS A0A139TKV9_9FIRM/66-154     AC A0A139TKV9.1
#=GS A0A1Y2X0B2_9PEZI/34-121     AC A0A1Y2X0B2.1
#=GS A0A1Y4IJ05_9FIRM/64-155     AC A0A1Y4IJ05.1
#=GS A0A0E0QGR0_ORYRU/77-203     AC A0A0E0QGR0.1
#=GS A0A1J6IJ54_NICAT/77-168     AC A0A1J6IJ54.1
#=GS A0A3N4V4J5_9ACTN/81-186     AC A0A3N4V4J5.1
#=GS F6MIW6_WHEAT/62-175         AC F6MIW6.1
#=GS A0A364KSH3_9EURO/74-178     AC A0A364KSH3.1
#=GS I0YIJ7_COCSC/115-223        AC I0YIJ7.1
#=GS A0A4D9BNF4_SALSN/144-247    AC A0A4D9BNF4.1
#=GS A0A1M6N0M7_9BACT/20-112     AC A0A1M6N0M7.1
#=GS R5AWN8_9BACE/258-354        AC R5AWN8.1
#=GS A0A2T7NIS0_POMCA/37-128     AC A0A2T7NIS0.1
#=GS A0A0E0BVP5_9ORYZ/526-620    AC A0A0E0BVP5.1
#=GS A0A0L9TIH2_PHAAN/149-252    AC A0A0L9TIH2.1
#=GS A0A3B4AQ35_9GOBI/28-121     AC A0A3B4AQ35.1
#=GS M1B548_SOLTU/44-136         AC M1B548.1
#=GS A0A1M6CSX2_9FLAO/27-113     AC A0A1M6CSX2.1
#=GS M1C0M6_SOLTU/54-141         AC M1C0M6.1
#=GS A0A2U0HZR6_9FLAO/21-112     AC A0A2U0HZR6.1
#=GS A0A1H3JJD3_9MICO/61-157     AC A0A1H3JJD3.1
#=GS H6WZ69_GOSHI/60-151         AC H6WZ69.1
#=GS A0A0K9R7N1_SPIOL/220-323    AC A0A0K9R7N1.1
#=GS A0A453T6S4_AEGTS/5-96       AC A0A453T6S4.1
#=GS A0A420Y1L9_9PEZI/21-111     AC A0A420Y1L9.1
#=GS A0A1G8M7N8_9NOCA/41-134     AC A0A1G8M7N8.1
#=GS A0A2U1P7Z1_ARTAN/173-282    AC A0A2U1P7Z1.1
#=GS A0A1B8W7D5_9BACI/35-135     AC A0A1B8W7D5.1
#=GS A0A095ZPY6_9CORY/77-233     AC A0A095ZPY6.1
#=GS A0A1A7KIA7_9FLAO/22-109     AC A0A1A7KIA7.1
#=GS A0A2P5DFS3_TREOI/186-294    AC A0A2P5DFS3.1
#=GS A0A1E3Q0Y9_LIPST/32-123     AC A0A1E3Q0Y9.1
#=GS A0A3T0EAN1_9RHOB/44-140     AC A0A3T0EAN1.1
#=GS V7B3Z4_PHAVU/72-184         AC V7B3Z4.1
#=GS A0A2K6QR49_RHIRO/32-125     AC A0A2K6QR49.1
#=GS I1HEM8_BRADI/63-176         AC I1HEM8.1
#=GS A0A1W2CWW2_9SPHI/33-131     AC A0A1W2CWW2.1
#=GS A0A3B6KEC0_WHEAT/235-343    AC A0A3B6KEC0.1
#=GS A0A061FY54_THECC/180-288    AC A0A061FY54.1
#=GS A0A1X7ICI2_9SPHI/56-153     AC A0A1X7ICI2.1
#=GS A0A132B3B4_9HELO/76-180     AC A0A132B3B4.1
#=GS A0A0J0XNG9_9TREE/46-139     AC A0A0J0XNG9.1
#=GS A0A0M8NXN6_9EURO/33-120     AC A0A0M8NXN6.1
#=GS A0A251RWV8_HELAN/17-108     AC A0A251RWV8.1
#=GS A0A1I2HR16_9BACT/26-127     AC A0A1I2HR16.1
#=GS A0A367GCH4_9FIRM/55-146     AC A0A367GCH4.1
#=GS G3JRY3_CORMM/34-123         AC G3JRY3.1
#=GS A7S4Y2_NEMVE/1-81           AC A7S4Y2.1
#=GS A0A432WI40_9GAMM/60-161     AC A0A432WI40.1
#=GS A0A0E4HCL3_9BACL/750-847    AC A0A0E4HCL3.1
#=GS A0A1V6PTJ0_9EURO/34-123     AC A0A1V6PTJ0.1
#=GS F5LN13_9BACL/409-520        AC F5LN13.1
#=GS G0PMT0_CAEBE/25-112         AC G0PMT0.1
#=GS A0A398AVC5_BRACM/76-187     AC A0A398AVC5.1
#=GS A0A1X2LPR3_9MYCO/61-154     AC A0A1X2LPR3.1
#=GS A0A415R2S1_9FIRM/65-157     AC A0A415R2S1.1
#=GS A0A3Q7JSD6_SOLLC/53-144     AC A0A3Q7JSD6.1
#=GS A0A3B6LJ35_WHEAT/108-197    AC A0A3B6LJ35.1
#=GS A0A2M9BU52_9MICO/62-158     AC A0A2M9BU52.1
#=GS A0A0R0HM85_SOYBN/78-190     AC A0A0R0HM85.1
#=GS A0A0E0MNX4_ORYPU/828-936    AC A0A0E0MNX4.1
#=GS A0A2Z5E8P2_9SPHN/41-141     AC A0A2Z5E8P2.1
#=GS A0A251RV08_HELAN/193-301    AC A0A251RV08.1
#=GS C6W3M9_DYAFD/37-133         AC C6W3M9.1
#=GS J3N631_ORYBR/45-134         AC J3N631.1
#=GS A0A3B6CEL3_WHEAT/134-225    AC A0A3B6CEL3.1
#=GS K3Z0Y1_SETIT/56-148         AC K3Z0Y1.1
#=GS A0A239MTR8_9ACTN/40-135     AC A0A239MTR8.1
#=GS A0A2T7CUV4_9POAL/48-135     AC A0A2T7CUV4.1
#=GS A0A287EIE5_HORVV/16-109     AC A0A287EIE5.1
#=GS A0A067FF19_CITSI/61-152     AC A0A067FF19.1
#=GS A0A2U1LSP5_ARTAN/189-297    AC A0A2U1LSP5.1
#=GS A0A0E0F2M5_9ORYZ/148-237    AC A0A0E0F2M5.1
#=GS A0A0J6WRW6_9FIRM/70-162     AC A0A0J6WRW6.1
#=GS A0A251P8U4_PRUPE/204-312    AC A0A251P8U4.1
#=GS A8FU35_SHESH/42-126         AC A8FU35.1
#=GS E0CPG2_VITVI/58-149         AC E0CPG2.1
#=GS A0A3B3RBY5_9TELE/27-120     AC A0A3B3RBY5.1
#=GS A0A3Q8V8D0_9ACTN/979-1071   AC A0A3Q8V8D0.1
#=GS A0A2C9K5Q5_BIOGL/52-154     AC A0A2C9K5Q5.1
#=GS A0A1T5A032_9SPHI/233-329    AC A0A1T5A032.1
#=GS A0A0X3S8G8_9ACTN/59-152     AC A0A0X3S8G8.1
#=GS M1D307_SOLTU/64-176         AC M1D307.1
#=GS Q0RN12_FRAAA/34-129         AC Q0RN12.1
#=GS A0A151U229_CAJCA/1-78       AC A0A151U229.1
#=GS A0A2J6KT83_LACSA/177-279    AC A0A2J6KT83.1
#=GS A0A166WZU8_9HYPO/34-125     AC A0A166WZU8.1
#=GS A0A1G4G6T9_9PORP/27-126     AC A0A1G4G6T9.1
#=GS A0A0R0H6N8_SOYBN/72-174     AC A0A0R0H6N8.1
#=GS A0A3B5Z4D8_WHEAT/169-282    AC A0A3B5Z4D8.1
#=GS A0A1M4ZXX9_9BACT/228-323    AC A0A1M4ZXX9.1
#=GS G9JJW5_GOSHI/47-139         AC G9JJW5.1
#=GS A0A318Z3U8_9EURO/33-122     AC A0A318Z3U8.1
#=GS A0A150VJ56_9PEZI/30-117     AC A0A150VJ56.1
#=GS A0A1Y4HBE7_9FIRM/58-144     AC A0A1Y4HBE7.1
#=GS A0A2U1LTG5_ARTAN/47-134     AC A0A2U1LTG5.1
#=GS A0A068TVT9_COFCA/1-90       AC A0A068TVT9.1
#=GS A1D8V4_NEOFI/34-123         AC A1D8V4.1
#=GS F9FEU4_FUSOF/75-176         AC F9FEU4.1
#=GS Q0D196_ASPTN/34-122         AC Q0D196.1
#=GS A0A0L8H5Z7_OCTBM/1-85       AC A0A0L8H5Z7.1
#=GS A0A420BJN5_9SPHI/30-127     AC A0A420BJN5.1
#=GS Y2577_MYCTU/65-158          AC P9WL81.1
#=GS A0A319APD5_ASPLB/33-122     AC A0A319APD5.1
#=GS A0A1S3UHM7_VIGRR/182-290    AC A0A1S3UHM7.1
#=GS A0A1X7U7G6_AMPQE/56-157     AC A0A1X7U7G6.1
#=GS A0A453M6Y2_AEGTS/51-142     AC A0A453M6Y2.1
#=GS K7K7T8_SOYBN/197-305        AC K7K7T8.1
#=GS M1D1Z8_SOLTU/61-152         AC M1D1Z8.1
#=GS A0A2W2EPM3_9ACTN/29-131     AC A0A2W2EPM3.1
#=GS A0A2B4SR79_STYPI/40-145     AC A0A2B4SR79.1
#=GS A0A074WCZ5_9PEZI/71-174     AC A0A074WCZ5.1
#=GS A0A0K9PYY3_ZOSMR/62-153     AC A0A0K9PYY3.1
#=GS A0A453D6U0_AEGTS/16-107     AC A0A453D6U0.1
#=GS A0A3D9L7K2_9MICC/39-131     AC A0A3D9L7K2.1
#=GS A0A368S2E2_SETIT/55-142     AC A0A368S2E2.1
#=GS A0A1W0A2W5_9STRA/127-232    AC A0A1W0A2W5.1
#=GS D2VUU5_NAEGR/23-125         AC D2VUU5.1
#=GS C1EDX9_MICCC/2-99           AC C1EDX9.1
#=GS A4APF5_MARSH/36-119         AC A4APF5.1
#=GS W1PXS5_AMBTC/43-130         AC W1PXS5.1
#=GS E4N983_KITSK/73-178         AC E4N983.1
#=GS B9GEG4_ORYSJ/57-151         AC B9GEG4.1
#=GS A0A3B6MM96_WHEAT/196-304    AC A0A3B6MM96.1
#=GS A0A2K3PAY8_TRIPR/62-156     AC A0A2K3PAY8.1
#=GS Q6BZK1_DEBHA/35-123         AC Q6BZK1.2
#=GS A0A1B6PD27_SORBI/64-157     AC A0A1B6PD27.1
#=GS A0A1D6KE93_MAIZE/174-282    AC A0A1D6KE93.1
#=GS A0A314KHQ2_NICAT/53-141     AC A0A314KHQ2.1
#=GS A0A1S4C526_TOBAC/53-144     AC A0A1S4C526.1
#=GS A0A3M2SR70_9HYPO/71-174     AC A0A3M2SR70.1
#=GS A0A0G3HIE4_9CORY/84-160     AC A0A0G3HIE4.1
#=GS A3QB56_SHELP/44-136         AC A3QB56.1
#=GS A0A401KQ91_ASPAW/33-122     AC A0A401KQ91.1
#=GS A0A453L819_AEGTS/127-235    AC A0A453L819.1
#=GS L0DEH2_SINAD/233-338        AC L0DEH2.1
#=GS H3GZF7_PHYRM/102-200        AC H3GZF7.1
#=GS A0A287QZ09_HORVV/22-109     AC A0A287QZ09.1
#=GS V7BKC0_PHAVU/42-129         AC V7BKC0.1
#=GS F6I1A3_VITVI/63-154         AC F6I1A3.1
#=GS A0A061GHS9_THECC/63-154     AC A0A061GHS9.1
#=GS A0A1L9MSN3_ASPTC/33-122     AC A0A1L9MSN3.1
#=GS Q82CS1_STRAW/62-179         AC Q82CS1.1
#=GS A0A094GG52_9PEZI/39-130     AC A0A094GG52.1
#=GS A0A1I1M1W0_9BACT/31-127     AC A0A1I1M1W0.1
#=GS D8RC38_SELML/65-175         AC D8RC38.1
#=GS A0A2K1WUS4_POPTR/63-154     AC A0A2K1WUS4.1
#=GS R5Y567_9BACE/165-248        AC R5Y567.1
#=GS G7JLE1_MEDTR/107-215        AC G7JLE1.1
#=GS A0A1U7XUV6_NICSY/76-167     AC A0A1U7XUV6.1
#=GS R6RQM7_9CLOT/60-153         AC R6RQM7.1
#=GS A0A1V4A9L0_9ACTN/83-188     AC A0A1V4A9L0.1
#=GS J1L4S3_9EURY/670-753        AC J1L4S3.1
#=GS A0A093XLE0_9PEZI/70-174     AC A0A093XLE0.1
#=GS A0A1W1ZSD2_9FIRM/37-133     AC A0A1W1ZSD2.1
#=GS A0A117PNJ4_9ACTN/76-181     AC A0A117PNJ4.1
#=GS A0A3B6LPZ2_WHEAT/106-219    AC A0A3B6LPZ2.1
#=GS Q10I09_ORYSJ/80-167         AC Q10I09.1
#=GS L0G2X8_ECHVK/48-149         AC L0G2X8.1
#=GS A0A0L8GU12_OCTBM/30-121     AC A0A0L8GU12.1
#=GS A0A1Y3MQ33_PIRSE/1-87       AC A0A1Y3MQ33.1
#=GS D3EJ47_GEOS4/496-599        AC D3EJ47.1
#=GS A0A251SIF3_HELAN/49-149     AC A0A251SIF3.1
#=GS D1W2E4_9BACT/39-134         AC D1W2E4.1
#=GS A0A2P8D2Z2_9BACT/398-476    AC A0A2P8D2Z2.1
#=GS A0A3L6S8G2_PANMI/63-150     AC A0A3L6S8G2.1
#=GS A0A059A5M9_EUCGR/165-273    AC A0A059A5M9.1
#=GS A0A0E0KLJ1_ORYPU/8-89       AC A0A0E0KLJ1.1
#=GS A0A4D8XR41_SALSN/69-181     AC A0A4D8XR41.1
#=GS A0A287SM92_HORVV/1-81       AC A0A287SM92.1
#=GS A0A1T4QGN5_9BACT/51-149     AC A0A1T4QGN5.1
#=GS A0A0D2QZY8_GOSRA/58-149     AC A0A0D2QZY8.1
#=GS A0A220SH27_9FLAO/23-110     AC A0A220SH27.1
#=GS A0A089KSU2_9BACL/36-134     AC A0A089KSU2.1
#=GS A0A2P5RIA0_GOSBA/100-191    AC A0A2P5RIA0.1
#=GS A0A0D2TMT7_GOSRA/61-152     AC A0A0D2TMT7.1
#=GS W4FUT3_9STRA/128-237        AC W4FUT3.1
#=GS A0A1I7MN95_9MICC/65-180     AC A0A1I7MN95.1
#=GS A0A0D3FVK7_9ORYZ/52-142     AC A0A0D3FVK7.1
#=GS Q4WHW5_ASPFU/1-87           AC Q4WHW5.1
#=GS A0A4D9BWI6_SALSN/229-331    AC A0A4D9BWI6.1
#=GS A0A1S3TMM3_VIGRR/46-134     AC A0A1S3TMM3.1
#=GS M1D3F3_SOLTU/70-160         AC M1D3F3.1
#=GS A0A1M4M841_9FIRM/219-316    AC A0A1M4M841.1
#=GS A0A0E0KQ91_ORYPU/52-139     AC A0A0E0KQ91.1
#=GS F8EDW6_RUNSL/29-111         AC F8EDW6.1
#=GS A0A3N6ZQL0_9BACT/27-118     AC A0A3N6ZQL0.1
#=GS A0A0N5A6D8_PARTI/70-166     AC A0A0N5A6D8.1
#=GS A0A1U8DXQ9_CAPAN/61-151     AC A0A1U8DXQ9.1
#=GS A0A078GHK5_BRANA/49-144     AC A0A078GHK5.1
#=GS A0A182LH17_9DIPT/45-136     AC A0A182LH17.1
#=GS R0FAA1_9BRAS/51-147         AC R0FAA1.1
#=GS A0A2J6JHC2_LACSA/25-111     AC A0A2J6JHC2.1
#=GS A0A199VKW3_ANACO/50-144     AC A0A199VKW3.1
#=GS D3BRK3_POLPP/30-135         AC D3BRK3.1
#=GS M7YMW3_TRIUA/139-247        AC M7YMW3.1
#=GS A0A453JWR6_AEGTS/174-282    AC A0A453JWR6.1
#=GS A0A3B6KLS5_WHEAT/179-288    AC A0A3B6KLS5.1
#=GS A0A0V8J4S6_9BACI/985-1091   AC A0A0V8J4S6.1
#=GS A0A2K0W3F4_GIBNY/76-178     AC A0A2K0W3F4.1
#=GS A0A0D9Y0R6_9ORYZ/2151-2259  AC A0A0D9Y0R6.1
#=GS A0A287R0F4_HORVV/105-223    AC A0A287R0F4.1
#=GS A0A3B6KJF8_WHEAT/173-281    AC A0A3B6KJF8.1
#=GS A0A453BXR3_AEGTS/47-134     AC A0A453BXR3.1
#=GS G4YPG8_PHYSP/220-326        AC G4YPG8.1
#=GS A0A1Z2L0G3_9ACTN/76-181     AC A0A1Z2L0G3.1
#=GS A0A1C5FBW7_9ACTN/44-149     AC A0A1C5FBW7.1
#=GS A0A1L9WSG8_ASPAC/70-173     AC A0A1L9WSG8.1
#=GS A0A2U1P7W5_ARTAN/183-291    AC A0A2U1P7W5.1
#=GS A0A383VLC0_TETOB/87-221     AC A0A383VLC0.1
#=GS G1LQ26_AILME/35-128         AC G1LQ26.1
#=GS A0A089IP76_9BACL/1091-1190  AC A0A089IP76.1
#=GS G0MTX2_CAEBE/25-111         AC G0MTX2.1
#=GS A0A498BBX8_9ACTN/79-184     AC A0A498BBX8.1
#=GS A0A094ETP4_9PEZI/34-124     AC A0A094ETP4.1
#=GS R5PV60_9BACT/78-162         AC R5PV60.1
#=GS A0A327ZDR3_9ACTN/42-137     AC A0A327ZDR3.1
#=GS A0A2G1XD25_STRCJ/81-186     AC A0A2G1XD25.1
#=GS K1R7R6_CRAGI/36-130         AC K1R7R6.1
#=GS A0A2I0AWC9_9ASPA/169-277    AC A0A2I0AWC9.1
#=GS A0A1H5L0B3_9ACTN/67-160     AC A0A1H5L0B3.1
#=GS A0A428QMZ4_9HYPO/71-174     AC A0A428QMZ4.1
#=GS A0A0I9Y4C8_9MYCO/70-163     AC A0A0I9Y4C8.1
#=GS A0A498IZE0_MALDO/75-187     AC A0A498IZE0.1
#=GS A0A3Q7XMX1_CICAR/45-134     AC A0A3Q7XMX1.1
#=GS A0A0E0IM38_ORYNI/177-285    AC A0A0E0IM38.1
#=GS A0A1H5FPU1_9ACTN/48-143     AC A0A1H5FPU1.1
#=GS A0A0D9W1C6_9ORYZ/13-95      AC A0A0D9W1C6.1
#=GS A0A453FNH5_AEGTS/26-117     AC A0A453FNH5.1
#=GS A0A0E0MQ20_ORYPU/60-151     AC A0A0E0MQ20.1
#=GS A0A1U8KAW9_GOSHI/65-176     AC A0A1U8KAW9.1
#=GS A0A127VA68_9SPHI/36-118     AC A0A127VA68.1
#=GS A0A078H0G8_BRANA/53-147     AC A0A078H0G8.1
#=GS A0A0B0HSA3_9BACL/125-235    AC A0A0B0HSA3.1
#=GS V7BZF5_PHAVU/76-187         AC V7BZF5.1
#=GS A0A495JVQ3_9ACTN/44-139     AC A0A495JVQ3.1
#=GS G0L8C4_ZOBGA/35-130         AC G0L8C4.1
#=GS A0A067C7M8_SAPPC/69-168     AC A0A067C7M8.1
#=GS A0A3D9I101_9BACL/36-150     AC A0A3D9I101.1
#=GS A0A197SL66_9ACTN/79-185     AC A0A197SL66.1
#=GS A0A0D3CM49_BRAOL/71-183     AC A0A0D3CM49.1
#=GS I1IRL2_BRADI/181-290        AC I1IRL2.1
#=GS A0A251NJH3_PRUPE/62-153     AC A0A251NJH3.1
#=GS A0A1V8SJF7_9PEZI/29-116     AC A0A1V8SJF7.1
#=GS A0A0J7P1V0_LASNI/24-115     AC A0A0J7P1V0.1
#=GS A0A160T317_9CHLR/106-191    AC A0A160T317.2
#=GS A0A1Y1XJ01_9FUNG/167-258    AC A0A1Y1XJ01.1
#=GS I1IRL3_BRADI/171-279        AC I1IRL3.1
#=GS A0A1Z5RC12_SORBI/119-227    AC A0A1Z5RC12.1
#=GS R6RV41_9FIRM/92-188         AC R6RV41.1
#=GS W7MWA6_GIBM7/77-178         AC W7MWA6.1
#=GS A0A316YGV7_9BASI/34-124     AC A0A316YGV7.1
#=GS A0A0A2LV48_9FLAO/20-111     AC A0A0A2LV48.1
#=GS A0A287JUB3_HORVV/1-82       AC A0A287JUB3.1
#=GS A0A1H7XD89_STRJI/81-174     AC A0A1H7XD89.1
#=GS A0A095VRF3_9GAMM/231-335    AC A0A095VRF3.1
#=GS A0A443RJC3_9ACAR/4-94       AC A0A443RJC3.1
#=GS A0A2U0H649_9MICO/700-791    AC A0A2U0H649.1
#=GS A0A345SWY9_9ACTN/48-143     AC A0A345SWY9.1
#=GS W1NYA8_AMBTC/63-174         AC W1NYA8.1
#=GS T1IAC6_RHOPR/1-86           AC T1IAC6.1
#=GS G2EGN1_9FLAO/21-113         AC G2EGN1.1
#=GS A0A388LKI2_CHABU/155-301    AC A0A388LKI2.1
#=GS A0A368KUQ4_9PLAN/266-350    AC A0A368KUQ4.1
#=GS W2EUW4_9ACTN/48-142         AC W2EUW4.1
#=GS A0A4D9AAS4_SALSN/41-136     AC A0A4D9AAS4.1
#=GS A0A087SD99_AUXPR/154-257    AC A0A087SD99.1
#=GS A0A369QJ37_9BACT/47-143     AC A0A369QJ37.1
#=GS A0A1X1TFD2_9MYCO/58-151     AC A0A1X1TFD2.1
#=GS B4GTD4_DROPE/13-101         AC B4GTD4.1
#=GS A0A1B8CXZ3_9PEZI/35-121     AC A0A1B8CXZ3.1
#=GS F5GUC7_CAEEL/1-76           AC F5GUC7.1
#=GS B0DKQ4_LACBS/38-128         AC B0DKQ4.1
#=GS A0A3Q0I3K0_PHODC/1-75       AC A0A3Q0I3K0.1
#=GS V4SWP9_9ROSI/92-179         AC V4SWP9.1
#=GS A0A0E0RKH3_ORYRU/63-149     AC A0A0E0RKH3.1
#=GS A0A1S3TGM8_VIGRR/169-277    AC A0A1S3TGM8.1
#=GS A0A1V6QR08_9EURO/33-120     AC A0A1V6QR08.1
#=GS K5Y978_9BACT/28-116         AC K5Y978.1
#=GS A0A2U1NKV0_ARTAN/78-180     AC A0A2U1NKV0.1
#=GS A0A0F7TFI3_9EURO/37-122     AC A0A0F7TFI3.1
#=GS A0A1R4L7V8_9SPHI/57-154     AC A0A1R4L7V8.1
#=GS F5LPT7_9BACL/46-157         AC F5LPT7.1
#=GS A0A1Q3ALW7_CEPFO/175-283    AC A0A1Q3ALW7.1
#=GS A0A3S8WFM4_9ACTN/86-191     AC A0A3S8WFM4.1
#=GS A0A0P5W7X5_9CRUS/35-129     AC A0A0P5W7X5.1
#=GS A0A0D2U9Q7_GOSRA/56-147     AC A0A0D2U9Q7.1
#=GS U5GV51_POPTR/218-320        AC U5GV51.1
#=GS A0A2R6QSI6_ACTCH/70-183     AC A0A2R6QSI6.1
#=GS A0A2I4F2B4_JUGRE/178-286    AC A0A2I4F2B4.1
#=GS A0A1S2VRI3_9BACT/33-113     AC A0A1S2VRI3.1
#=GS A0A2P8GWI1_9MICO/389-484    AC A0A2P8GWI1.1
#=GS A0A0L9U957_PHAAN/58-150     AC A0A0L9U957.1
#=GS A0A1J6KPR7_NICAT/53-144     AC A0A1J6KPR7.1
#=GS A0A3Q0I8U2_PHODC/74-186     AC A0A3Q0I8U2.1
#=GS F4F326_VERMA/57-160         AC F4F326.1
#=GS A0A287QZ71_HORVV/1-75       AC A0A287QZ71.1
#=GS A0A1R3UHL2_9ACTN/1-74       AC A0A1R3UHL2.1
#=GS A0A2U9CJ78_SCOMX/69-162     AC A0A2U9CJ78.1
#=GS A0A1H5VNX1_9ACTN/57-159     AC A0A1H5VNX1.1
#=GS A0A2U1MWN0_ARTAN/168-276    AC A0A2U1MWN0.1
#=GS A0A0D1E5L4_USTMA/34-120     AC A0A0D1E5L4.1
#=GS A0A139WTQ4_9CYAN/19-103     AC A0A139WTQ4.1
#=GS A0A2C9UE91_MANES/117-160    AC A0A2C9UE91.1
#=GS A0A067EE33_CITSI/17-108     AC A0A067EE33.1
#=GS A0A3B6I115_WHEAT/13-126     AC A0A3B6I115.1
#=GS A0A1Y1T8C9_9FLAO/66-175     AC A0A1Y1T8C9.1
#=GS A0A103Y1D5_CYNCS/217-317    AC A0A103Y1D5.1
#=GS A0A453BQ07_AEGTS/165-255    AC A0A453BQ07.1
#=GS M4E2A3_BRARP/64-175         AC M4E2A3.1
#=GS G7JSI6_MEDTR/216-318        AC G7JSI6.2
#=GS I1NSF8_ORYGL/206-309        AC I1NSF8.1
#=GS A0A0K0DU54_STRER/29-125     AC A0A0K0DU54.1
#=GS A0A2P4ZJL5_9HYPO/69-172     AC A0A2P4ZJL5.1
#=GS A0A3M6TYY5_9CNID/171-274    AC A0A3M6TYY5.1
#=GS A0A3L6SJ55_PANMI/209-312    AC A0A3L6SJ55.1
#=GS A0A1Y0H1N7_9BACT/256-344    AC A0A1Y0H1N7.1
#=GS A0A3Q1FJ25_9TELE/28-121     AC A0A3Q1FJ25.1
#=GS A0A067K8V7_JATCU/50-149     AC A0A067K8V7.1
#=GS F6MIV8_WHEAT/63-176         AC F6MIV8.1
#=GS A0A072U2E8_MEDTR/169-277    AC A0A072U2E8.1
#=GS L8GZ22_ACACA/77-167         AC L8GZ22.1
#=GS A0A3L6T386_PANMI/60-147     AC A0A3L6T386.1
#=GS F2I6V2_AERUA/100-256        AC F2I6V2.1
#=GS A0A0F9ZH76_TRIHA/67-170     AC A0A0F9ZH76.1
#=GS A0A2I4E2N6_JUGRE/53-140     AC A0A2I4E2N6.1
#=GS A0A0D2WX61_CAPO3/24-117     AC A0A0D2WX61.1
#=GS A0A2R9AF82_PANPA/32-125     AC A0A2R9AF82.1
#=GS A0A314KNW1_NICAT/70-182     AC A0A314KNW1.1
#=GS A0A2K5NLR5_CERAT/32-125     AC A0A2K5NLR5.1
#=GS A0A099WF80_9LIST/213-311    AC A0A099WF80.1
#=GS E0IGC9_9BACL/37-139         AC E0IGC9.1
#=GS A0A0D9WSJ2_9ORYZ/54-145     AC A0A0D9WSJ2.1
#=GS A0A316VQB4_9BASI/35-123     AC A0A316VQB4.1
#=GS I1JEF3_SOYBN/197-305        AC I1JEF3.1
#=GS A0A394DCE9_LUPAN/57-148     AC A0A394DCE9.1
#=GS A0A179HKI4_PURLI/34-120     AC A0A179HKI4.1
#=GS A0A1L7X3B4_9HELO/76-179     AC A0A1L7X3B4.1
#=GS A0A2I3MY74_PAPAN/32-125     AC A0A2I3MY74.1
#=GS G5EE15_CAEEL/20-114         AC G5EE15.2
#=GS A0A314KRB3_NICAT/146-249    AC A0A314KRB3.1
#=GS A0A1R3HMS9_9ROSI/170-278    AC A0A1R3HMS9.1
#=GS A0A2K5JT91_COLAP/32-125     AC A0A2K5JT91.1
#=GS A0A2C9UD49_MANES/96-208     AC A0A2C9UD49.1
#=GS A0A2P7AFR9_9MICO/32-124     AC A0A2P7AFR9.1
#=GS A0A2A3H4N1_9ACTN/79-184     AC A0A2A3H4N1.1
#=GS A0A0E0C8F2_9ORYZ/57-148     AC A0A0E0C8F2.1
#=GS A0A1X2H7A9_SYNRA/61-161     AC A0A1X2H7A9.1
#=GS A0A1X7VC55_AMPQE/30-121     AC A0A1X7VC55.1
#=GS C6PWC9_9CLOT/46-142         AC C6PWC9.1
#=GS A0A329SQ31_9STRA/243-349    AC A0A329SQ31.1
#=GS R7ZWS2_9BACT/232-328        AC R7ZWS2.1
#=GS Q8LJ43_ORYSJ/57-148         AC Q8LJ43.1
#=GS F0ZBD1_DICPU/25-123         AC F0ZBD1.1
#=GS A0A1T2X1R2_9BACL/5-114      AC A0A1T2X1R2.1
#=GS A0A1K1MAP1_9FLAO/57-165     AC A0A1K1MAP1.1
#=GS A0A067FEB9_CITSI/61-152     AC A0A067FEB9.1
#=GS A0A416AZA8_9FIRM/55-149     AC A0A416AZA8.1
#=GS M0T7T2_MUSAM/47-137         AC M0T7T2.1
#=GS F6GX85_VITVI/217-318        AC F6GX85.1
#=GS A0A2I4DW13_JUGRE/43-136     AC A0A2I4DW13.1
#=GS A0A453L827_AEGTS/170-278    AC A0A453L827.1
#=GS A0A0S2KFW2_9GAMM/50-146     AC A0A0S2KFW2.1
#=GS I3C615_9FLAO/32-116         AC I3C615.1
#=GS A0A2C9W975_MANES/69-180     AC A0A2C9W975.1
#=GS A0A0W8DP46_PHYNI/70-169     AC A0A0W8DP46.1
#=GS A0A0D2RWZ1_GOSRA/46-133     AC A0A0D2RWZ1.1
#=GS A0A2U0H149_9MICO/247-340    AC A0A2U0H149.1
#=GS Q6CDW1_YARLI/30-118         AC Q6CDW1.1
#=GS G0FJL2_AMYMS/55-148         AC G0FJL2.1
#=GS K1QWF8_CRAGI/9-100          AC K1QWF8.1
#=GS A0A1Y4M0B5_9FIRM/65-159     AC A0A1Y4M0B5.1
#=GS D3BTH8_POLPP/3-43           AC D3BTH8.1
#=GS A0A2T4GWT6_FUSCU/34-122     AC A0A2T4GWT6.1
#=GS A0A261AHN8_9PELO/43-136     AC A0A261AHN8.1
#=GS A0A0A0KNH8_CUCSA/143-246    AC A0A0A0KNH8.1
#=GS A0A1Y2A3U0_9FUNG/96-187     AC A0A1Y2A3U0.1
#=GS A0A453KLI7_AEGTS/88-206     AC A0A453KLI7.1
#=GS A0A379MSA8_9BACT/259-357    AC A0A379MSA8.1
#=GS A0A2N4XF99_9BACT/52-153     AC A0A2N4XF99.1
#=GS A0A0F6QXR9_9CORY/31-126     AC A0A0F6QXR9.1
#=GS F8EYE2_TRECH/227-324        AC F8EYE2.1
#=GS A0A061DYP5_THECC/62-153     AC A0A061DYP5.1
#=GS A0A1I0LYY9_9BACT/36-137     AC A0A1I0LYY9.1
#=GS A0A067LCF7_JATCU/58-148     AC A0A067LCF7.1
#=GS C0HG39_MAIZE/83-201         AC C0HG39.1
#=GS A0A397LYS4_9MICO/253-346    AC A0A397LYS4.1
#=GS A0A453K9X9_AEGTS/4-91       AC A0A453K9X9.1
#=GS A0A1Y2A3V2_9FUNG/50-141     AC A0A1Y2A3V2.1
#=GS A0A1R3HKX7_COCAP/76-188     AC A0A1R3HKX7.1
#=GS A0A078HDF8_BRANA/1-81       AC A0A078HDF8.1
#=GS A0A445DPC5_ARAHY/172-280    AC A0A445DPC5.1
#=GS A0A1P8X432_9SPHN/25-121     AC A0A1P8X432.1
#=GS A0A371EHK6_MUCPR/210-312    AC A0A371EHK6.1
#=GS A0A0M8VVX2_9ACTN/48-143     AC A0A0M8VVX2.1
#=GS A0A016S3U6_9BILA/40-134     AC A0A016S3U6.1
#=GS G5A0U1_PHYSP/70-166         AC G5A0U1.1
#=GS A0A1Q9JSN7_9FIRM/65-191     AC A0A1Q9JSN7.1
#=GS D4ZJ13_SHEVD/52-136         AC D4ZJ13.1
#=GS A0A0P8Y531_DROAN/40-144     AC A0A0P8Y531.1
#=GS B2JSM5_PARP8/64-160         AC B2JSM5.1
#=GS A0A4D9AZZ4_SALSN/1-80       AC A0A4D9AZZ4.1
#=GS A0A094EQW6_9PEZI/70-174     AC A0A094EQW6.1
#=GS PPAF_SOYBN/54-145           AC Q09131.2
#=GS A0A2A2JJH1_9BILA/21-109     AC A0A2A2JJH1.1
#=GS H3DJ87_TETNG/24-111         AC H3DJ87.1
#=GS A0A3M7PID5_BRAPC/36-128     AC A0A3M7PID5.1
#=GS A0A199V4L6_ANACO/61-148     AC A0A199V4L6.1
#=GS T1FX50_HELRO/1-83           AC T1FX50.1
#=GS A0A0E0QTG5_ORYRU/186-294    AC A0A0E0QTG5.1
#=GS A0A0D2TTG8_GOSRA/179-287    AC A0A0D2TTG8.1
#=GS A0A1E7N4Y3_KITAU/76-181     AC A0A1E7N4Y3.1
#=GS F8L2E4_PARAV/26-114         AC F8L2E4.1
#=GS A0A0G0A3L3_TRIHA/34-122     AC A0A0G0A3L3.1
#=GS A0A4D8ZK94_SALSN/53-144     AC A0A4D8ZK94.1
#=GS V7C809_PHAVU/169-277        AC V7C809.1
#=GS A0A139WIU9_TRICA/25-116     AC A0A139WIU9.1
#=GS A0A1M4XB87_9BACE/46-137     AC A0A1M4XB87.1
#=GS R6TEC2_9FIRM/57-154         AC R6TEC2.1
#=GS A0A175YRY5_DAUCS/67-179     AC A0A175YRY5.1
#=GS A0A178PK72_STALE/67-219     AC A0A178PK72.1
#=GS V4A001_LOTGI/9-100          AC V4A001.1
#=GS A0A1W2BBC3_9SPHI/50-134     AC A0A1W2BBC3.1
#=GS A0A433Y780_9BACL/349-460    AC A0A433Y780.1
#=GS A0A0E0KFP2_ORYPU/80-167     AC A0A0E0KFP2.1
#=GS D7KB00_ARALL/50-147         AC D7KB00.1
#=GS A0A3M2KXW9_9NOCA/72-166     AC A0A3M2KXW9.1
#=GS A0A316A779_9BACT/539-623    AC A0A316A779.1
#=GS A0A1S3C6B9_CUCME/1-72       AC A0A1S3C6B9.1
#=GS A0A0D2WUR4_CAPO3/24-118     AC A0A0D2WUR4.1
#=GS W9ZD20_9EURO/31-118         AC W9ZD20.1
#=GS A0A2R7KWB1_9SPHI/50-146     AC A0A2R7KWB1.1
#=GS A0A3N7GFS3_POPTR/172-280    AC A0A3N7GFS3.1
#=GS H1Y8F4_9SPHI/43-139         AC H1Y8F4.1
#=GS A0A182H931_AEDAL/34-125     AC A0A182H931.1
#=GS A0A199UNG1_ANACO/68-159     AC A0A199UNG1.1
#=GS A0A314ZG47_PRUYE/170-278    AC A0A314ZG47.1
#=GS V4UBK6_9ROSI/75-166         AC V4UBK6.1
#=GS A0A151MLZ8_ALLMI/1-80       AC A0A151MLZ8.1
#=GS A0A0D2LWH6_9CHLO/192-295    AC A0A0D2LWH6.1
#=GS A0A1A9WDD5_9MUSC/24-117     AC A0A1A9WDD5.1
#=GS V4L6N3_EUTSA/145-248        AC V4L6N3.1
#=GS A0A0Q3GG17_BRADI/1-77       AC A0A0Q3GG17.1
#=GS A3ZVA8_9PLAN/48-144         AC A3ZVA8.1
#=GS A0A0J1G1S6_9FIRM/45-140     AC A0A0J1G1S6.1
#=GS A0A1H5HDN6_9ACTN/48-167     AC A0A1H5HDN6.1
#=GS A0A067FSL1_CITSI/169-277    AC A0A067FSL1.1
#=GS A0A2A2LRT8_9BILA/24-111     AC A0A2A2LRT8.1
#=GS A0A1S2VR21_9BACT/218-314    AC A0A1S2VR21.1
#=GS A0A067FEW8_CITSI/76-188     AC A0A067FEW8.1
#=GS A0A1Y3MLQ5_PIRSE/1-87       AC A0A1Y3MLQ5.1
#=GS A0A2U1Q0K1_ARTAN/33-120     AC A0A2U1Q0K1.1
#=GS A0A397ZBU9_BRACM/43-130     AC A0A397ZBU9.1
#=GS A0A3L6RM59_PANMI/87-202     AC A0A3L6RM59.1
#=GS A0A225WX05_9STRA/149-254    AC A0A225WX05.1
#=GS A0A445KAZ2_GLYSO/180-288    AC A0A445KAZ2.1
#=GS A0A1N7FJC3_9ACTN/46-138     AC A0A1N7FJC3.1
#=GS A0A0B8N5X6_9NOCA/86-181     AC A0A0B8N5X6.1
#=GS A0A2U1NQ68_ARTAN/51-165     AC A0A2U1NQ68.1
#=GS A0A417YSU9_9BACI/52-149     AC A0A417YSU9.1
#=GS A0A445HIA0_GLYSO/78-190     AC A0A445HIA0.1
#=GS R7JG37_9BACT/234-319        AC R7JG37.1
#=GS A0A0E0R4B6_ORYRU/193-282    AC A0A0E0R4B6.1
#=GS A0A0D9VR71_9ORYZ/176-284    AC A0A0D9VR71.1
#=GS A0A3S0Z410_ELYCH/48-140     AC A0A3S0Z410.1
#=GS V4UML7_9ROSI/61-152         AC V4UML7.1
#=GS A0A327X777_9BACT/54-152     AC A0A327X777.1
#=GS R0HQV6_9BRAS/68-183         AC R0HQV6.1
#=GS H6L8U4_SAPGL/21-113         AC H6L8U4.1
#=GS A0A3N4Z8X7_9MICO/1004-1100  AC A0A3N4Z8X7.1
#=GS F2IBC1_FLUTR/196-280        AC F2IBC1.1
#=GS D6YTX5_WADCW/23-112         AC D6YTX5.1
#=GS A0A2X0NZ13_9BASI/56-149     AC A0A2X0NZ13.1
#=GS V4MQU8_EUTSA/50-147         AC V4MQU8.1
#=GS A0A1X7HBM2_9BACL/1-79       AC A0A1X7HBM2.1
#=GS A0A3P8UJ37_CYNSE/27-120     AC A0A3P8UJ37.1
#=GS A0A2G3BW50_CAPCH/61-152     AC A0A2G3BW50.1
#=GS A0A2K1L9Q6_PHYPA/175-277    AC A0A2K1L9Q6.1
#=GS A3UAG1_CROAH/20-115         AC A3UAG1.1
#=GS A0A2I0I3R7_PUNGR/17-109     AC A0A2I0I3R7.1
#=GS A0A2T7TEV0_9ACTN/69-174     AC A0A2T7TEV0.1
#=GS A0A2N5GWW6_9BACI/986-1090   AC A0A2N5GWW6.1
#=GS A0A059ANH4_EUCGR/60-152     AC A0A059ANH4.1
#=GS A0A2K3P146_TRIPR/60-151     AC A0A2K3P146.1
#=GS A0A1Y2W6C3_9PEZI/31-118     AC A0A1Y2W6C3.1
#=GS A0A0N5BKC4_STREA/28-121     AC A0A0N5BKC4.1
#=GS A0A1S3CLG1_CUCME/177-285    AC A0A1S3CLG1.1
#=GS A0A367KST6_RHIST/63-161     AC A0A367KST6.1
#=GS A0A287KQH0_HORVV/25-108     AC A0A287KQH0.1
#=GS A0A1H3AUH9_9PSEU/49-142     AC A0A1H3AUH9.1
#=GS A0A287LTG9_HORVV/260-350    AC A0A287LTG9.1
#=GS Q0CWA3_ASPTN/68-171         AC Q0CWA3.1
#=GS L8YC21_TUPCH/1-86           AC L8YC21.1
#=GS A0A0D2V3K5_GOSRA/58-149     AC A0A0D2V3K5.1
#=GS A0A1L8F943_XENLA/28-120     AC A0A1L8F943.1
#=GS A0A314KZU8_NICAT/53-144     AC A0A314KZU8.1
#=GS A0A2Y9ALL4_9MICO/2-100      AC A0A2Y9ALL4.1
#=GS A0A383WBK7_TETOB/14-133     AC A0A383WBK7.1
#=GS A0A3Q9FYJ8_STRLT/89-194     AC A0A3Q9FYJ8.1
#=GS A0A1H3H404_9PSEU/29-142     AC A0A1H3H404.1
#=GS A0A0D3B4K5_BRAOL/73-184     AC A0A0D3B4K5.1
#=GS A0A2I4H891_JUGRE/169-277    AC A0A2I4H891.1
#=GS A0A0Q4BHI7_9EURY/522-603    AC A0A0Q4BHI7.1
#=GS A0A2T0BPL9_9CLOT/52-147     AC A0A2T0BPL9.1
#=GS Q2SG19_HAHCH/37-127         AC Q2SG19.1
#=GS A0A2P5CEN1_TREOI/62-153     AC A0A2P5CEN1.1
#=GS E9DYC8_METAQ/69-171         AC E9DYC8.1
#=GS PPA27_ARATH/168-276         AC Q5MAU8.1
#=GS K0YFZ3_9CORY/51-142         AC K0YFZ3.1
#=GS A0A0D9XA44_9ORYZ/178-275    AC A0A0D9XA44.1
#=GS G1NX75_MYOLU/32-124         AC G1NX75.1
#=GS A0A2K8KR08_9GAMM/177-265    AC A0A2K8KR08.1
#=GS A0A445I629_GLYSO/60-151     AC A0A445I629.1
#=GS A0A287PY09_HORVV/178-286    AC A0A287PY09.1
#=GS X0BGT0_FUSOX/69-173         AC X0BGT0.1
#=GS D7CCD4_STRBB/75-180         AC D7CCD4.1
#=GS A0A445I5R3_GLYSO/53-144     AC A0A445I5R3.1
#=GS A0A168NYF9_MUCCL/58-156     AC A0A168NYF9.1
#=GS G7XLN6_ASPKW/33-122         AC G7XLN6.1
#=GS Q13K54_PARXL/69-165         AC Q13K54.1
#=GS A0A2K2TZ26_9CLOT/39-128     AC A0A2K2TZ26.1
#=GS A0A0E4HCL3_9BACL/237-348    AC A0A0E4HCL3.1
#=GS A0A3B6PIB7_WHEAT/33-125     AC A0A3B6PIB7.1
#=GS A0A314XXN4_PRUYE/54-141     AC A0A314XXN4.1
#=GS E9FC97_METRA/34-122         AC E9FC97.1
#=GS A0A445EX46_ARAHY/44-133     AC A0A445EX46.1
#=GS A0A2I0XAD0_9ASPA/44-132     AC A0A2I0XAD0.1
#=GS A0A2U1KGF4_ARTAN/173-257    AC A0A2U1KGF4.1
#=GS A0A094IIQ5_9PEZI/70-174     AC A0A094IIQ5.1
#=GS D1BXZ3_XYLCX/248-341        AC D1BXZ3.1
#=GS A0A0D3HW09_9ORYZ/120-228    AC A0A0D3HW09.1
#=GS A0A3T1ALY8_9ACTN/42-138     AC A0A3T1ALY8.1
#=GS A0A1P8F7J2_9CHLR/38-130     AC A0A1P8F7J2.1
#=GS A0A2S7KP18_9FLAO/41-144     AC A0A2S7KP18.1
#=GS H3EWH7_PRIPA/49-144         AC H3EWH7.2
#=GS F6GX85_VITVI/877-978        AC F6GX85.1
#=GS B0DKQ3_LACBS/33-123         AC B0DKQ3.1
#=GS A0A443NV10_9MAGN/45-133     AC A0A443NV10.1
#=GS U5GX45_POPTR/42-130         AC U5GX45.1
#=GS A0A2G5CAL0_AQUCA/46-133     AC A0A2G5CAL0.1
#=GS A0A399SVS4_9BACT/33-133     AC A0A399SVS4.1
#=GS A0A2Y9LBL1_ENHLU/32-125     AC A0A2Y9LBL1.1
#=GS A0A2K3PI97_TRIPR/1-76       AC A0A2K3PI97.1
#=GS W1S9H0_9SPHN/42-139         AC W1S9H0.1
#=GS A0A3B6MMJ9_WHEAT/53-140     AC A0A3B6MMJ9.1
#=GS A0A0E0D5A9_9ORYZ/54-141     AC A0A0E0D5A9.1
#=GS A0A395NJ26_TRIAR/34-122     AC A0A395NJ26.1
#=GS C5ACX1_BURGB/56-156         AC C5ACX1.1
#=GS R7WN77_9NOCA/2-63           AC R7WN77.1
#=GS A0A0N5CQJ5_THECL/46-137     AC A0A0N5CQJ5.1
#=GS A0A0D2S7Q2_GOSRA/59-150     AC A0A0D2S7Q2.1
#=GS A0A0R1N6S0_9LACO/1008-1110  AC A0A0R1N6S0.1
#=GS X0BTW5_FUSOX/28-117         AC X0BTW5.1
#=GS K9ARZ4_9STAP/31-123         AC K9ARZ4.1
#=GS A0A161IF49_9MICO/236-327    AC A0A161IF49.1
#=GS A0A101QVD4_9ACTN/74-179     AC A0A101QVD4.1
#=GS M0RRM7_MUSAM/186-273        AC M0RRM7.1
#=GS M4DBI3_BRARP/174-282        AC M4DBI3.1
#=GS K7KG04_SOYBN/100-187        AC K7KG04.1
#=GS A0A0Q5QBT8_9FLAO/20-110     AC A0A0Q5QBT8.1
#=GS A0A287QKK4_HORVV/1-95       AC A0A287QKK4.1
#=GS A0A2U1NQ61_ARTAN/80-194     AC A0A2U1NQ61.1
#=GS G4ZZW7_PHYSP/102-200        AC G4ZZW7.1
#=GS B0X4G2_CULQU/715-807        AC B0X4G2.1
#=GS A0A1V0DGM3_9BACT/41-138     AC A0A1V0DGM3.1
#=GS A0A176TDE7_9FLAO/20-98      AC A0A176TDE7.1
#=GS A0A4D8ZLM2_SALSN/187-295    AC A0A4D8ZLM2.1
#=GS A0A094BM97_9PEZI/70-174     AC A0A094BM97.1
#=GS M0Y7U2_HORVV/1-80           AC M0Y7U2.1
#=GS A0A0E0BP05_9ORYZ/55-142     AC A0A0E0BP05.1
#=GS A0A371GLE5_MUCPR/42-130     AC A0A371GLE5.1
#=GS PPA15_ARATH/64-176          AC Q9SFU3.1
#=GS A0A2I0WGL0_9ASPA/51-139     AC A0A2I0WGL0.1
#=GS A0A154BW98_ANASB/39-134     AC A0A154BW98.1
#=GS G9MZW9_HYPVG/34-122         AC G9MZW9.1
#=GS A0A2Z2KIN9_9BACL/1084-1183  AC A0A2Z2KIN9.1
#=GS A0A151TRB6_CAJCA/180-289    AC A0A151TRB6.1
#=GS A0A287JUN2_HORVV/30-124     AC A0A287JUN2.1
#=GS A0A251VGS1_HELAN/54-145     AC A0A251VGS1.1
#=GS A5Z721_9FIRM/37-134         AC A5Z721.1
#=GS A0A2G2VG27_CAPBA/69-181     AC A0A2G2VG27.1
#=GS A0A287QZ04_HORVV/56-143     AC A0A287QZ04.1
#=GS A0A0K9NPL3_ZOSMR/203-311    AC A0A0K9NPL3.1
#=GS A0A453JWJ3_AEGTS/167-275    AC A0A453JWJ3.1
#=GS I0YWD4_COCSC/1-89           AC I0YWD4.1
#=GS A0A1Y1XJS8_9FUNG/122-214    AC A0A1Y1XJS8.1
#=GS A0A316E073_9FLAO/382-460    AC A0A316E073.1
#=GS A0A0G3LYT3_9FLAO/250-339    AC A0A0G3LYT3.1
#=GS A0A0K9R9M5_SPIOL/62-152     AC A0A0K9R9M5.1
#=GS J9QTH8_RIEAN/19-108         AC J9QTH8.1
#=GS A0A453JUS1_AEGTS/83-188     AC A0A453JUS1.1
#=GS A0A395I036_ASPHC/33-122     AC A0A395I036.1
#=GS A0A0E0QLL3_ORYRU/179-290    AC A0A0E0QLL3.1
#=GS A0A061FC25_THECC/60-151     AC A0A061FC25.1
#=GS A0A1U8FBZ9_CAPAN/53-144     AC A0A1U8FBZ9.1
#=GS A0A2G2XQL4_CAPBA/224-326    AC A0A2G2XQL4.1
#=GS A0A327QP17_9BACT/57-153     AC A0A327QP17.1
#=GS A0A1Q5K1Z6_9ACTN/79-184     AC A0A1Q5K1Z6.1
#=GS A0A1V9ZUZ6_9STRA/493-591    AC A0A1V9ZUZ6.1
#=GS I0YNC3_COCSC/54-180         AC I0YNC3.1
#=GS A0A2I4F574_JUGRE/62-153     AC A0A2I4F574.1
#=GS A0A1L9TZB5_9EURO/31-119     AC A0A1L9TZB5.1
#=GS A0A3Q3VUA5_MOLML/31-124     AC A0A3Q3VUA5.1
#=GS A0A127V886_9SPHI/30-128     AC A0A127V886.1
#=GS R7IYY5_9FIRM/65-164         AC R7IYY5.1
#=GS S0FT26_CLOCB/36-133         AC S0FT26.1
#=GS A0A1M6DQP5_9FLAO/59-184     AC A0A1M6DQP5.1
#=GS K9F863_PEND2/35-122         AC K9F863.1
#=GS R6E1J7_9FIRM/13-104         AC R6E1J7.1
#=GS A0A286EMZ8_9ACTN/77-175     AC A0A286EMZ8.1
#=GS A0A251TBC6_HELAN/49-136     AC A0A251TBC6.1
#=GS F2LAI2_BURGS/58-154         AC F2LAI2.1
#=GS A0A495JCM5_9ACTN/61-163     AC A0A495JCM5.1
#=GS A0A494XIP1_9BURK/54-151     AC A0A494XIP1.1
#=GS A0A383V9I3_TETOB/3-59       AC A0A383V9I3.1
#=GS R5PVV2_9BACT/170-252        AC R5PVV2.1
#=GS A0A0D3C9W7_BRAOL/169-278    AC A0A0D3C9W7.1
#=GS A0A0Q9W8R8_DROVI/46-140     AC A0A0Q9W8R8.1
#=GS R5QTR3_9FIRM/254-345        AC R5QTR3.1
#=GS A0A1E5PIL3_9ACTN/62-170     AC A0A1E5PIL3.1
#=GS H6RSK7_BLASD/41-132         AC H6RSK7.1
#=GS K7LFF4_SOYBN/222-324        AC K7LFF4.1
#=GS A0A2G7EY22_9ACTN/74-179     AC A0A2G7EY22.1
#=GS A0A1U8Q0B2_NELNU/1-75       AC A0A1U8Q0B2.1
#=GS A0A1Y1VL52_9FUNG/131-223    AC A0A1Y1VL52.1
#=GS A0A0U4BKE5_9ACTN/37-131     AC A0A0U4BKE5.1
#=GS B9RWG8_RICCO/70-182         AC B9RWG8.1
#=GS A0A173MK64_9BACT/35-112     AC A0A173MK64.1
#=GS A0A2G3CFK1_CAPCH/144-247    AC A0A2G3CFK1.1
#=GS D8TBS5_SELML/63-154         AC D8TBS5.1
#=GS A0A1M6QCU0_9BACT/138-230    AC A0A1M6QCU0.1
#=GS W1P0V8_AMBTC/53-144         AC W1P0V8.1
#=GS A0A067GU53_CITSI/1-89       AC A0A067GU53.1
#=GS Q8NLL9_CORGL/56-164         AC Q8NLL9.1
#=GS A0A2H3Y6F1_PHODC/63-154     AC A0A2H3Y6F1.1
#=GS A0A1G8N9K8_9FLAO/18-109     AC A0A1G8N9K8.1
#=GS G3XWT2_ASPNA/33-122         AC G3XWT2.1
#=GS A0A3B6TE59_WHEAT/116-226    AC A0A3B6TE59.1
#=GS A0A367K7Z2_RHIST/789-890    AC A0A367K7Z2.1
#=GS A0A2H3YQT8_PHODC/182-290    AC A0A2H3YQT8.1
#=GS A0A3N4YME3_9MICO/50-137     AC A0A3N4YME3.1
#=GS S0E9N1_GIBF5/69-173         AC S0E9N1.1
#=GS A0A3R5UC36_9CLOT/1-82       AC A0A3R5UC36.1
#=GS R6XXU9_9BACT/28-116         AC R6XXU9.1
#=GS A0A151TC63_CAJCA/38-129     AC A0A151TC63.1
#=GS A0A2N1F582_9FLAO/21-112     AC A0A2N1F582.1
#=GS A0A1H6REL4_9BACT/39-135     AC A0A1H6REL4.1
#=GS A0A1V8U768_9PEZI/29-116     AC A0A1V8U768.1
#=GS A2SS91_METLZ/29-102         AC A2SS91.1
#=GS A0A1S3PAW9_SALSA/45-139     AC A0A1S3PAW9.1
#=GS A0A118K3N3_CYNCS/912-1011   AC A0A118K3N3.1
#=GS A0A094JLR1_9PEZI/70-174     AC A0A094JLR1.1
#=GS A0A2B4S6W9_STYPI/699-801    AC A0A2B4S6W9.1
#=GS A0A0D2V971_GOSRA/216-319    AC A0A0D2V971.1
#=GS A0A2K3NGK9_TRIPR/183-291    AC A0A2K3NGK9.1
#=GS A0A1Y1UUC0_9TREE/68-170     AC A0A1Y1UUC0.1
#=GS A0A0Q4RQN1_9BACL/47-151     AC A0A0Q4RQN1.1
#=GS A0A0G3HIE4_9CORY/164-240    AC A0A0G3HIE4.1
#=GS A0A2P8PUW9_9ACTN/89-194     AC A0A2P8PUW9.1
#=GS A0A445ATN1_ARAHY/185-293    AC A0A445ATN1.1
#=GS A0A1M5FMW8_9BACT/254-333    AC A0A1M5FMW8.1
#=GS A0A2A2LRS7_9BILA/24-111     AC A0A2A2LRS7.1
#=GS A0A1V1P1R7_9DELT/403-487    AC A0A1V1P1R7.1
#=GS R0I2P0_9BRAS/169-277        AC R0I2P0.1
#=GS B9RAG4_RICCO/179-283        AC B9RAG4.1
#=GS A0A090ZBS0_PAEMA/1076-1175  AC A0A090ZBS0.1
#=GS A0A3L6PRQ4_PANMI/79-196     AC A0A3L6PRQ4.1
#=GS A0A3B6LR82_WHEAT/63-177     AC A0A3B6LR82.1
#=GS A0A0L0DJB6_THETB/136-226    AC A0A0L0DJB6.1
#=GS A0A2P5E279_PARAD/156-259    AC A0A2P5E279.1
#=GS A0A0M8WP95_9NOCA/59-170     AC A0A0M8WP95.1
#=GS A0A1S3WZJ1_TOBAC/171-279    AC A0A1S3WZJ1.1
#=GS A0A0N9IFP6_9PSEU/61-160     AC A0A0N9IFP6.1
#=GS W4EQL2_9BACL/37-134         AC W4EQL2.1
#=GS A0A345C3X6_9RHOB/36-134     AC A0A345C3X6.1
#=GS A0A3Q2DAN3_CYPVA/52-145     AC A0A3Q2DAN3.1
#=GS A0A1R3RHA7_ASPC5/69-172     AC A0A1R3RHA7.1
#=GS A0A067EKZ0_CITSI/78-161     AC A0A067EKZ0.1
#=GS A0A2J6SBI2_9HELO/73-175     AC A0A2J6SBI2.1
#=GS A0A2H5N9J4_CITUN/736-838    AC A0A2H5N9J4.1
#=GS A0A2S6NC74_9RHIZ/67-160     AC A0A2S6NC74.1
#=GS U5C288_9BACT/40-145         AC U5C288.1
#=GS A0A1M5XDN4_9FIRM/34-128     AC A0A1M5XDN4.1
#=GS A0A287RV48_HORVV/165-273    AC A0A287RV48.1
#=GS A0A168F9L9_CORDF/34-121     AC A0A168F9L9.1
#=GS A0A1B8WM57_9BACI/362-468    AC A0A1B8WM57.1
#=GS A0A287RV25_HORVV/86-195     AC A0A287RV25.1
#=GS A0A0E0MCI8_ORYPU/57-144     AC A0A0E0MCI8.1
#=GS A0A1S3CHA0_CUCME/58-145     AC A0A1S3CHA0.1
#=GS A0A1U8B5A8_NELNU/69-157     AC A0A1U8B5A8.1
#=GS A0A061PEK4_9BACL/253-338    AC A0A061PEK4.1
#=GS A0A2H5NVQ5_CITUN/763-868    AC A0A2H5NVQ5.1
#=GS A0A3L8KDZ6_9ACTN/56-149     AC A0A3L8KDZ6.1
#=GS A0A061FD44_THECC/45-135     AC A0A061FD44.1
#=GS V4WFY4_9ROSI/43-130         AC V4WFY4.1
#=GS A0A3M8GFX6_9FLAO/41-144     AC A0A3M8GFX6.1
#=GS A0A194X9K6_9HELO/34-121     AC A0A194X9K6.1
#=GS A0A094B561_9PEZI/34-124     AC A0A094B561.1
#=GS A0A0Q5NPG9_9BURK/52-149     AC A0A0Q5NPG9.1
#=GS A0A0W8DPN0_PHYNI/67-164     AC A0A0W8DPN0.1
#=GS A0A416A6N0_9BACT/269-364    AC A0A416A6N0.1
#=GS F1MUZ7_BOVIN/32-125         AC F1MUZ7.3
#=GS A0A287PTV9_HORVV/16-108     AC A0A287PTV9.1
#=GS D7MHC1_ARALL/54-165         AC D7MHC1.1
#=GS A0A3D9KIU9_9BACL/757-867    AC A0A3D9KIU9.1
#=GS A0A0E0BVP7_9ORYZ/58-152     AC A0A0E0BVP7.1
#=GS A0A2W2J4R5_9ACTN/702-796    AC A0A2W2J4R5.1
#=GS A0A287PHB3_HORVV/124-232    AC A0A287PHB3.1
#=GS A0A251MYC2_PRUPE/1-76       AC A0A251MYC2.1
#=GS A0A261Q4G1_9BACT/39-135     AC A0A261Q4G1.1
#=GS A0A0B9AEW7_BRELN/78-174     AC A0A0B9AEW7.1
#=GS PPA5_ARATH/15-109           AC Q9C927.1
#=GS A0A1G9MTP9_9BACT/220-314    AC A0A1G9MTP9.1
#=GS A0A316DYZ6_9FLAO/43-120     AC A0A316DYZ6.1
#=GS M4B892_HYAAE/179-284        AC M4B892.1
#=GS A0A2P5EZM9_TREOI/61-152     AC A0A2P5EZM9.1
#=GS V6JFX1_STRRC/27-120         AC V6JFX1.1
#=GS A0A423WUK4_9PEZI/67-170     AC A0A423WUK4.1
#=GS A0A0L1J6D3_ASPNO/34-123     AC A0A0L1J6D3.1
#=GS A0A2J6KPZ2_LACSA/71-158     AC A0A2J6KPZ2.1
#=GS A0A0Q9X3T9_DROWI/3-94       AC A0A0Q9X3T9.1
#=GS A0A383V3E1_TETOB/35-161     AC A0A383V3E1.1
#=GS A0A2P6NUS3_9MYCE/132-223    AC A0A2P6NUS3.1
#=GS A0A3B0C3V6_9FLAO/29-113     AC A0A3B0C3V6.1
#=GS A0A0P1AE76_PLAHL/252-357    AC A0A0P1AE76.1
#=GS A0A3E2GVU8_SCYLI/34-121     AC A0A3E2GVU8.1
#=GS A0A267DHI5_9PLAT/78-175     AC A0A267DHI5.1
#=GS A0A443PRL1_9MAGN/47-134     AC A0A443PRL1.1
#=GS A0A2H5N0Q8_CITUN/101-188    AC A0A2H5N0Q8.1
#=GS A0A0X8FB41_9LACT/104-260    AC A0A0X8FB41.1
#=GS A0A0S3RZ39_PHAAN/46-134     AC A0A0S3RZ39.1
#=GS A0A0S3R6Z5_PHAAN/62-153     AC A0A0S3R6Z5.1
#=GS A0A2J6S554_9HELO/34-120     AC A0A2J6S554.1
#=GS F1RI33_PIG/31-124           AC F1RI33.3
#=GS A0A2A2L3K3_9BILA/838-932    AC A0A2A2L3K3.1
#=GS A0A0E0GWH7_ORYNI/63-176     AC A0A0E0GWH7.1
#=GS A0A1W1Y2N7_9LACT/129-271    AC A0A1W1Y2N7.1
#=GS A0A210QAC0_MIZYE/27-124     AC A0A210QAC0.1
#=GS A0A1S1NEM5_9MYCO/51-144     AC A0A1S1NEM5.1
#=GS A0A093V601_TALMA/35-122     AC A0A093V601.1
#=GS A0A1B6PIN9_SORBI/219-337    AC A0A1B6PIN9.1
#=GS A0A133UZ61_9EURY/1-95       AC A0A133UZ61.1
#=GS A0A0N5AGB1_9BILA/56-147     AC A0A0N5AGB1.1
#=GS A0A3A9BI89_9CLOT/80-174     AC A0A3A9BI89.1
#=GS A0A3R7H1T9_9STRA/205-310    AC A0A3R7H1T9.1
#=GS A0A2I4ENW4_JUGRE/178-286    AC A0A2I4ENW4.1
#=GS K7W3V6_MAIZE/218-321        AC K7W3V6.1
#=GS D7MQ73_ARALL/172-280        AC D7MQ73.1
#=GS A0A1X2G9J8_9FUNG/34-137     AC A0A1X2G9J8.1
#=GS K3YGM1_SETIT/147-252        AC K3YGM1.1
#=GS A0A2I4G9X6_JUGRE/90-202     AC A0A2I4G9X6.1
#=GS A0A2T7NW89_POMCA/473-547    AC A0A2T7NW89.1
#=GS A0A0A2VA75_BEABA/73-174     AC A0A0A2VA75.1
#=GS A0A0D0PME8_KITGR/78-183     AC A0A0D0PME8.1
#=GS A0A3B6KEZ2_WHEAT/84-203     AC A0A3B6KEZ2.1
#=GS A0A199W016_ANACO/65-177     AC A0A199W016.1
#=GS A0A172TGR6_9BACL/1073-1172  AC A0A172TGR6.1
#=GS A0A3A1P5V0_9SPHN/37-137     AC A0A3A1P5V0.1
#=GS A0A182XVY1_ANOST/48-139     AC A0A182XVY1.1
#=GS A0A0W8BZI5_PHYNI/174-279    AC A0A0W8BZI5.1
#=GS A0A3R7FW87_9STRA/12-100     AC A0A3R7FW87.1
#=GS A0A022QZB7_ERYGU/70-182     AC A0A022QZB7.1
#=GS A0A2H3IBJ4_9EURO/374-461    AC A0A2H3IBJ4.1
#=GS R6NJZ3_9CLOT/14-104         AC R6NJZ3.1
#=GS A0A250VBY8_STROL/78-183     AC A0A250VBY8.1
#=GS A0A3Q7IRE3_SOLLC/64-172     AC A0A3Q7IRE3.1
#=GS A0A498J4G7_MALDO/79-169     AC A0A498J4G7.1
#=GS A0A0D3HX61_9ORYZ/75-166     AC A0A0D3HX61.1
#=GS A0A1Q5KZX5_9ACTN/73-178     AC A0A1Q5KZX5.1
#=GS A0A3M6TZE2_9CNID/178-280    AC A0A3M6TZE2.1
#=GS A0A3M0I1P6_9ACTN/46-141     AC A0A3M0I1P6.1
#=GS A0A1F5L468_9EURO/32-119     AC A0A1F5L468.1
#=GS R7ZWF4_9BACT/30-115         AC R7ZWF4.1
#=GS A0A2M9E6P3_9GAMM/39-135     AC A0A2M9E6P3.1
#=GS A0A1R3HXZ2_9ROSI/60-151     AC A0A1R3HXZ2.1
#=GS A0A368S3S4_SETIT/60-147     AC A0A368S3S4.1
#=GS Q6ZCX8_ORYSJ/78-204         AC Q6ZCX8.1
#=GS F5LDQ1_9BACL/1072-1171      AC F5LDQ1.1
#=GS A0A0Q3NBW7_BRADI/97-185     AC A0A0Q3NBW7.1
#=GS A0A2T7E568_9POAL/143-231    AC A0A2T7E568.1
#=GS A0A0S6WWM9_9SPHN/52-149     AC A0A0S6WWM9.1
#=GS A0A1H1STT7_9ACTN/34-129     AC A0A1H1STT7.1
#=GS B4JMN8_DROGR/1-89           AC B4JMN8.1
#=GS A0A1V9KG16_9ACTN/91-196     AC A0A1V9KG16.1
#=GS A0A3T1CZS4_9BACL/43-149     AC A0A3T1CZS4.1
#=GS A0A443PZD1_9MAGN/612-723    AC A0A443PZD1.1
#=GS A0A287WJQ5_HORVV/121-235    AC A0A287WJQ5.1
#=GS A0A453JWS0_AEGTS/82-190     AC A0A453JWS0.1
#=GS A0A1M7M483_9BACT/33-120     AC A0A1M7M483.1
#=GS A0A3T1CZS4_9BACL/494-597    AC A0A3T1CZS4.1
#=GS A0A1S4CU51_TOBAC/168-276    AC A0A1S4CU51.1
#=GS M5VLZ4_PRUPE/62-152         AC M5VLZ4.1
#=GS A0A2T4C010_TRILO/17-107     AC A0A2T4C010.1
#=GS A0A0K0FUN1_STRVS/28-125     AC A0A0K0FUN1.1
#=GS A0A453QNX9_AEGTS/112-225    AC A0A453QNX9.1
#=GS A0A1V9Z2Q4_9STRA/126-232    AC A0A1V9Z2Q4.1
#=GS A0A445J544_GLYSO/54-145     AC A0A445J544.1
#=GS A0A2A3HTH2_9ACTN/76-181     AC A0A2A3HTH2.1
#=GS A0A0L9TCH7_PHAAN/175-283    AC A0A0L9TCH7.1
#=GS K7K7T9_SOYBN/169-277        AC K7K7T9.1
#=GS A0A445DK90_ARAHY/77-189     AC A0A445DK90.1
#=GS D7AYU5_NOCDD/64-170         AC D7AYU5.1
#=GS A0A0E0FEP4_9ORYZ/17-108     AC A0A0E0FEP4.1
#=GS I1R941_ORYGL/164-272        AC I1R941.1
#=GS A0A2X4VNE5_BACLE/512-612    AC A0A2X4VNE5.1
#=GS A0A059CKY8_EUCGR/55-146     AC A0A059CKY8.1
#=GS A0A1V6N668_9EURO/33-120     AC A0A1V6N668.1
#=GS A0A396S724_9BACI/30-127     AC A0A396S724.1
#=GS A0A067DKE7_CITSI/10-91      AC A0A067DKE7.1
#=GS H3H2W3_PHYRM/67-164         AC H3H2W3.1
#=GS A0A2G8K0A7_STIJA/18-109     AC A0A2G8K0A7.1
#=GS A0A1H6ZCA9_9FIRM/65-155     AC A0A1H6ZCA9.1
#=GS H3GCK3_PHYRM/189-294        AC H3GCK3.1
#=GS A0A0L9UVB3_PHAAN/49-141     AC A0A0L9UVB3.1
#=GS A0A067DW31_CITSI/86-198     AC A0A067DW31.1
#=GS K1PZ22_CRAGI/27-124         AC K1PZ22.1
#=GS A0A397YP21_BRACM/54-148     AC A0A397YP21.1
#=GS F7W6U3_SORMK/29-101         AC F7W6U3.1
#=GS A0A0D9XPN9_9ORYZ/81-169     AC A0A0D9XPN9.1
#=GS A0A2G2XQL8_CAPBA/219-321    AC A0A2G2XQL8.1
#=GS A0A0B2WR91_METAS/43-132     AC A0A0B2WR91.1
#=GS A0A158R0D5_NIPBR/368-453    AC A0A158R0D5.1
#=GS A0A1A3Q2R2_9MYCO/65-158     AC A0A1A3Q2R2.1
#=GS A0A401L6U3_ASPAW/70-173     AC A0A401L6U3.1
#=GS J2JKU9_9FLAO/22-109         AC J2JKU9.1
#=GS A0A1T5P9E0_9BACT/33-129     AC A0A1T5P9E0.1
#=GS A0A225EEJ2_9BACT/44-148     AC A0A225EEJ2.1
#=GS A0A0B7NQ03_9FUNG/57-156     AC A0A0B7NQ03.1
#=GS A0A2H5NR22_CITUN/54-145     AC A0A2H5NR22.1
#=GS A0A094CHX2_9PEZI/37-128     AC A0A094CHX2.1
#=GS A0A1R3INE3_COCAP/170-278    AC A0A1R3INE3.1
#=GS A0A445LMN8_GLYSO/169-277    AC A0A445LMN8.1
#=GS U2UWR0_9FIRM/12-97          AC U2UWR0.1
#=GS E1Z2T8_CHLVA/30-145         AC E1Z2T8.1
#=GS A0A2U1B457_9FIRM/39-125     AC A0A2U1B457.1
#=GS B2RRA7_MOUSE/90-183         AC B2RRA7.1
#=GS A0A0E0F2M8_9ORYZ/55-142     AC A0A0E0F2M8.1
#=GS D7TS77_VITVI/55-166         AC D7TS77.1
#=GS D0MY72_PHYIT/195-301        AC D0MY72.1
#=GS E3MEM2_CAERE/22-117         AC E3MEM2.1
#=GS A0A267FRF6_9PLAT/56-151     AC A0A267FRF6.1
#=GS A0A2H9ZW69_9ASPA/45-132     AC A0A2H9ZW69.1
#=GS A0A445LMU9_GLYSO/55-163     AC A0A445LMU9.1
#=GS A0A094G2D6_9PEZI/70-174     AC A0A094G2D6.1
#=GS M8AT23_TRIUA/1-81           AC M8AT23.1
#=GS A0A2M9C501_9MICO/54-150     AC A0A2M9C501.1
#=GS B7RVD6_9GAMM/47-133         AC B7RVD6.1
#=GS A0A0D2VG39_GOSRA/47-139     AC A0A0D2VG39.1
#=GS A0A453D6R1_AEGTS/144-235    AC A0A453D6R1.1
#=GS R7DJF1_9BACT/613-696        AC R7DJF1.1
#=GS A0A453J697_AEGTS/111-219    AC A0A453J697.1
#=GS A0A0C9Y4A6_9AGAR/54-144     AC A0A0C9Y4A6.1
#=GS A0A2S5BAQ8_9BASI/86-189     AC A0A2S5BAQ8.1
#=GS L8GV66_ACACA/1-82           AC L8GV66.1
#=GS J3NBE7_ORYBR/49-136         AC J3NBE7.1
#=GS A0A078IGA5_BRANA/66-157     AC A0A078IGA5.1
#=GS A0A2R9AF65_PANPA/32-125     AC A0A2R9AF65.1
#=GS C6D1I1_PAESJ/45-147         AC C6D1I1.1
#=GS A0A368JNH9_9BACT/51-149     AC A0A368JNH9.1
#=GS A0A0R0EIB5_SOYBN/30-114     AC A0A0R0EIB5.1
#=GS A0A394DC54_LUPAN/55-146     AC A0A394DC54.1
#=GS D8SF22_SELML/1-86           AC D8SF22.1
#=GS A0A2S9BQI3_9MICO/58-155     AC A0A2S9BQI3.1
#=GS A0A251SI94_HELAN/45-132     AC A0A251SI94.1
#=GS A0A2K1IJN5_PHYPA/74-185     AC A0A2K1IJN5.1
#=GS F3B8P0_9FIRM/71-165         AC F3B8P0.1
#=GS G7JA60_MEDTR/71-183         AC G7JA60.1
#=GS R7ZW56_9BACT/32-118         AC R7ZW56.1
#=GS A0A1C4R0E1_9ACTN/81-187     AC A0A1C4R0E1.1
#=GS A0A2P6NBI5_9MYCE/157-261    AC A0A2P6NBI5.1
#=GS A0A373VTS0_9FIRM/55-149     AC A0A373VTS0.1
#=GS A0A3S3Z1Z9_9MICO/61-157     AC A0A3S3Z1Z9.1
#=GS A0A3T0ECJ1_9RHOB/241-340    AC A0A3T0ECJ1.1
#=GS A0A239U3E5_9FIRM/69-161     AC A0A239U3E5.1
#=GS F0ZXR4_DICPU/24-120         AC F0ZXR4.1
#=GS A0A2T3YWY0_9HYPO/106-209    AC A0A2T3YWY0.1
#=GS A0A0K8QWF9_9BACT/26-127     AC A0A0K8QWF9.1
#=GS A0A2Z3H3R0_9BACT/52-140     AC A0A2Z3H3R0.1
#=GS A0A2P6C1B3_9BACT/57-158     AC A0A2P6C1B3.1
#=GS A0A1L6KZ47_9DELT/97-198     AC A0A1L6KZ47.1
#=GS A0A2K1WUT0_POPTR/63-154     AC A0A2K1WUT0.1
#=GS Q7MX70_PORGI/75-170         AC Q7MX70.1
#=GS A0A0E0E8Q2_9ORYZ/184-292    AC A0A0E0E8Q2.1
#=GS A0A453K9U4_AEGTS/204-291    AC A0A453K9U4.1
#=GS A0A117P2Q3_9ACTN/56-154     AC A0A117P2Q3.1
#=GS A0A1R1DBL8_9BACL/605-711    AC A0A1R1DBL8.1
#=GS A0A0J6WX90_9FIRM/55-145     AC A0A0J6WX90.1
#=GS D8LBI4_ECTSI/69-169         AC D8LBI4.1
#=GS R7CP86_9FIRM/44-135         AC R7CP86.1
#=GS A0A3B6H087_WHEAT/59-150     AC A0A3B6H087.1
#=GS R7ZV11_9BACT/32-119         AC R7ZV11.1
#=GS A0A2V2Z0G4_9BACL/54-152     AC A0A2V2Z0G4.1
#=GS A0A2P6NT51_9MYCE/217-321    AC A0A2P6NT51.1
#=GS H3GZF8_PHYRM/102-200        AC H3GZF8.1
#=GS A0A142XDF5_9BACT/46-134     AC A0A142XDF5.1
#=GS A0A1S1QPD6_9ACTN/51-147     AC A0A1S1QPD6.1
#=GS A0A1D6QMD0_MAIZE/30-117     AC A0A1D6QMD0.1
#=GS A0A3N7HAJ1_POPTR/14-104     AC A0A3N7HAJ1.1
#=GS A0A0D2VEF6_GOSRA/47-139     AC A0A0D2VEF6.1
#=GS Q54NC3_DICDI/33-134         AC Q54NC3.1
#=GS A0A2U1ZWU5_9MICO/984-1082   AC A0A2U1ZWU5.1
#=GS A0A3D8S0U9_9HELO/29-120     AC A0A3D8S0U9.1
#=GS A0A0B8PKW6_9VIBR/48-131     AC A0A0B8PKW6.1
#=GS A0A1G6QKW6_9BURK/54-151     AC A0A1G6QKW6.1
#=GS A0A0E0I9M9_ORYNI/78-204     AC A0A0E0I9M9.1
#=GS A0A0D2Y395_FUSO4/69-173     AC A0A0D2Y395.1
#=GS A0A1I6HYQ9_9FIRM/60-149     AC A0A1I6HYQ9.1
#=GS A0A0D3DLM4_BRAOL/77-188     AC A0A0D3DLM4.1
#=GS A0A3B6LJK3_WHEAT/85-203     AC A0A3B6LJK3.1
#=GS I1Q7H7_ORYGL/142-247        AC I1Q7H7.1
#=GS A0A287PYX1_HORVV/155-263    AC A0A287PYX1.1
#=GS A0A319CDJ9_9EURO/33-120     AC A0A319CDJ9.1
#=GS W2EQ43_9ACTN/31-124         AC W2EQ43.1
#=GS A0A0D9WUR1_9ORYZ/146-252    AC A0A0D9WUR1.1
#=GS A0A261CC48_9PELO/20-105     AC A0A261CC48.1
#=GS M4EIB9_BRARP/49-136         AC M4EIB9.1
#=GS K4IFM9_PSYTT/23-114         AC K4IFM9.1
#=GS A0A2H3Y3T7_PHODC/72-184     AC A0A2H3Y3T7.1
#=GS W9WZU9_9EURO/27-101         AC W9WZU9.1
#=GS A0A2I4F3K9_JUGRE/176-284    AC A0A2I4F3K9.1
#=GS A0A1V6SVC3_9EURO/67-171     AC A0A1V6SVC3.1
#=GS D0MXF2_PHYIT/62-159         AC D0MXF2.1
#=GS T1PFT1_MUSDO/33-128         AC T1PFT1.1
#=GS A0A3P8UCZ8_CYNSE/27-120     AC A0A3P8UCZ8.1
#=GS A0A2H2ZEH0_9HYPO/23-113     AC A0A2H2ZEH0.1
#=GS I0Z0Q6_COCSC/156-263        AC I0Z0Q6.1
#=GS A0A1Y1CEQ7_9BACT/28-125     AC A0A1Y1CEQ7.1
#=GS A0A1H9UGS0_9CORY/75-231     AC A0A1H9UGS0.1
#=GS A0A445H0H7_GLYSO/22-112     AC A0A445H0H7.1
#=GS Q8YKC4_NOSS1/42-157         AC Q8YKC4.1
#=GS A0A0D9W4M1_9ORYZ/76-164     AC A0A0D9W4M1.1
#=GS A0A444X8H4_ARAHY/83-194     AC A0A444X8H4.1
#=GS A0A0E0ITS2_ORYNI/142-247    AC A0A0E0ITS2.1
#=GS A0A225VE16_9STRA/59-158     AC A0A225VE16.1
#=GS A0A0M2VDF7_9GAMM/23-119     AC A0A0M2VDF7.1
#=GS A0A314KU94_NICAT/168-276    AC A0A314KU94.1
#=GS A0A1Y1VL49_9FUNG/92-183     AC A0A1Y1VL49.1
#=GS A0A2H3ZE35_PHODC/50-137     AC A0A2H3ZE35.1
#=GS A0A287R025_HORVV/107-225    AC A0A287R025.1
#=GS A0A154P6J4_DUFNO/26-117     AC A0A154P6J4.1
#=GS A0A059BQK3_EUCGR/61-152     AC A0A059BQK3.1
#=GS A0A1I0YZW5_9FIRM/1120-1215  AC A0A1I0YZW5.1
#=GS A0A0K0EPS5_STRER/28-121     AC A0A0K0EPS5.1
#=GS D7SGY6_VITVI/176-284        AC D7SGY6.1
#=GS A0A453K9Y4_AEGTS/7-96       AC A0A453K9Y4.1
#=GS A0A199V7T4_ANACO/1-110      AC A0A199V7T4.1
#=GS M3VZV2_FELCA/32-125         AC M3VZV2.3
#=GS R0I977_9BRAS/50-147         AC R0I977.1
#=GS C0HHY2_MAIZE/190-298        AC C0HHY2.1
#=GS A0A2I0I3Q2_PUNGR/71-162     AC A0A2I0I3Q2.1
#=GS A0A1W2C1G0_9FLAO/23-110     AC A0A1W2C1G0.1
#=GS A0A069DEB4_9BACL/36-135     AC A0A069DEB4.1
#=GS B8B909_ORYSI/78-204         AC B8B909.1
#=GS A0A2S9ACW7_9MICO/650-761    AC A0A2S9ACW7.1
#=GS A0A329T0M3_9STRA/201-306    AC A0A329T0M3.1
#=GS B9SXP8_RICCO/55-104         AC B9SXP8.1
#=GS A0A0F5JSN4_9BACT/269-364    AC A0A0F5JSN4.1
#=GS A0A2G2VKZ8_CAPBA/684-792    AC A0A2G2VKZ8.1
#=GS A0A2G9HK09_9LAMI/69-181     AC A0A2G9HK09.1
#=GS A0A3S3QBC4_9ACAR/1-78       AC A0A3S3QBC4.1
#=GS A0A061EL35_THECC/68-179     AC A0A061EL35.1
#=GS A0A0Q8FBR5_9GAMM/46-141     AC A0A0Q8FBR5.1
#=GS A0A3L6SZ83_PANMI/17-108     AC A0A3L6SZ83.1
#=GS A0A0M5J102_DROBS/38-141     AC A0A0M5J102.1
#=GS A0A1Y2E5M8_9FUNG/96-187     AC A0A1Y2E5M8.1
#=GS B9RCW2_RICCO/141-244        AC B9RCW2.1
#=GS A0A2I0JMQ4_PUNGR/75-159     AC A0A2I0JMQ4.1
#=GS A0A0C3FKP0_9AGAM/46-137     AC A0A0C3FKP0.1
#=GS A0A427XSS4_9TREE/43-136     AC A0A427XSS4.1
#=GS G4ZZW8_PHYSP/91-189         AC G4ZZW8.1
#=GS B8BDB2_ORYSI/186-294        AC B8BDB2.1
#=GS C6VYH5_DYAFD/27-107         AC C6VYH5.1
#=GS B9SAE7_RICCO/42-138         AC B9SAE7.1
#=GS I3LZ30_ICTTR/36-129         AC I3LZ30.2
#=GS E2SCW0_9ACTN/41-133         AC E2SCW0.1
#=GS M5XVP8_PRUPE/168-275        AC M5XVP8.1
#=GS W2TWF9_NECAM/40-134         AC W2TWF9.1
#=GS A0A0D3EV42_9ORYZ/206-309    AC A0A0D3EV42.1
#=GS G7JLE0_MEDTR/184-292        AC G7JLE0.1
#=GS A0A1Q2HV25_9CORY/57-162     AC A0A1Q2HV25.1
#=GS A0A1V9KA87_9ACTN/81-186     AC A0A1V9KA87.1
#=GS A0A2D0NGY0_9BACT/28-119     AC A0A2D0NGY0.1
#=GS A0A0X3SJJ6_9ACTN/79-196     AC A0A0X3SJJ6.1
#=GS A0A4D9C3U9_SALSN/53-144     AC A0A4D9C3U9.1
#=GS A0A453QNY1_AEGTS/1-100      AC A0A453QNY1.1
#=GS R6J9M3_9FIRM/42-133         AC R6J9M3.1
#=GS A0A1X7RD85_ZYMTR/29-116     AC A0A1X7RD85.1
#=GS A0A067FR60_CITSI/76-188     AC A0A067FR60.1
#=GS PPA25_ARATH/51-147          AC O23244.2
#=GS A0A388KS19_CHABU/153-243    AC A0A388KS19.1
#=GS A0A3B6FRH1_WHEAT/209-312    AC A0A3B6FRH1.1
#=GS A0A3L6QVI3_PANMI/149-254    AC A0A3L6QVI3.1
#=GS M0SU42_MUSAM/169-277        AC M0SU42.1
#=GS A0A3B6KQ30_WHEAT/58-149     AC A0A3B6KQ30.1
#=GS A0A075K9Z9_9FIRM/35-127     AC A0A075K9Z9.1
#=GS A0A1H0CNA9_9BACI/1081-1168  AC A0A1H0CNA9.1
#=GS A0A124SEJ3_CYNCS/56-192     AC A0A124SEJ3.1
#=GS H3ES52_PRIPA/43-133         AC H3ES52.2
#=GS A0A444ZV18_ARAHY/172-280    AC A0A444ZV18.1
#=GS A0A1M7JZH6_9BACT/204-287    AC A0A1M7JZH6.1
#=GS A0A397G7N3_9EURO/34-121     AC A0A397G7N3.1
#=GS A0A140LHD2_MOUSE/32-125     AC A0A140LHD2.1
#=GS A0A059DFE2_EUCGR/57-144     AC A0A059DFE2.1
#=GS A0A287LTH4_HORVV/3-106      AC A0A287LTH4.1
#=GS A0A433THY9_ELYCH/41-132     AC A0A433THY9.1
#=GS A0A2J6TAT1_9HELO/73-175     AC A0A2J6TAT1.1
#=GS M5XDE4_PRUPE/58-150         AC M5XDE4.1
#=GS I1HSI5_BRADI/205-308        AC I1HSI5.1
#=GS Q1NEE5_SPHSS/41-138         AC Q1NEE5.1
#=GS A0A2U1NI82_ARTAN/190-298    AC A0A2U1NI82.1
#=GS A0A374AA48_9BACT/29-127     AC A0A374AA48.1
#=GS Q54TC4_DICDI/142-245        AC Q54TC4.1
#=GS G0IVE7_CYCMS/28-115         AC G0IVE7.1
#=GS A0A2T3AQB8_AMORE/69-173     AC A0A2T3AQB8.1
#=GS A0A0B4D6D4_9FLAO/363-454    AC A0A0B4D6D4.1
#=GS A0A2J7QLU3_9NEOP/23-114     AC A0A2J7QLU3.1
#=GS A0A287S1Q6_HORVV/68-181     AC A0A287S1Q6.1
#=GS A0A0L0N9Q0_9HYPO/34-122     AC A0A0L0N9Q0.1
#=GS A0A1Q5KV71_9ACTN/76-181     AC A0A1Q5KV71.1
#=GS C5C578_BEUC1/37-148         AC C5C578.1
#=GS A0A242K391_9ENTE/438-545    AC A0A242K391.1
#=GS A0A1G8IP33_9MICC/44-160     AC A0A1G8IP33.1
#=GS M0W8X3_HORVV/5-92           AC M0W8X3.1
#=GS A0A1I1XSV9_9BACT/28-110     AC A0A1I1XSV9.1
#=GS A0A3P8UCZ3_CYNSE/27-120     AC A0A3P8UCZ3.1
#=GS A0A0K8JGT4_9FIRM/59-155     AC A0A0K8JGT4.1
#=GS M1W0K6_CLAP2/34-130         AC M1W0K6.1
#=GS A0A1H6UK83_9FIRM/42-135     AC A0A1H6UK83.1
#=GS A0A0D3DSL6_BRAOL/43-132     AC A0A0D3DSL6.1
#=GS A0A1S9MHS7_9MICC/58-151     AC A0A1S9MHS7.1
#=GS A0A2R4T8K2_9ACTN/70-175     AC A0A2R4T8K2.1
#=GS A0A1B8U061_9FLAO/24-110     AC A0A1B8U061.1
#=GS A0A318ABZ5_9MICC/240-332    AC A0A318ABZ5.1
#=GS A0A3E0HGT0_9PSEU/51-144     AC A0A3E0HGT0.1
#=GS A0A399VH40_9ACTN/1507-1612  AC A0A399VH40.1
#=GS M4D9A9_BRARP/57-148         AC M4D9A9.1
#=GS A0A0A0KH55_CUCSA/52-145     AC A0A0A0KH55.1
#=GS A0A1J6KXU9_NICAT/61-152     AC A0A1J6KXU9.1
#=GS A0A2P7TR28_9SPHI/24-108     AC A0A2P7TR28.1
#=GS A0A2T7NW83_POMCA/2-62       AC A0A2T7NW83.1
#=GS A0A199UAL7_MANES/49-136     AC A0A199UAL7.1
#=GS A0A445HBX7_GLYSO/67-190     AC A0A445HBX7.1
#=GS A0A133V6Q7_9EURY/67-172     AC A0A133V6Q7.1
#=GS A0A0D2S4L0_GOSRA/58-147     AC A0A0D2S4L0.1
#=GS R0F3I2_9BRAS/174-282        AC R0F3I2.1
#=GS A0A371E905_MUCPR/64-155     AC A0A371E905.1
#=GS A0A1G9VDR5_9FLAO/62-140     AC A0A1G9VDR5.1
#=GS A0A2P5B1U5_PARAD/62-153     AC A0A2P5B1U5.1
#=GS A0A2S7KNH1_9FLAO/20-111     AC A0A2S7KNH1.1
#=GS A0A2G3BP76_CAPCH/53-144     AC A0A2G3BP76.1
#=GS A0A1I9LLI7_ARATH/64-176     AC A0A1I9LLI7.1
#=GS A0A1Q8IN27_9BURK/57-155     AC A0A1Q8IN27.1
#=GS F6HF85_VITVI/144-247        AC F6HF85.1
#=GS K9TA43_9CYAN/44-128         AC K9TA43.1
#=GS L9KWS0_TUPCH/172-299        AC L9KWS0.1
#=GS D8RFJ9_SELML/163-271        AC D8RFJ9.1
#=GS A0A287SPT1_HORVV/6-97       AC A0A287SPT1.1
#=GS A0A0A0L9I1_CUCSA/65-176     AC A0A0A0L9I1.1
#=GS A0A2P5BT78_PARAD/17-94      AC A0A2P5BT78.1
#=GS A0A0D3AVP8_BRAOL/141-244    AC A0A0D3AVP8.1
#=GS A0A1N6UDA4_9ACTN/48-142     AC A0A1N6UDA4.1
#=GS A0A1U7R2R5_MESAU/32-125     AC A0A1U7R2R5.1
#=GS A0A1Y4DBJ5_9BACT/26-116     AC A0A1Y4DBJ5.1
#=GS A0A1H5C5F1_9ACTN/79-184     AC A0A1H5C5F1.1
#=GS A0A225AHY0_9EURO/73-177     AC A0A225AHY0.1
#=GS A0A453K9T9_AEGTS/1-76       AC A0A453K9T9.1
#=GS A0A453K9K7_AEGTS/108-196    AC A0A453K9K7.1
#=GS A0A0A6QC18_9BURK/57-153     AC A0A0A6QC18.1
#=GS R7LEQ5_9BACT/56-170         AC R7LEQ5.1
#=GS I1QQ84_ORYGL/186-294        AC I1QQ84.1
#=GS A0A067K2B4_JATCU/56-147     AC A0A067K2B4.1
#=GS A0A1R1SQM4_9ACTN/95-200     AC A0A1R1SQM4.1
#=GS A0A453D6U6_AEGTS/119-210    AC A0A453D6U6.1
#=GS A0A1H5PTX2_9ACTN/68-161     AC A0A1H5PTX2.1
#=GS A0A093YH40_9PEZI/36-127     AC A0A093YH40.1
#=GS A0A287PGZ4_HORVV/120-228    AC A0A287PGZ4.1
#=GS A0A0K9R6M9_SPIOL/42-129     AC A0A0K9R6M9.1
#=GS A0A3B6LHI6_WHEAT/167-275    AC A0A3B6LHI6.1
#=GS A0A0E0QTG6_ORYRU/175-283    AC A0A0E0QTG6.1
#=GS A0A3B5Y788_WHEAT/172-285    AC A0A3B5Y788.1
#=GS A0A452ZW16_AEGTS/245-358    AC A0A452ZW16.1
#=GS A0A314YUT1_PRUYE/62-153     AC A0A314YUT1.1
#=GS A0A1Q3CG30_CEPFO/146-251    AC A0A1Q3CG30.1
#=GS A0A1U8B721_NELNU/48-135     AC A0A1U8B721.1
#=GS A0A0B4HF46_METMF/35-123     AC A0A0B4HF46.1
#=GS Q54SB4_DICDI/25-121         AC Q54SB4.1
#=GS A0A3D9I0V4_9BACL/600-707    AC A0A3D9I0V4.1
#=GS A0A287KQH7_HORVV/25-146     AC A0A287KQH7.1
#=GS A0A1D6EDB6_MAIZE/168-276    AC A0A1D6EDB6.1
#=GS A0A287PHB7_HORVV/219-327    AC A0A287PHB7.1
#=GS M7SUS8_EUTLA/18-98          AC M7SUS8.1
#=GS A0A4D8YS20_SALSN/177-285    AC A0A4D8YS20.1
#=GS A0A2A2KYT7_9BILA/27-122     AC A0A2A2KYT7.1
#=GS A0A1D6KW39_MAIZE/68-155     AC A0A1D6KW39.1
#=GS A0A162YLN6_9FLAO/1490-1582  AC A0A162YLN6.1
#=GS E6U9D4_ETHHY/981-1082       AC E6U9D4.1
#=GS A0A0R1N352_9LACO/987-1088   AC A0A0R1N352.1
#=GS A0A317VSD3_9EURO/69-172     AC A0A317VSD3.1
#=GS A0A0K9NXK9_ZOSMR/62-153     AC A0A0K9NXK9.1
#=GS A0A1Q3CTN3_CEPFO/62-153     AC A0A1Q3CTN3.1
#=GS A0A399G386_9ACTN/45-133     AC A0A399G386.1
#=GS G9PC97_HYPAI/22-112         AC G9PC97.1
#=GS A0A2A2JJ91_9BILA/21-110     AC A0A2A2JJ91.1
#=GS A0A1B1MHY5_STRLN/78-183     AC A0A1B1MHY5.1
#=GS F4CA56_SPHS2/40-139         AC F4CA56.1
#=GS D7SNS9_VITVI/69-181         AC D7SNS9.1
#=GS A0A1V4IV59_9CLOT/61-151     AC A0A1V4IV59.1
#=GS A0A2W2DVJ1_9ACTN/57-159     AC A0A2W2DVJ1.1
#=GS A0A3N7BFE4_9BACT/397-477    AC A0A3N7BFE4.1
#=GS K3Y5Z1_SETIT/167-275        AC K3Y5Z1.1
#=GS E1ZD44_CHLVA/59-156         AC E1ZD44.1
#=GS A0A179HSH3_PURLI/24-117     AC A0A179HSH3.1
#=GS I1QQ83_ORYGL/213-324        AC I1QQ83.1
#=GS U2HC80_9SPHI/46-142         AC U2HC80.1
#=GS A0A0R0C3H8_9GAMM/38-133     AC A0A0R0C3H8.1
#=GS Q55F77_DICDI/79-179         AC Q55F77.1
#=GS A0A2G5TVQ6_9PELO/21-116     AC A0A2G5TVQ6.1
#=GS A0A0B4I6E1_METMF/26-116     AC A0A0B4I6E1.1
#=GS A0A445FIT8_GLYSO/99-186     AC A0A445FIT8.1
#=GS A0A370TKE8_9PEZI/29-120     AC A0A370TKE8.1
#=GS A0A1R3JFA2_COCAP/1054-1162  AC A0A1R3JFA2.1
#=GS A0A0D9XFE3_9ORYZ/198-307    AC A0A0D9XFE3.1
#=GS A0A0D2TFP9_GOSRA/97-209     AC A0A0D2TFP9.1
#=GS A0A453JWY6_AEGTS/164-272    AC A0A453JWY6.1
#=GS A9SXV5_PHYPA/51-140         AC A9SXV5.1
#=GS A0A078GH08_BRANA/71-183     AC A0A078GH08.1
#=GS A0A2T5M7U9_9EURO/33-123     AC A0A2T5M7U9.1
#=GS A0A453KLI4_AEGTS/88-206     AC A0A453KLI4.1
#=GS A0A3M8FPA5_9BACT/42-145     AC A0A3M8FPA5.1
#=GS A0A2U9CPL7_SCOMX/64-157     AC A0A2U9CPL7.1
#=GS A0A0E0RKH6_ORYRU/59-153     AC A0A0E0RKH6.1
#=GS I1R877_ORYGL/61-152         AC I1R877.1
#=GS A0A498R836_9FIRM/46-142     AC A0A498R836.1
#=GS A0A1S3US29_VIGRR/62-153     AC A0A1S3US29.1
#=GS A0A0K9PHR9_ZOSMR/89-180     AC A0A0K9PHR9.1
#=GS A0A3M6VN73_9STRA/239-345    AC A0A3M6VN73.1
#=GS E8R110_ISOPI/281-364        AC E8R110.1
#=GS A0A2N5XI67_9ACTN/37-142     AC A0A2N5XI67.1
#=GS A0A061DM70_THECC/72-184     AC A0A061DM70.1
#=GS A0A178IM07_9BACT/46-141     AC A0A178IM07.1
#=GS A0A0L0KMP4_9ACTN/74-179     AC A0A0L0KMP4.1
#=GS A0A0H4BZE0_9ACTN/82-187     AC A0A0H4BZE0.1
#=GS A0A2T1N9W7_9FLAO/21-112     AC A0A2T1N9W7.1
#=GS A0A078FZV2_BRANA/77-188     AC A0A078FZV2.1
#=GS A0A1S3UUB8_VIGRR/56-147     AC A0A1S3UUB8.1
#=GS A0A3N1KYD9_9ACTN/71-164     AC A0A3N1KYD9.1
#=GS E5XUQ5_9ACTN/60-153         AC E5XUQ5.1
#=GS A0A415EHE2_9FIRM/62-156     AC A0A415EHE2.1
#=GS K0N4S3_DESTT/36-133         AC K0N4S3.1
#=GS A0A0D3E3C5_BRAOL/53-147     AC A0A0D3E3C5.1
#=GS A0A3S1BJA0_ELYCH/32-124     AC A0A3S1BJA0.1
#=GS A0A059B2E2_EUCGR/76-187     AC A0A059B2E2.1
#=GS V7C1V6_PHAVU/76-187         AC V7C1V6.1
#=GS A0A0E0IEZ5_ORYNI/244-355    AC A0A0E0IEZ5.1
#=GS I1NS51_ORYGL/57-148         AC I1NS51.1
#=GS A0A2P5RWJ1_GOSBA/37-128     AC A0A2P5RWJ1.1
#=GS A0A2P8PXQ4_9ACTN/28-118     AC A0A2P8PXQ4.1
#=GS A0A2C9VWN5_MANES/171-279    AC A0A2C9VWN5.1
#=GS A0A1B8CTP5_9PEZI/37-130     AC A0A1B8CTP5.1
#=GS A0A1V9ZBS3_9STRA/88-187     AC A0A1V9ZBS3.1
#=GS A0A1B0BP11_9MUSC/65-150     AC A0A1B0BP11.1
#=GS A0A183MU95_9TREM/4-58       AC A0A183MU95.1
#=GS D8RM59_SELML/77-168         AC D8RM59.1
#=GS C1ECJ3_MICCC/28-128         AC C1ECJ3.1
#=GS A0A1C0BLI0_9CLOT/37-156     AC A0A1C0BLI0.1
#=GS A0A2K3LVW4_TRIPR/1-91       AC A0A2K3LVW4.1
#=GS F2E6U9_HORVV/174-282        AC F2E6U9.1
#=GS A0A3L6RAD6_PANMI/56-143     AC A0A3L6RAD6.1
#=GS D8T1V8_SELML/165-275        AC D8T1V8.1
#=GS A0A078H974_BRANA/174-282    AC A0A078H974.1
#=GS J3NFB2_ORYBR/24-103         AC J3NFB2.1
#=GS A0A1S3E1D1_CICAR/1-78       AC A0A1S3E1D1.1
#=GS A0A0N1FZ24_9ACTN/79-184     AC A0A0N1FZ24.1
#=GS A0A2I0WZI4_9ASPA/73-185     AC A0A2I0WZI4.1
#=GS A0A1R3JF08_COCAP/138-242    AC A0A1R3JF08.1
#=GS A0A0L7LVE1_9NEOP/32-106     AC A0A0L7LVE1.1
#=GS W1S8Z7_9SPHN/45-145         AC W1S8Z7.1
#=GS A0A1J6ISY4_NICAT/219-321    AC A0A1J6ISY4.1
#=GS A0A484AZB3_DRONA/5-87       AC A0A484AZB3.1
#=GS A0A418KS39_9ACTN/489-572    AC A0A418KS39.1
#=GS A0A287QZ63_HORVV/1-88       AC A0A287QZ63.1
#=GS A0A453JWK8_AEGTS/224-332    AC A0A453JWK8.1
#=GS A0A199V363_ANACO/64-155     AC A0A199V363.1
#=GS A0A1C5HZF2_9ACTN/48-142     AC A0A1C5HZF2.1
#=GS V4KCI4_EUTSA/172-280        AC V4KCI4.1
#=GS A0A225VJS3_9STRA/194-293    AC A0A225VJS3.1
#=GS A0A2U1QL13_ARTAN/610-697    AC A0A2U1QL13.1
#=GS A0A067L4U3_JATCU/44-132     AC A0A067L4U3.1
#=GS N4UGE1_FUSC1/76-176         AC N4UGE1.1
#=GS A0A2T7D9Y7_9POAL/176-288    AC A0A2T7D9Y7.1
#=GS V5IM44_NEUCR/19-108         AC V5IM44.1
#=GS A0A1U7WLV8_NICSY/45-133     AC A0A1U7WLV8.1
#=GS A0A453D6Q6_AEGTS/145-236    AC A0A453D6Q6.1
#=GS A0A1G6R4M4_9BACT/40-122     AC A0A1G6R4M4.1
#=GS K9RKT5_9CYAN/46-156         AC K9RKT5.1
#=GS A0A287QKA2_HORVV/1-95       AC A0A287QKA2.1
#=GS A0A2H3SUD0_FUSOX/69-173     AC A0A2H3SUD0.1
#=GS A0A2P6RBQ3_ROSCH/51-138     AC A0A2P6RBQ3.1
#=GS A0A090VNG3_9FLAO/56-165     AC A0A090VNG3.1
#=GS W9SBY2_9ROSA/118-226        AC W9SBY2.1
#=GS A0A0X8FLE7_9LACT/64-225     AC A0A0X8FLE7.1
#=GS V9GGY4_9BACL/1073-1172      AC V9GGY4.1
#=GS A0A1N6KUA0_9BURK/66-163     AC A0A1N6KUA0.1
#=GS A0A0D2C4B9_9EURO/27-117     AC A0A0D2C4B9.1
#=GS A0A1S3AV65_CUCME/206-311    AC A0A1S3AV65.1
#=GS V4TTP7_9ROSI/76-188         AC V4TTP7.1
#=GS A0A1S2ZSY6_ERIEU/32-125     AC A0A1S2ZSY6.1
#=GS W3Y737_9FIRM/57-149         AC W3Y737.1
#=GS A0A0U3Q144_9ACTN/46-143     AC A0A0U3Q144.1
#=GS A0A1Y3NKM4_PIRSE/34-132     AC A0A1Y3NKM4.1
#=GS M5VPK4_PRUPE/62-153         AC M5VPK4.1
#=GS A0A397XSF7_BRACM/61-152     AC A0A397XSF7.1
#=GS A0A229XQ05_9EURO/34-121     AC A0A229XQ05.1
#=GS A0A059A5X0_EUCGR/185-293    AC A0A059A5X0.1
#=GS K7TM89_MAIZE/45-132         AC K7TM89.1
#=GS D7LUB4_ARALL/51-138         AC D7LUB4.1
#=GS A0A2H5NVP7_CITUN/189-292    AC A0A2H5NVP7.1
#=GS A0A0B2BV75_9ACTN/32-125     AC A0A0B2BV75.1
#=GS A0A399VEG9_9ACTN/240-333    AC A0A399VEG9.1
#=GS A0A1Y3NGF0_PIRSE/64-157     AC A0A1Y3NGF0.1
#=GS V4P9G9_EUTSA/60-171         AC V4P9G9.1
#=GS A0A2N7X9D5_9BURK/54-151     AC A0A2N7X9D5.1
#=GS F2D5X1_HORVV/168-276        AC F2D5X1.1
#=GS A0A0D2PKU3_GOSRA/164-272    AC A0A0D2PKU3.1
#=GS A0A1H7K521_9GAMM/40-135     AC A0A1H7K521.1
#=GS A0A2N0ISK2_9ACTN/74-191     AC A0A2N0ISK2.1
#=GS A0A199VXY3_ANACO/181-289    AC A0A199VXY3.1
#=GS A0A316E1B1_9FLAO/52-129     AC A0A316E1B1.1
#=GS A0A3Q7FWW1_SOLLC/144-247    AC A0A3Q7FWW1.1
#=GS A0A1Q9JJ10_9FIRM/1087-1194  AC A0A1Q9JJ10.1
#=GS A0A0D4C128_9MICC/87-194     AC A0A0D4C128.1
#=GS F8EB32_RUNSL/33-129         AC F8EB32.1
#=GS A0A162AG32_DAUCS/50-138     AC A0A162AG32.1
#=GS A0A2T7E558_9POAL/1-75       AC A0A2T7E558.1
#=GS W2QXA7_PHYPN/201-306        AC W2QXA7.1
#=GS A0A1M5ZEJ9_9FIRM/58-156     AC A0A1M5ZEJ9.1
#=GS A0A2G5DFL1_AQUCA/58-149     AC A0A2G5DFL1.1
#=GS A0A3Q4G4S8_NEOBR/28-121     AC A0A3Q4G4S8.1
#=GS A0A453L831_AEGTS/1-97       AC A0A453L831.1
#=GS A0A2K5JT52_COLAP/32-125     AC A0A2K5JT52.1
#=GS A0A068V7C6_COFCA/1-88       AC A0A068V7C6.1
#=GS A0A3B6LTR9_WHEAT/145-252    AC A0A3B6LTR9.1
#=GS A0A453QNX8_AEGTS/173-286    AC A0A453QNX8.1
#=GS A0A2I3MVB0_PAPAN/32-125     AC A0A2I3MVB0.1
#=GS A0A0L0DJ10_THETB/63-162     AC A0A0L0DJ10.1
#=GS I1I2K5_BRADI/78-204         AC I1I2K5.1
#=GS A0A1D6KKC8_MAIZE/1-99       AC A0A1D6KKC8.1
#=GS W2KNN4_PHYPR/63-160         AC W2KNN4.1
#=GS A0A0D3GJ68_9ORYZ/80-171     AC A0A0D3GJ68.1
#=GS A0A1I4QB01_9BACL/35-134     AC A0A1I4QB01.1
#=GS A0A1U8A9F7_NELNU/68-179     AC A0A1U8A9F7.1
#=GS A0A0D7CD46_9ACTN/75-180     AC A0A0D7CD46.1
#=GS A0A1H5JP57_9ACTN/76-181     AC A0A1H5JP57.1
#=GS A0A419W4K4_9BACT/229-324    AC A0A419W4K4.1
#=GS A0A2R6RHG2_ACTCH/56-158     AC A0A2R6RHG2.1
#=GS A0A1U8LJH2_GOSHI/60-151     AC A0A1U8LJH2.1
#=GS A0A1I5G6Y4_9ACTN/34-145     AC A0A1I5G6Y4.1
#=GS A0A0E0RDU7_ORYRU/55-142     AC A0A0E0RDU7.1
#=GS H0DFX4_9STAP/65-217         AC H0DFX4.1
#=GS A0A0P9AX66_DROAN/40-134     AC A0A0P9AX66.1
#=GS A0A2P5SSW0_GOSBA/57-144     AC A0A2P5SSW0.1
#=GS A0A1Y4CNH5_9FIRM/70-162     AC A0A1Y4CNH5.1
#=GS A0A1T4YU49_9ACTN/27-120     AC A0A1T4YU49.1
#=GS A0A1V6RI09_9EURO/33-119     AC A0A1V6RI09.1
#=GS U5G9A8_POPTR/62-153         AC U5G9A8.1
#=GS A0A1F5LNM7_9EURO/34-120     AC A0A1F5LNM7.1
#=GS A0A2R6RHG9_ACTCH/61-152     AC A0A2R6RHG9.1
#=GS D7KQL0_ARALL/146-248        AC D7KQL0.1
#=GS A0A1Y0RIZ8_9CYAN/10-119     AC A0A1Y0RIZ8.1
#=GS A0A453BPP2_AEGTS/169-274    AC A0A453BPP2.1
#=GS A0A1L9WEW0_ASPAC/33-122     AC A0A1L9WEW0.1
#=GS A0A1B0FHH9_GLOMM/41-133     AC A0A1B0FHH9.1
#=GS K6DVA5_9BACI/50-147         AC K6DVA5.1
#=GS Q8A5V0_BACTN/46-137         AC Q8A5V0.1
#=GS A0A453KLG4_AEGTS/84-202     AC A0A453KLG4.1
#=GS A0A078ISA4_BRANA/141-244    AC A0A078ISA4.1
#=GS A0A0E0M337_ORYPU/181-289    AC A0A0E0M337.1
#=GS A0A078FHD3_BRANA/54-145     AC A0A078FHD3.1
#=GS A0A0C1G3B3_9FLAO/23-111     AC A0A0C1G3B3.1
#=GS A0A067EEW5_CITSI/1-89       AC A0A067EEW5.1
#=GS W1PPI1_AMBTC/66-177         AC W1PPI1.1
#=GS A0A0E0GI84_ORYNI/538-632    AC A0A0E0GI84.1
#=GS A0A0P0XNW6_ORYSJ/111-219    AC A0A0P0XNW6.1
#=GS Q19553_CAEEL/24-110         AC Q19553.1
#=GS A0A0D0DLT5_9AGAM/48-139     AC A0A0D0DLT5.1
#=GS R7CES4_9FIRM/256-345        AC R7CES4.1
#=GS A0A2Z3HFG7_9BACT/10-116     AC A0A2Z3HFG7.1
#=GS A0A3N0VKT1_9GAMM/63-162     AC A0A3N0VKT1.1
#=GS Q15XS6_PSEA6/45-158         AC Q15XS6.1
#=GS V4LLF9_EUTSA/53-144         AC V4LLF9.1
#=GS A0A1Y4LI83_9FIRM/55-152     AC A0A1Y4LI83.1
#=GS D3B0Y9_POLPP/395-507        AC D3B0Y9.1
#=GS A0A1S4DMV3_TOBAC/52-143     AC A0A1S4DMV3.1
#=GS D9V440_9ACTN/44-137         AC D9V440.1
#=GS C6VXE6_DYAFD/22-102         AC C6VXE6.1
#=GS A0A0D2T2L9_GOSRA/71-183     AC A0A0D2T2L9.1
#=GS A0A371IV18_9FIRM/57-152     AC A0A371IV18.1
#=GS A0A1B1Z1F0_9BACI/986-1091   AC A0A1B1Z1F0.1
#=GS A0A1Q8CJB2_9PSEU/47-149     AC A0A1Q8CJB2.1
#=GS A0A2H5NA47_CITUN/216-318    AC A0A2H5NA47.1
#=GS M4D9B1_BRARP/1-89           AC M4D9B1.1
#=GS W2PEK5_PHYPN/58-155         AC W2PEK5.1
#=GS B4FR72_MAIZE/55-145         AC B4FR72.1
#=GS A0A2G9DCN0_9ACTN/89-194     AC A0A2G9DCN0.1
#=GS A0A453JWB2_AEGTS/167-275    AC A0A453JWB2.1
#=GS A0A318UHL3_9SPHI/25-123     AC A0A318UHL3.1
#=GS A0A251TC93_HELAN/68-179     AC A0A251TC93.1
#=GS A0A068Y0U3_ECHMU/20-116     AC A0A068Y0U3.1
#=GS B4L6S0_DROMO/45-139         AC B4L6S0.1
#=GS A0A0E0NRJ3_ORYRU/172-280    AC A0A0E0NRJ3.1
#=GS A0A287PY32_HORVV/185-293    AC A0A287PY32.1
#=GS A0A0Q4IQZ1_9SPHN/41-138     AC A0A0Q4IQZ1.1
#=GS A0A2X0NJ42_9BASI/56-149     AC A0A2X0NJ42.1
#=GS A0A2P5DM63_PARAD/222-323    AC A0A2P5DM63.1
#=GS A0A200QDY9_9MAGN/55-146     AC A0A200QDY9.1
#=GS A0A453FQR6_AEGTS/205-308    AC A0A453FQR6.1
#=GS A0A2K5YDJ3_MANLE/32-125     AC A0A2K5YDJ3.1
#=GS A0A2Y9A5N7_9MICO/37-141     AC A0A2Y9A5N7.1
#=GS C0P5E1_MAIZE/63-157         AC C0P5E1.1
#=GS A0A1Y3TI71_9FIRM/60-159     AC A0A1Y3TI71.1
#=GS A0A072TZQ6_MEDTR/70-182     AC A0A072TZQ6.1
#=GS A0A239H129_9ACTN/81-186     AC A0A239H129.1
#=GS A0A1Y1XJU2_9FUNG/150-241    AC A0A1Y1XJU2.1
#=GS A0A287PH05_HORVV/214-322    AC A0A287PH05.1
#=GS A0A024UCE4_9STRA/56-150     AC A0A024UCE4.1
#=GS R6HEG8_9FIRM/41-130         AC R6HEG8.1
#=GS A0A3Q7I8I3_SOLLC/42-140     AC A0A3Q7I8I3.1
#=GS B4NC52_DROWI/1-87           AC B4NC52.2
#=GS G3R6I6_GORGO/32-125         AC G3R6I6.1
#=GS A0A2G5DXJ9_AQUCA/212-314    AC A0A2G5DXJ9.1
#=GS D2PXT6_KRIFD/38-139         AC D2PXT6.1
#=GS A0A0E0P8T6_ORYRU/52-141     AC A0A0E0P8T6.1
#=GS I1LZT0_SOYBN/60-151         AC I1LZT0.1
#=GS A0A402BLR2_9FIRM/39-135     AC A0A402BLR2.1
#=GS A0A0F7NAF6_9ACTN/77-180     AC A0A0F7NAF6.1
#=GS A0A251T444_HELAN/172-280    AC A0A251T444.1
#=GS A0A0D3E307_BRAOL/60-151     AC A0A0D3E307.1
#=GS U7PSG6_SPOS1/73-176         AC U7PSG6.1
#=GS A0A1L7XBZ3_9HELO/29-119     AC A0A1L7XBZ3.1
#=GS A0A0N4ZTX4_PARTI/70-166     AC A0A0N4ZTX4.2
#=GS A0A3B6JN91_WHEAT/52-144     AC A0A3B6JN91.1
#=GS A0A445A726_ARAHY/526-618    AC A0A445A726.1
#=GS A0A0B4IDF6_METMF/35-123     AC A0A0B4IDF6.1
#=GS K7MW57_SOYBN/72-183         AC K7MW57.1
#=GS K1LUL2_9BACT/26-111         AC K1LUL2.1
#=GS G9YRX4_9FIRM/57-152         AC G9YRX4.1
#=GS A0A2T3AHN4_9PEZI/82-185     AC A0A2T3AHN4.1
#=GS PPA13_ARATH/69-185          AC O48840.2
#=GS A0A103XGJ9_CYNCS/50-144     AC A0A103XGJ9.1
#=GS A0A484E780_BRELC/183-288    AC A0A484E780.1
#=GS A0A4D9B4X2_SALSN/105-192    AC A0A4D9B4X2.1
#=GS A0A0S3SI53_PHAAN/62-154     AC A0A0S3SI53.1
#=GS A0A3Q7V3W5_URSAR/28-121     AC A0A3Q7V3W5.1
#=GS A0A2J6LU76_LACSA/48-135     AC A0A2J6LU76.1
#=GS I0YTQ3_COCSC/128-219        AC I0YTQ3.1
#=GS A0A3S1AXT5_9BACT/54-152     AC A0A3S1AXT5.1
#=GS A0A2H5NVP7_CITUN/764-869    AC A0A2H5NVP7.1
#=GS A0A0D2X4M8_CAPO3/29-120     AC A0A0D2X4M8.1
#=GS A0A1R3J7H7_9ROSI/75-166     AC A0A1R3J7H7.1
#=GS A0A0L6JPD0_9FIRM/605-710    AC A0A0L6JPD0.1
#=GS W4FYC6_9STRA/32-126         AC W4FYC6.1
#=GS A0A3D8YB98_9BACT/38-135     AC A0A3D8YB98.1
#=GS A0A453BPX7_AEGTS/163-268    AC A0A453BPX7.1
#=GS A0A399D0M8_9BACT/31-123     AC A0A399D0M8.1
#=GS A0A2P5R1U0_GOSBA/61-132     AC A0A2P5R1U0.1
#=GS A0A023BUL7_9FLAO/1488-1580  AC A0A023BUL7.1
#=GS A0A078J8H5_BRANA/52-149     AC A0A078J8H5.1
#=GS G4UJZ4_NEUT9/19-108         AC G4UJZ4.1
#=GS A9SPI2_PHYPA/73-185         AC A9SPI2.1
#=GS A0A259UKR3_9FIRM/34-126     AC A0A259UKR3.1
#=GS A0A090LFJ7_STRRB/14-102     AC A0A090LFJ7.1
#=GS I9LFI1_9FIRM/40-136         AC I9LFI1.1
#=GS A0A368JJQ1_9BACT/228-324    AC A0A368JJQ1.1
#=GS A0A291QPL3_9BACT/61-156     AC A0A291QPL3.1
#=GS A0A2T7EJP9_9POAL/1-77       AC A0A2T7EJP9.1
#=GS A0A287RUW9_HORVV/1-95       AC A0A287RUW9.1
#=GS A0A1Y4UDM0_9FIRM/92-187     AC A0A1Y4UDM0.1
#=GS A0A2H2IM14_CAEJA/59-152     AC A0A2H2IM14.1
#=GS A0A445E246_ARAHY/202-305    AC A0A445E246.1
#=GS A0A2G5EPQ8_AQUCA/171-279    AC A0A2G5EPQ8.1
#=GS G0VPP7_MEGEL/56-148         AC G0VPP7.1
#=GS A0A3B6JR91_WHEAT/52-144     AC A0A3B6JR91.1
#=GS A0A2G3B773_CAPCH/168-276    AC A0A2G3B773.1
#=GS C7ZLA6_NECH7/33-122         AC C7ZLA6.1
#=GS A0A423SQV8_PENVA/56-147     AC A0A423SQV8.1
#=GS A0A2G7G2G5_9EURO/31-118     AC A0A2G7G2G5.1
#=GS A0A0E0KLJ2_ORYPU/66-179     AC A0A0E0KLJ2.1
#=GS A0A2C9W304_MANES/60-151     AC A0A2C9W304.1
#=GS A0A498M223_LABRO/1-80       AC A0A498M223.1
#=GS A0A453D6Y4_AEGTS/152-243    AC A0A453D6Y4.1
#=GS A0A4D8YZV4_SALSN/41-137     AC A0A4D8YZV4.1
#=GS Q5AR94_EMENI/75-178         AC Q5AR94.1
#=GS A0A225W0B7_9STRA/204-307    AC A0A225W0B7.1
#=GS A0A368JNM5_9BACT/38-134     AC A0A368JNM5.1
#=GS A0A239U0H1_9FIRM/69-161     AC A0A239U0H1.1
#=GS A0A1B0FIB1_GLOMM/30-115     AC A0A1B0FIB1.1
#=GS A0A0E0EJS5_9ORYZ/78-204     AC A0A0E0EJS5.1
#=GS A0A1B1BPU5_9MICO/55-152     AC A0A1B1BPU5.1
#=GS A0A1J6IPB9_NICAT/69-181     AC A0A1J6IPB9.1
#=GS A0A151TC63_CAJCA/240-331    AC A0A151TC63.1
#=GS A0A3L6R143_PANMI/211-312    AC A0A3L6R143.1
#=GS A0A2T4AMR3_TRIHA/34-122     AC A0A2T4AMR3.1
#=GS A0A2H5QLU0_CITUN/53-165     AC A0A2H5QLU0.1
#=GS A0A2R6PBQ2_ACTCH/169-277    AC A0A2R6PBQ2.1
#=GS A0A0L9TAX5_PHAAN/77-189     AC A0A0L9TAX5.1
#=GS A0A103XZT5_CYNCS/456-546    AC A0A103XZT5.1
#=GS A0A151TR98_CAJCA/179-288    AC A0A151TR98.1
#=GS A0A1G6YWJ7_9FLAO/28-113     AC A0A1G6YWJ7.1
#=GS A0A059AEB9_EUCGR/220-322    AC A0A059AEB9.1
#=GS G4YVZ5_PHYSP/189-294        AC G4YVZ5.1
#=GS A0A2G2X6S6_CAPBA/103-194    AC A0A2G2X6S6.1
#=GS A0A453KLX1_AEGTS/85-203     AC A0A453KLX1.1
#=GS A0A182M9B3_9DIPT/32-123     AC A0A182M9B3.1
#=GS A0A2T3ZD11_9HYPO/34-122     AC A0A2T3ZD11.1
#=GS A0A2K6KCP4_RHIBE/32-125     AC A0A2K6KCP4.1
#=GS A0A453L823_AEGTS/95-203     AC A0A453L823.1
#=GS A0A151RBJ2_CAJCA/52-143     AC A0A151RBJ2.1
#=GS A0A0D3DSM0_BRAOL/47-134     AC A0A0D3DSM0.1
#=GS D7KQJ3_ARALL/170-278        AC D7KQJ3.1
#=GS B4R7N5_DROSI/38-141         AC B4R7N5.1
#=GS A0A1X7HP66_9BACL/1072-1171  AC A0A1X7HP66.1
#=GS A0A239GSF0_9ACTN/71-173     AC A0A239GSF0.1
#=GS A0A1U8I8K2_GOSHI/141-245    AC A0A1U8I8K2.1
#=GS A0A2J6LDF4_LACSA/54-144     AC A0A2J6LDF4.1
#=GS A0A1V0DA28_9BACT/838-918    AC A0A1V0DA28.1
#=GS A0A3G2L125_9FLAO/40-125     AC A0A3G2L125.1
#=GS K7TEL4_MAIZE/49-136         AC K7TEL4.1
#=GS A0A443N7B1_9MAGN/64-155     AC A0A443N7B1.1
#=GS A0A0S2W5B4_9FIRM/57-157     AC A0A0S2W5B4.1
#=GS X0C4R0_FUSOX/76-176         AC X0C4R0.1
#=GS A0A287EIB0_HORVV/30-123     AC A0A287EIB0.1
#=GS A0A142ELT7_9BACT/43-144     AC A0A142ELT7.1
#=GS M0U3A4_MUSAM/51-139         AC M0U3A4.1
#=GS A0A423VTT5_9PEZI/34-120     AC A0A423VTT5.1
#=GS A0A1B8DRW5_9PEZI/33-122     AC A0A1B8DRW5.1
#=GS A0A1Q9JGI4_9FIRM/221-318    AC A0A1Q9JGI4.1
#=GS L1JKZ8_GUITC/72-177         AC L1JKZ8.1
#=GS A0A158R0D5_NIPBR/18-104     AC A0A158R0D5.1
#=GS D3EI91_GEOS4/1090-1189      AC D3EI91.1
#=GS A0A2T7CUM9_9POAL/48-135     AC A0A2T7CUM9.1
#=GS A0A068TWV0_COFCA/168-276    AC A0A068TWV0.1
#=GS A0A0R0D6C7_9GAMM/48-143     AC A0A0R0D6C7.1
#=GS A0A453LGR9_AEGTS/17-101     AC A0A453LGR9.1
#=GS A0A3R7KME1_9STRA/7-104      AC A0A3R7KME1.1
#=GS A0A0K9QIW9_SPIOL/52-144     AC A0A0K9QIW9.1
#=GS A0A0S3RJK0_PHAAN/49-141     AC A0A0S3RJK0.1
#=GS A0A016WRS5_9BILA/1-72       AC A0A016WRS5.1
#=GS A0A2H5P0U7_CITUN/61-152     AC A0A2H5P0U7.1
#=GS A7HH21_ANADF/21-105         AC A7HH21.1
#=GS A0A3S0AN63_9FLAO/52-138     AC A0A3S0AN63.1
#=GS A0A0R3NYJ1_DROPS/42-136     AC A0A0R3NYJ1.1
#=GS A0A2I0VG39_9ASPA/170-278    AC A0A2I0VG39.1
#=GS A0A1A5YEL0_9BACL/35-136     AC A0A1A5YEL0.1
#=GS A0A166EBS0_DAUCS/144-233    AC A0A166EBS0.1
#=GS A0A0D9V6T2_9ORYZ/129-227    AC A0A0D9V6T2.1
#=GS A0A1T2XGS7_9BACL/1076-1175  AC A0A1T2XGS7.1
#=GS G2R6B6_THITE/71-174         AC G2R6B6.1
#=GS A0A0E0FEP3_9ORYZ/56-147     AC A0A0E0FEP3.1
#=GS I2GJT4_9BACT/25-124         AC I2GJT4.1
#=GS A0A260ZM35_9PELO/22-117     AC A0A260ZM35.1
#=GS A0A445LE88_GLYSO/49-137     AC A0A445LE88.1
#=GS A0A074VP15_9PEZI/33-119     AC A0A074VP15.1
#=GS A0A453L822_AEGTS/87-195     AC A0A453L822.1
#=GS W2MUU5_PHYPR/243-349        AC W2MUU5.1
#=GS A0A286ISS9_9BACT/58-159     AC A0A286ISS9.1
#=GS A0A1J7FWE7_LUPAN/42-134     AC A0A1J7FWE7.1
#=GS G9MJT6_HYPVG/22-112         AC G9MJT6.1
#=GS A0A0N4WF48_HAEPC/40-134     AC A0A0N4WF48.1
#=GS A0A0X3SER1_9ACTN/56-148     AC A0A0X3SER1.1
#=GS A0A1R3I052_9ROSI/233-335    AC A0A1R3I052.1
#=GS W1SJF4_9BACI/40-146         AC W1SJF4.1
#=GS A0A3Q3LB62_9TELE/28-121     AC A0A3Q3LB62.1
#=GS A0A1H8J325_9BACT/38-135     AC A0A1H8J325.1
#=GS A0A0N4Z3J1_PARTI/70-166     AC A0A0N4Z3J1.1
#=GS A0A0P0XPV5_ORYSJ/202-313    AC A0A0P0XPV5.1
#=GS A0A2P6P4X6_ROSCH/143-252    AC A0A2P6P4X6.1
#=GS A0A0B2WSA1_METAS/35-123     AC A0A0B2WSA1.1
#=GS A0A1Y6BUX4_9PROT/85-185     AC A0A1Y6BUX4.1
#=GS B0N3K9_9FIRM/239-333        AC B0N3K9.1
#=GS A0A0C1YJK1_9BURK/49-146     AC A0A0C1YJK1.1
#=GS A0A1A2BJ81_9MYCO/60-153     AC A0A1A2BJ81.1
#=GS A0A1J7HM77_LUPAN/67-179     AC A0A1J7HM77.1
#=GS A0A2J6L7L3_LACSA/176-285    AC A0A2J6L7L3.1
#=GS W2J3P8_PHYPR/174-279        AC W2J3P8.1
#=GS V5G6U6_BYSSN/33-122         AC V5G6U6.1
#=GS A0A1B1B8T5_9ACTN/74-179     AC A0A1B1B8T5.1
#=GS Q5L7X1_BACFN/260-353        AC Q5L7X1.1
#=GS W9SPY4_9ROSA/175-278        AC W9SPY4.1
#=GS A0A2D0RME2_ICTPU/26-119     AC A0A2D0RME2.1
#=GS A0A2P5CUC8_TREOI/472-580    AC A0A2P5CUC8.1
#=GS A0A3B6AY85_WHEAT/143-248    AC A0A3B6AY85.1
#=GS A0A072VJR0_MEDTR/46-133     AC A0A072VJR0.1
#=GS R0HIF4_9BRAS/142-245        AC R0HIF4.1
#=GS R6E592_9FIRM/54-143         AC R6E592.1
#=GS A0A0E0B508_9ORYZ/192-303    AC A0A0E0B508.1
#=GS E1ZJI7_CHLVA/318-426        AC E1ZJI7.1
#=GS A0A067DJ00_CITSI/86-198     AC A0A067DJ00.1
#=GS A0A0R0JHK6_SOYBN/34-125     AC A0A0R0JHK6.1
#=GS Q2S7R2_HAHCH/27-112         AC Q2S7R2.1
#=GS A0A3M2J4Q1_9CELL/219-314    AC A0A3M2J4Q1.1
#=GS A0A2P5B241_PARAD/55-142     AC A0A2P5B241.1
#=GS A0A103YF11_CYNCS/45-132     AC A0A103YF11.1
#=GS A0A287JGS3_HORVV/13-102     AC A0A287JGS3.2
#=GS W9JD99_9HYPO/28-117         AC W9JD99.1
#=GS A0A175YK32_DAUCS/69-180     AC A0A175YK32.1
#=GS M0RTN7_MUSAM/179-287        AC M0RTN7.1
#=GS V7CK97_PHAVU/149-252        AC V7CK97.1
#=GS A0A101TT76_9ACTN/40-135     AC A0A101TT76.1
#=GS A0A2K6BX22_MACNE/32-125     AC A0A2K6BX22.1
#=GS A0A4D9C1Z2_SALSN/69-181     AC A0A4D9C1Z2.1
#=GS A0A287R016_HORVV/98-216     AC A0A287R016.1
#=GS A0A448UZQ2_9FIRM/48-139     AC A0A448UZQ2.1
#=GS A0A124I7I1_9ACTN/82-187     AC A0A124I7I1.1
#=GS G9NP31_HYPAI/69-172         AC G9NP31.1
#=GS A0A2K2ZCA4_9FLAO/31-114     AC A0A2K2ZCA4.1
#=GS A0A0E0LGA3_ORYPU/143-248    AC A0A0E0LGA3.1
#=GS A0A3N4PM52_9BACT/29-125     AC A0A3N4PM52.1
#=GS A0A022PSB9_ERYGU/44-135     AC A0A022PSB9.1
#=GS A0A287KQH9_HORVV/67-180     AC A0A287KQH9.1
#=GS A0A0B7H0P3_9FLAO/50-145     AC A0A0B7H0P3.1
#=GS A0A133V7I0_9EURY/33-129     AC A0A133V7I0.1
#=GS M9MCX2_PSEA3/33-119         AC M9MCX2.1
#=GS A0A1P8Y1B8_9ACTN/84-189     AC A0A1P8Y1B8.1
#=GS A0A0A0KTR4_CUCSA/5-59       AC A0A0A0KTR4.1
#=GS D8R9Z8_SELML/197-298        AC D8R9Z8.1
#=GS A0A2I4GV59_JUGRE/90-178     AC A0A2I4GV59.1
#=GS A0A0L9UTK3_PHAAN/169-277    AC A0A0L9UTK3.1
#=GS A0A1V1YFG8_9ACTN/63-168     AC A0A1V1YFG8.1
#=GS A0A1H9MNN4_9BACI/53-170     AC A0A1H9MNN4.1
#=GS A0A2A9DUJ5_9MICO/246-340    AC A0A2A9DUJ5.1
#=GS A0A1Q3AXQ0_CEPFO/60-151     AC A0A1Q3AXQ0.1
#=GS A0A0D2U748_GOSRA/56-147     AC A0A0D2U748.1
#=GS J3LLD8_ORYBR/174-282        AC J3LLD8.1
#=GS A0A3Q7H7N4_SOLLC/187-295    AC A0A3Q7H7N4.1
#=GS A0A0T2L1M6_9MICO/49-146     AC A0A0T2L1M6.1
#=GS D2R593_PIRSD/54-151         AC D2R593.1
#=GS A0A1D6EVQ8_MAIZE/1-95       AC A0A1D6EVQ8.1
#=GS B3PE63_CELJU/39-142         AC B3PE63.1
#=GS G3JI50_CORMM/34-124         AC G3JI50.1
#=GS A0A453KAL5_AEGTS/154-242    AC A0A453KAL5.1
#=GS E0VLI0_PEDHC/18-111         AC E0VLI0.1
#=GS A0A0E0RKH5_ORYRU/66-169     AC A0A0E0RKH5.1
#=GS A0A365MMI6_GIBIN/69-173     AC A0A365MMI6.1
#=GS K4A9F0_SETIT/82-169         AC K4A9F0.1
#=GS A0A1B8BYE3_9PEZI/70-174     AC A0A1B8BYE3.1
#=GS G9YKC2_9FIRM/1-74           AC G9YKC2.1
#=GS L8FYA7_PSED2/29-104         AC L8FYA7.1
#=GS A0A103XWX8_CYNCS/46-137     AC A0A103XWX8.1
#=GS M4FCX6_BRARP/59-150         AC M4FCX6.1
#=GS R6DMY4_9FIRM/691-807        AC R6DMY4.1
#=GS A0A067FCE4_CITSI/1-75       AC A0A067FCE4.1
#=GS A0A397KWG1_BRACM/174-282    AC A0A397KWG1.1
#=GS A0A427XQF8_9TREE/78-180     AC A0A427XQF8.1
#=GS S7Z876_PENO1/35-121         AC S7Z876.1
#=GS A0A0Q0ZFB4_9SPHI/35-153     AC A0A0Q0ZFB4.1
#=GS A0A0Q9WJU0_DROVI/46-140     AC A0A0Q9WJU0.1
#=GS I1NAM1_SOYBN/48-136         AC I1NAM1.1
#=GS B9RED8_RICCO/172-280        AC B9RED8.1
#=GS A0A1K1RPM5_9BACT/34-116     AC A0A1K1RPM5.1
#=GS A0A1S2VS12_9BACT/30-111     AC A0A1S2VS12.1
#=GS A0A498JX87_MALDO/614-726    AC A0A498JX87.1
#=GS A0A1S3BJG6_CUCME/62-153     AC A0A1S3BJG6.1
#=GS H3SFV3_9BACL/1076-1174      AC H3SFV3.1
#=GS D0NUG6_PHYIT/1-83           AC D0NUG6.1
#=GS A0A072UZJ4_MEDTR/180-288    AC A0A072UZJ4.1
#=GS A0A3L6T655_PANMI/184-293    AC A0A3L6T655.1
#=GS A0A453JWW5_AEGTS/10-118     AC A0A453JWW5.1
#=GS A0A0A0KGX7_CUCSA/169-277    AC A0A0A0KGX7.1
#=GS A0A369AGD5_9FIRM/50-145     AC A0A369AGD5.1
#=GS A0A367Y5A7_9MICO/445-540    AC A0A367Y5A7.1
#=GS W9HK93_9HYPO/75-176         AC W9HK93.1
#=GS A0A433Y2B8_9BACL/35-135     AC A0A433Y2B8.1
#=GS A0A1M7H0H9_9FIRM/61-149     AC A0A1M7H0H9.1
#=GS F5XIC4_MICPN/37-130         AC F5XIC4.1
#=GS A9T525_PHYPA/74-185         AC A9T525.1
#=GS A0A0Q9XEZ5_DROMO/45-139     AC A0A0Q9XEZ5.1
#=GS B9RWG6_RICCO/92-204         AC B9RWG6.1
#=GS A0A094I8E7_9PEZI/35-126     AC A0A094I8E7.1
#=GS B9SRV4_RICCO/52-139         AC B9SRV4.1
#=GS A0A3Q3VUA8_MOLML/29-122     AC A0A3Q3VUA8.1
#=GS A0A329S3Z0_9STRA/197-303    AC A0A329S3Z0.1
#=GS A0A0P0D591_9FLAO/33-115     AC A0A0P0D591.1
#=GS A0A3Q7XKX4_CICAR/47-134     AC A0A3Q7XKX4.1
#=GS A0A1W7CSP7_9ACTN/58-145     AC A0A1W7CSP7.1
#=GS W4FCL3_9STRA/162-271        AC W4FCL3.1
#=GS A0A059B329_EUCGR/75-187     AC A0A059B329.1
#=GS A0A022MBQ8_9ACTN/79-184     AC A0A022MBQ8.1
#=GS A0A383V868_TETOB/85-218     AC A0A383V868.1
#=GS A0A118K6I1_CYNCS/58-149     AC A0A118K6I1.1
#=GS A0A3Q0I1X3_PHODC/210-310    AC A0A3Q0I1X3.1
#=GS A0A1Y1XE57_9FUNG/129-220    AC A0A1Y1XE57.1
#=GS A0A373NIX3_9FIRM/55-151     AC A0A373NIX3.1
#=GS A0A2G2X4B1_CAPBA/53-144     AC A0A2G2X4B1.1
#=GS E2RE14_CANLF/29-122         AC E2RE14.1
#=GS A0A368WD13_9BACL/50-148     AC A0A368WD13.1
#=GS I1IH79_BRADI/173-281        AC I1IH79.1
#=GS H3BDL2_LATCH/28-122         AC H3BDL2.1
#=GS A0A1U8PVV9_GOSHI/56-147     AC A0A1U8PVV9.1
#=GS A0A0W8BYF2_PHYNI/61-158     AC A0A0W8BYF2.1
#=GS A0A061EK97_THECC/69-181     AC A0A061EK97.1
#=GS A0A3B6KNR8_WHEAT/146-251    AC A0A3B6KNR8.1
#=GS A0A0W8C026_PHYNI/68-166     AC A0A0W8C026.1
#=GS W4YU07_STRPU/47-140         AC W4YU07.1
#=GS A0A103Y1M2_CYNCS/210-312    AC A0A103Y1M2.1
#=GS Q0IMD7_ORYSJ/167-275        AC Q0IMD7.1
#=GS M0ZSX2_SOLTU/145-248        AC M0ZSX2.1
#=GS A0A0E0RDU4_ORYRU/52-145     AC A0A0E0RDU4.1
#=GS D7LUB5_ARALL/48-135         AC D7LUB5.1
#=GS W9SFG9_9ROSA/469-541        AC W9SFG9.1
#=GS A0A1S3XAI5_TOBAC/47-135     AC A0A1S3XAI5.1
#=GS PPA24_ARATH/172-280         AC Q8H1R2.1
#=GS A0A0U2YT78_9BACL/77-172     AC A0A0U2YT78.1
#=GS M0SR51_MUSAM/60-151         AC M0SR51.1
#=GS A0A1R3J1E1_9ROSI/2-58       AC A0A1R3J1E1.1
#=GS D5XE18_THEPJ/323-410        AC D5XE18.1
#=GS B8M199_TALSN/71-175         AC B8M199.1
#=GS C6T9R4_SOYBN/70-160         AC C6T9R4.1
#=GS A0A1Y1HM52_KLENI/60-174     AC A0A1Y1HM52.1
#=GS A0A368G2I3_ANCCA/17-102     AC A0A368G2I3.1
#=GS J7LI96_NOCAA/41-129         AC J7LI96.1
#=GS A0A2T4B081_9HYPO/62-169     AC A0A2T4B081.1
#=GS A0A085WI26_9DELT/49-127     AC A0A085WI26.1
#=GS A0A427XF33_9TREE/171-274    AC A0A427XF33.1
#=GS A0A0L8QUY1_9ACTN/88-193     AC A0A0L8QUY1.1
#=GS A0A2B4SBD6_STYPI/23-112     AC A0A2B4SBD6.1
#=GS R9A9E9_WALI9/18-112         AC R9A9E9.1
#=GS A0A2U1LTG1_ARTAN/105-193    AC A0A2U1LTG1.1
#=GS A0A3M6TZE2_9CNID/742-843    AC A0A3M6TZE2.1
#=GS A2XT61_ORYSI/52-141         AC A2XT61.1
#=GS A0A453L839_AEGTS/1-95       AC A0A453L839.1
#=GS G7L619_MEDTR/47-133         AC G7L619.2
#=GS D8RM71_SELML/77-168         AC D8RM71.1
#=GS A0A1M5MXE5_9BACT/225-320    AC A0A1M5MXE5.1
#=GS A0A2G1UHG5_9ALTE/152-241    AC A0A2G1UHG5.1
#=GS A0A0K9QM98_SPIOL/35-122     AC A0A0K9QM98.1
#=GS A0A388SCK3_9BURK/39-127     AC A0A388SCK3.1
#=GS A0A142XIX6_9BACT/53-148     AC A0A142XIX6.1
#=GS A0A2U1KGI6_ARTAN/210-312    AC A0A2U1KGI6.1
#=GS A0A3B3V190_9TELE/47-140     AC A0A3B3V190.1
#=GS A0A1S3X6H5_TOBAC/56-147     AC A0A1S3X6H5.1
#=GS A0A3D8Q5G8_9HELO/71-174     AC A0A3D8Q5G8.1
#=GS A0A315ZFW3_9BACT/28-119     AC A0A315ZFW3.1
#=GS I0YPZ7_COCSC/69-190         AC I0YPZ7.1
#=GS A0A0E0GI83_ORYNI/59-150     AC A0A0E0GI83.1
#=GS A0A498HI54_MALDO/172-280    AC A0A498HI54.1
#=GS A0A4P1RR89_LUPAN/123-209    AC A0A4P1RR89.1
#=GS A0A2U1KJV3_ARTAN/166-274    AC A0A2U1KJV3.1
#=GS A0A3B6MKQ7_WHEAT/222-330    AC A0A3B6MKQ7.1
#=GS A0A419T2U9_9FIRM/56-145     AC A0A419T2U9.1
#=GS G0T428_SOYBN/52-144         AC G0T428.1
#=GS A0A067DUY1_CITSI/86-198     AC A0A067DUY1.1
#=GS A0A0H3KLR8_BURM1/54-150     AC A0A0H3KLR8.1
#=GS A0A445JPK9_GLYSO/72-184     AC A0A445JPK9.1
#=GS A0A2K1IIV8_PHYPA/74-185     AC A0A2K1IIV8.1
#=GS A0A0K1PFK4_9DELT/33-113     AC A0A0K1PFK4.1
#=GS A0A068V4F2_COFCA/49-136     AC A0A068V4F2.1
#=GS A0A2I4E3G0_JUGRE/54-148     AC A0A2I4E3G0.1
#=GS N9WEZ7_9SPHN/51-147         AC N9WEZ7.1
#=GS M1CGZ9_SOLTU/1-93           AC M1CGZ9.1
#=GS G2RGK6_THITE/28-117         AC G2RGK6.1
#=GS A0A166ICU1_DAUCS/2-79       AC A0A166ICU1.1
#=GS F6MIW0_WHEAT/63-176         AC F6MIW0.1
#=GS A0A060R9K5_9BACT/32-131     AC A0A060R9K5.1
#=GS A0A371E3J4_MUCPR/48-136     AC A0A371E3J4.1
#=GS A0A3S4F4T6_9PEZI/36-121     AC A0A3S4F4T6.1
#=GS I1C3N2_RHIO9/1-97           AC I1C3N2.1
#=GS R0GVM9_9BRAS/145-248        AC R0GVM9.1
#=GS A0A2K1K5V2_PHYPA/179-288    AC A0A2K1K5V2.1
#=GS A0A1X7JRP4_9SPHI/43-139     AC A0A1X7JRP4.1
#=GS I1HS75_BRADI/60-151         AC I1HS75.1
#=GS A0A1J0GD75_9CLOT/46-141     AC A0A1J0GD75.1
#=GS A0A151T1M0_CAJCA/1-76       AC A0A151T1M0.1
#=GS A0A3E0VKN2_9MICO/50-145     AC A0A3E0VKN2.1
#=GS B0S2T7_FINM2/49-170         AC B0S2T7.1
#=GS F4Q2Y4_CAVFA/63-155         AC F4Q2Y4.1
#=GS A0A1S3ZQ91_TOBAC/229-331    AC A0A1S3ZQ91.1
#=GS A0A165ZZH5_DAUCS/65-159     AC A0A165ZZH5.1
#=GS A0A314Y217_PRUYE/65-155     AC A0A314Y217.1
#=GS A0A453JUW6_AEGTS/83-179     AC A0A453JUW6.1
#=GS A0A0E0JPV1_ORYPU/206-309    AC A0A0E0JPV1.1
#=GS A0A2P5BT97_PARAD/61-152     AC A0A2P5BT97.1
#=GS A0A1Q3BI56_CEPFO/69-181     AC A0A1Q3BI56.1
#=GS A0A1U7WAN3_NICSY/61-152     AC A0A1U7WAN3.1
#=GS A0A067DMM2_CITSI/86-198     AC A0A067DMM2.1
#=GS J3MG77_ORYBR/55-146         AC J3MG77.1
#=GS A0A2A4GE26_9FLAO/55-161     AC A0A2A4GE26.1
#=GS A0A067F5L0_CITSI/43-130     AC A0A067F5L0.1
#=GS A0A3B4YJZ3_SERLL/28-121     AC A0A3B4YJZ3.1
#=GS A1C5K8_ASPCL/69-173         AC A1C5K8.1
#=GS K3XFF1_SETIT/213-316        AC K3XFF1.1
#=GS G3J2J7_CORMM/29-105         AC G3J2J7.1
#=GS A0A484AZG2_DRONA/1-92       AC A0A484AZG2.1
#=GS A0A3B6REA7_WHEAT/171-281    AC A0A3B6REA7.1
#=GS A0A287R030_HORVV/89-207     AC A0A287R030.1
#=GS A0A399CYS1_9BACT/228-323    AC A0A399CYS1.1
#=GS A0A2V3W4W5_9BACI/697-792    AC A0A2V3W4W5.1
#=GS A0A2M9J459_9ACTN/40-133     AC A0A2M9J459.1
#=GS A0A0Q6Y074_9MICO/61-157     AC A0A0Q6Y074.1
#=GS I9SDG9_9BACE/30-121         AC I9SDG9.1
#=GS A0A0N5BA91_STREA/28-125     AC A0A0N5BA91.1
#=GS A0A2N0FUV7_9FLAO/23-111     AC A0A2N0FUV7.1
#=GS A0A200Q6G5_9MAGN/133-225    AC A0A200Q6G5.1
#=GS A0A369B1T9_9BACL/45-145     AC A0A369B1T9.1
#=GS G1T0Z9_RABIT/35-128         AC G1T0Z9.1
#=GS C8W6U0_DESAS/47-139         AC C8W6U0.1
#=GS A0A2G9HY06_9LAMI/60-151     AC A0A2G9HY06.1
#=GS Q4KU02_MEDTR/55-146         AC Q4KU02.1
#=GS A0A0N4ZK86_PARTI/25-119     AC A0A0N4ZK86.1
#=GS A0A2A4K1D9_HELVI/34-125     AC A0A2A4K1D9.1
#=GS S7X4I5_9FLAO/811-890        AC S7X4I5.1
#=GS A0A445E1W5_ARAHY/64-156     AC A0A445E1W5.1
#=GS F6HKK0_VITVI/48-134         AC F6HKK0.1
#=GS A0A3T1DC29_9BACL/54-149     AC A0A3T1DC29.1
#=GS A0A1S3PAU1_SALSA/65-159     AC A0A1S3PAU1.1
#=GS A3HZ41_9BACT/32-128         AC A3HZ41.1
#=GS A0A2P6NGC8_9MYCE/216-320    AC A0A2P6NGC8.1
#=GS A0A2I0WT64_9ASPA/207-309    AC A0A2I0WT64.1
#=GS A0A2Z4G7H4_9BACT/225-322    AC A0A2Z4G7H4.1
#=GS A0A0K9Q156_ZOSMR/4-99       AC A0A0K9Q156.1
#=GS L8GGG9_ACACA/27-120         AC L8GGG9.1
#=GS A0A1S4AXP5_TOBAC/61-152     AC A0A1S4AXP5.1
#=GS A0A2H5WSU7_9BACT/33-121     AC A0A2H5WSU7.1
#=GS A0A1B8UYK2_9BACL/228-339    AC A0A1B8UYK2.1
#=GS A0A078FJI0_BRANA/49-136     AC A0A078FJI0.1
#=GS K7MRU1_SOYBN/173-281        AC K7MRU1.1
#=GS A0A1C0BVV9_9FIRM/281-379    AC A0A1C0BVV9.1
#=GS G4ZMQ7_PHYSP/50-165         AC G4ZMQ7.1
#=GS A0A1T5E2F3_9SPHI/42-138     AC A0A1T5E2F3.1
#=GS A0A0M3C9T5_9SPHI/31-142     AC A0A0M3C9T5.1
#=GS B1B9M3_CLOBO/53-137         AC B1B9M3.1
#=GS A0A251MVB6_PRUPE/68-158     AC A0A251MVB6.1
#=GS A0A1H3H245_9PSEU/68-182     AC A0A1H3H245.1
#=GS T0SAU2_SAPDV/162-272        AC T0SAU2.1
#=GS A0A152A6R2_9MYCE/1-118      AC A0A152A6R2.1
#=GS A0A0Q5T497_9BACT/228-324    AC A0A0Q5T497.1
#=GS A0A0C3H7G2_9PEZI/1-88       AC A0A0C3H7G2.1
#=GS A0A1E5TAS6_9FLAO/22-114     AC A0A1E5TAS6.1
#=GS A0A0D2QTF8_GOSRA/69-181     AC A0A0D2QTF8.1
#=GS A0A016S2Q0_9BILA/40-134     AC A0A016S2Q0.1
#=GS A0A1Y2D293_9FUNG/246-337    AC A0A1Y2D293.1
#=GS A0A1H4T9J1_9ACTN/73-178     AC A0A1H4T9J1.1
#=GS I1I2K6_BRADI/78-204         AC I1I2K6.1
#=GS A0A1T4Z141_9ACTN/232-323    AC A0A1T4Z141.1
#=GS F2CT85_HORVV/188-296        AC F2CT85.1
#=GS A0A2I9DKG8_9FLAO/95-201     AC A0A2I9DKG8.1
#=GS A0A317WGA7_ASPEC/70-173     AC A0A317WGA7.1
#=GS A0A1T4NTE9_9ACTN/42-129     AC A0A1T4NTE9.1
#=GS A0A387C0R1_9MICO/71-164     AC A0A387C0R1.1
#=GS A0A0W8C0A6_PHYNI/95-193     AC A0A0W8C0A6.1
#=GS A0A2G2XJV3_CAPBA/170-278    AC A0A2G2XJV3.1
#=GS A0A1A9Y2M8_GLOFF/28-121     AC A0A1A9Y2M8.1
#=GS A0A3L6QWK5_PANMI/1-88       AC A0A3L6QWK5.1
#=GS V7AEV3_PHAVU/1-77           AC V7AEV3.1
#=GS A0A2P5SG99_GOSBA/141-245    AC A0A2P5SG99.1
#=GS A0A4D9A8L2_SALSN/58-149     AC A0A4D9A8L2.1
#=GS A0A252F6D9_9CLOT/61-158     AC A0A252F6D9.1
#=GS B9I0D9_POPTR/42-131         AC B9I0D9.1
#=GS A0A0V1LZP8_9BILA/2-70       AC A0A0V1LZP8.1
#=GS A0A2U1N2Z8_ARTAN/54-145     AC A0A2U1N2Z8.1
#=GS A0A386Z7C7_9NOCA/87-182     AC A0A386Z7C7.1
#=GS A0A1I6XH40_9FLAO/19-108     AC A0A1I6XH40.1
#=GS S2Z3T7_9ACTN/76-181         AC S2Z3T7.1
#=GS A0A1M7NBJ7_9ACTN/64-157     AC A0A1M7NBJ7.1
#=GS A0A1U8J2D3_GOSHI/56-147     AC A0A1U8J2D3.1
#=GS A0A287LTF2_HORVV/209-312    AC A0A287LTF2.1
#=GS G2IPZ7_SPHSK/44-140         AC G2IPZ7.1
#=GS A0A1S3TQH9_VIGRR/58-145     AC A0A1S3TQH9.1
#=GS A0A3N1JKI4_9BACT/35-121     AC A0A3N1JKI4.1
#=GS A0A0K0E1G1_STRER/14-102     AC A0A0K0E1G1.1
#=GS A0A2U3Y791_LEPWE/32-125     AC A0A2U3Y791.1
#=GS A0A1I0WD44_9BACT/32-128     AC A0A1I0WD44.1
#=GS V7AD31_PHAVU/54-145         AC V7AD31.1
#=GS A0A1A9YCP6_GLOFF/41-133     AC A0A1A9YCP6.1
#=GS A0A168CMM7_9HYPO/72-174     AC A0A168CMM7.1
#=GS A0A0M8WEB1_9ACTN/77-182     AC A0A0M8WEB1.1
#=GS A0A2P5QH85_GOSBA/65-177     AC A0A2P5QH85.1
#=GS A0A251VTF6_HELAN/47-134     AC A0A251VTF6.1
#=GS S8AR30_PENO1/67-171         AC S8AR30.1
#=GS A0A0R0H8H3_SOYBN/217-319    AC A0A0R0H8H3.1
#=GS A0A314UG77_PRUYE/59-149     AC A0A314UG77.1
#=GS A0A194W7P8_9PEZI/66-169     AC A0A194W7P8.1
#=GS W7Z8J0_9BACL/393-503        AC W7Z8J0.1
#=GS A0A319EJJ0_ASPSB/33-122     AC A0A319EJJ0.1
#=GS A0A314ZIN0_PRUYE/27-135     AC A0A314ZIN0.1
#=GS B9R821_RICCO/60-151         AC B9R821.1
#=GS A0A1S4A3U4_TOBAC/2-82       AC A0A1S4A3U4.1
#=GS A0A453LGW8_AEGTS/38-151     AC A0A453LGW8.1
#=GS A0A443NC68_9MAGN/206-309    AC A0A443NC68.1
#=GS A0A445A6R5_ARAHY/60-151     AC A0A445A6R5.1
#=GS R5IK64_9BACT/43-134         AC R5IK64.1
#=GS U7Q4W9_SPOS1/34-119         AC U7Q4W9.1
#=GS A0A3Q1HB01_ANATE/28-121     AC A0A3Q1HB01.1
#=GS A0A287R026_HORVV/106-224    AC A0A287R026.1
#=GS A0A453FNK4_AEGTS/59-150     AC A0A453FNK4.1
#=GS R6NIJ9_9CLOT/42-126         AC R6NIJ9.1
#=GS C5YWL2_SORBI/62-156         AC C5YWL2.1
#=GS A0A1W0W002_SORBI/112-215    AC A0A1W0W002.1
#=GS A0A022RBX4_ERYGU/58-149     AC A0A022RBX4.1
#=GS H9GI46_ANOCA/29-117         AC H9GI46.1
#=GS A0A3S4ARQ4_9PEZI/71-174     AC A0A3S4ARQ4.1
#=GS A0A1J4NW05_9ACTN/74-179     AC A0A1J4NW05.1
#=GS A0A1N6G500_9BACT/43-126     AC A0A1N6G500.1
#=GS A0A1H3A4W7_9FLAO/20-111     AC A0A1H3A4W7.1
#=GS A0A2I0WYL5_9ASPA/68-154     AC A0A2I0WYL5.1
#=GS A0A2V3JET6_9EURY/136-223    AC A0A2V3JET6.1
#=GS A0A453FQH8_AEGTS/205-308    AC A0A453FQH8.1
#=GS A0A094BTB4_9PEZI/583-673    AC A0A094BTB4.1
#=GS A0A1X0D6N8_9MYCO/56-149     AC A0A1X0D6N8.1
#=GS A0A103YKA0_CYNCS/1-76       AC A0A103YKA0.1
#=GS A0A0D2QJD5_GOSRA/61-152     AC A0A0D2QJD5.1
#=GS A0A1R1LCC7_9MICC/40-129     AC A0A1R1LCC7.1
#=GS N1PDD9_DOTSN/35-121         AC N1PDD9.1
#=GS A0A1Z5RAL5_SORBI/195-313    AC A0A1Z5RAL5.1
#=GS A7T4Y9_NEMVE/2-95           AC A7T4Y9.1
#=GS F9Z3J6_ODOSD/31-129         AC F9Z3J6.1
#=GS A0A1D6NA73_MAIZE/67-138     AC A0A1D6NA73.1
#=GS A0A2T7E563_9POAL/62-149     AC A0A2T7E563.1
#=GS A0A1S3BDG6_CUCME/169-277    AC A0A1S3BDG6.1
#=GS A1D0I1_NEOFI/70-173         AC A1D0I1.1
#=GS A0A1C4MP72_9ACTN/48-143     AC A0A1C4MP72.1
#=GS A0A094BW79_9PEZI/70-174     AC A0A094BW79.1
#=GS A0A1J7I117_LUPAN/49-160     AC A0A1J7I117.1
#=GS E6NU63_JATCU/62-153         AC E6NU63.1
#=GS A0A1H3X8W0_9BACT/37-118     AC A0A1H3X8W0.1
#=GS A0A369S1I8_9METZ/49-148     AC A0A369S1I8.1
#=GS V7CA52_PHAVU/60-151         AC V7CA52.1
#=GS A0A1Q3BWF6_CEPFO/83-174     AC A0A1Q3BWF6.1
#=GS A0A1R3HDB9_9ROSI/58-145     AC A0A1R3HDB9.1
#=GS A0A453L834_AEGTS/201-309    AC A0A453L834.1
#=GS A0A3Q3NL81_9LABR/38-131     AC A0A3Q3NL81.1
#=GS A0A179G1Y6_METCM/26-116     AC A0A179G1Y6.1
#=GS A0A250X7H2_9CHLO/61-195     AC A0A250X7H2.1
#=GS A0A0F7CN91_9ACTN/50-152     AC A0A0F7CN91.1
#=GS A0A2V5GRQ3_9EURO/33-122     AC A0A2V5GRQ3.1
#=GS A0A0M2LUP4_9MICO/244-335    AC A0A0M2LUP4.1
#=GS A0A0D9YG69_9ORYZ/206-309    AC A0A0D9YG69.1
#=GS A0A171KRI0_9BURK/1111-1205  AC A0A171KRI0.1
#=GS A0A2G3B2N2_CAPCH/1-61       AC A0A2G3B2N2.1
#=GS A0A1E3PZF5_LIPST/33-124     AC A0A1E3PZF5.1
#=GS A0A3S1B3K2_ELYCH/1-79       AC A0A3S1B3K2.1
#=GS A0A2G3BXZ0_CAPCH/53-144     AC A0A2G3BXZ0.1
#=GS F7EI35_MACMU/32-125         AC F7EI35.2
#=GS A0A368SU33_SETIT/172-280    AC A0A368SU33.1
#=GS A0A0E0MNX5_ORYPU/881-989    AC A0A0E0MNX5.1
#=GS A0A087SNF3_AUXPR/77-178     AC A0A087SNF3.1
#=GS A0A287RV42_HORVV/86-194     AC A0A287RV42.1
#=GS M4ECP0_BRARP/139-242        AC M4ECP0.1
#=GS A0A0N1NDA0_9ACTN/80-185     AC A0A0N1NDA0.1
#=GS A0A0C5XKW4_NOCSI/40-135     AC A0A0C5XKW4.1
#=GS A0A444HDR6_9FLAO/22-110     AC A0A444HDR6.1
#=GS A0A0L6JHD8_9FIRM/35-134     AC A0A0L6JHD8.1
#=GS A0A2G2VWU9_CAPBA/39-126     AC A0A2G2VWU9.1
#=GS A0A368WC44_9BACL/33-122     AC A0A368WC44.1
#=GS E9DRE6_METAQ/35-123         AC E9DRE6.1
#=GS A0A2T7DW29_9POAL/55-146     AC A0A2T7DW29.1
#=GS A0A2G5TVT9_9PELO/20-114     AC A0A2G5TVT9.1
#=GS A0A0D3DXH6_BRAOL/173-280    AC A0A0D3DXH6.1
#=GS E9ESD2_METRA/35-123         AC E9ESD2.1
#=GS A0A1Y2EGL3_9FUNG/98-189     AC A0A1Y2EGL3.1
#=GS A0A182EAF2_ONCOC/46-137     AC A0A182EAF2.1
#=GS A0A146EY09_9EURO/33-122     AC A0A146EY09.1
#=GS A0A2I4E2M6_JUGRE/55-142     AC A0A2I4E2M6.1
#=GS A0A167W6U0_9PEZI/132-218    AC A0A167W6U0.1
#=GS A0A368G2R3_ANCCA/21-106     AC A0A368G2R3.1
#=GS A0A2G3AKN1_CAPAN/113-215    AC A0A2G3AKN1.1
#=GS A0A2P6P4Z5_ROSCH/173-281    AC A0A2P6P4Z5.1
#=GS A0A1D2NKD8_ORCCI/60-152     AC A0A1D2NKD8.1
#=GS A0A1G6LY32_9BACT/60-143     AC A0A1G6LY32.1
#=GS A0A0D9P870_METAN/803-891    AC A0A0D9P870.1
#=GS A0A1S2XTA8_CICAR/54-141     AC A0A1S2XTA8.1
#=GS A0A3B6LPQ4_WHEAT/1-95       AC A0A3B6LPQ4.1
#=GS A0A498BXH9_9ACTN/72-177     AC A0A498BXH9.1
#=GS A0A2I0HRP0_PUNGR/210-312    AC A0A2I0HRP0.1
#=GS A0A0D2UU09_GOSRA/108-219    AC A0A0D2UU09.1
#=GS A0A319CS81_9EURO/32-121     AC A0A319CS81.1
#=GS M3BLY4_STRMB/64-169         AC M3BLY4.1
#=GS A0A1U7CVJ1_9BACT/237-347    AC A0A1U7CVJ1.1
#=GS A0A319C4F9_9EURO/70-173     AC A0A319C4F9.1
#=GS A0A0C2LUG1_9CYAN/20-104     AC A0A0C2LUG1.1
#=GS A0A1H0T6Q8_9ACTN/72-165     AC A0A1H0T6Q8.1
#=GS W5J5R2_ANODA/34-125         AC W5J5R2.1
#=GS A0A0L1IW73_ASPNO/133-220    AC A0A0L1IW73.1
#=GS G3NRK8_GASAC/27-120         AC G3NRK8.1
#=GS A0A369B5P9_9FIRM/1180-1286  AC A0A369B5P9.1
#=GS S2YFP0_9ACTN/49-149         AC S2YFP0.1
#=GS A0A2H3ZPT9_PHODC/70-157     AC A0A2H3ZPT9.1
#=GS A0A3B6QBK8_WHEAT/63-155     AC A0A3B6QBK8.1
#=GS A0A3M6VCG3_9STRA/214-319    AC A0A3M6VCG3.1
#=GS A0A3T1CYK8_9BACL/1074-1173  AC A0A3T1CYK8.1
#=GS I3IRG3_9BACT/30-116         AC I3IRG3.1
#=GS L1L035_9ACTN/80-185         AC L1L035.1
#=GS A0A0A1TS26_9HYPO/30-120     AC A0A0A1TS26.1
#=GS A0A1H6QUV3_9BACT/1502-1593  AC A0A1H6QUV3.1
#=GS A0A1S3IRU7_LINUN/50-140     AC A0A1S3IRU7.1
#=GS A0A063BZM0_USTVR/30-117     AC A0A063BZM0.1
#=GS A0A150UZT7_9PEZI/74-176     AC A0A150UZT7.1
#=GS A0A3G3GSX2_9BACT/223-319    AC A0A3G3GSX2.1
#=GS A0A1Y1XJ72_9FUNG/170-261    AC A0A1Y1XJ72.1
#=GS A0A1H5FKS9_9FLAO/21-112     AC A0A1H5FKS9.1
#=GS A0A3N4MCR3_9BACT/58-156     AC A0A3N4MCR3.1
#=GS A0A445A726_ARAHY/60-151     AC A0A445A726.1
#=GS A0A059BLC6_EUCGR/1-78       AC A0A059BLC6.1
#=GS A0A368RTR4_SETIT/152-239    AC A0A368RTR4.1
#=GS A0A0N5A1P6_PARTI/14-102     AC A0A0N5A1P6.1
#=GS A0A142YKZ8_9PLAN/237-347    AC A0A142YKZ8.1
#=GS A0A0N4ZK86_PARTI/547-642    AC A0A0N4ZK86.1
#=GS G0VMY2_MEGEL/29-123         AC G0VMY2.1
#=GS A0A0D2XTT0_FUSO4/28-117     AC A0A0D2XTT0.1
#=GS A0A445J4R6_GLYSO/222-324    AC A0A445J4R6.1
#=GS A0A0E0BVP6_9ORYZ/58-149     AC A0A0E0BVP6.1
#=GS A0A1W0VZU6_SORBI/68-159     AC A0A1W0VZU6.1
#=GS A0A074VTA2_9PEZI/71-174     AC A0A074VTA2.1
#=GS A0A419HIV7_9PSEU/65-163     AC A0A419HIV7.1
#=GS C7PWR5_CATAD/71-164         AC C7PWR5.1
#=GS R5QC02_9FIRM/45-140         AC R5QC02.1
#=GS A0A2K5ELY0_AOTNA/32-124     AC A0A2K5ELY0.1
#=GS A0A072TFW4_MEDTR/61-152     AC A0A072TFW4.1
#=GS A0A1I8GHZ9_9PLAT/29-120     AC A0A1I8GHZ9.1
#=GS D1CIU3_THET1/239-328        AC D1CIU3.1
#=GS A0A061EHE8_THECC/172-281    AC A0A061EHE8.1
#=GS R7EVD7_9FIRM/700-815        AC R7EVD7.1
#=GS A0A0K9PIF5_ZOSMR/114-217    AC A0A0K9PIF5.1
#=GS A0A067P4C9_9AGAM/36-123     AC A0A067P4C9.1
#=GS A0A0D2R8H7_GOSRA/73-185     AC A0A0D2R8H7.1
#=GS A0A0B2VIU9_TOXCA/42-133     AC A0A0B2VIU9.1
#=GS F4L3L8_HALH1/34-129         AC F4L3L8.1
#=GS B9T7B6_RICCO/49-142         AC B9T7B6.1
#=GS A0A061FJT8_THECC/252-355    AC A0A061FJT8.1
#=GS A0A2K5NLR2_CERAT/32-125     AC A0A2K5NLR2.1
#=GS A0A498IN54_MALDO/44-131     AC A0A498IN54.1
#=GS A0A453PW39_AEGTS/61-131     AC A0A453PW39.1
#=GS A7SDQ0_NEMVE/1-80           AC A7SDQ0.1
#=GS A0A101NKU7_9ACTN/74-179     AC A0A101NKU7.1
#=GS A0A2K5NLY0_CERAT/32-125     AC A0A2K5NLY0.1
#=GS A0A1I8Q1W4_STOCA/29-124     AC A0A1I8Q1W4.1
#=GS A0A251N0K9_PRUPE/75-187     AC A0A251N0K9.1
#=GS S3ZPA5_9ACTN/85-190         AC S3ZPA5.1
#=GS A0A371P7I3_9BACL/616-727    AC A0A371P7I3.1
#=GS A0A3L6S2I1_PANMI/1-92       AC A0A3L6S2I1.1
#=GS A0A0E0N379_ORYRU/57-148     AC A0A0E0N379.1
#=GS A0A3B6KII4_WHEAT/175-283    AC A0A3B6KII4.1
#=GS A0A1I3GB78_9ACTN/34-125     AC A0A1I3GB78.1
#=GS Q8S2H5_ORYSJ/206-309        AC Q8S2H5.1
#=GS H1BIF9_9FIRM/1070-1176      AC H1BIF9.1
#=GS I0HFE0_ACTM4/42-137         AC I0HFE0.1
#=GS A0A067EP55_CITSI/1-95       AC A0A067EP55.1
#=GS F2U2E4_SALR5/74-176         AC F2U2E4.1
#=GS A0A2N5G9I9_9BACI/1128-1228  AC A0A2N5G9I9.1
#=GS A7SZW4_NEMVE/173-273        AC A7SZW4.1
#=GS A0A1S3HKN8_LINUN/50-140     AC A0A1S3HKN8.1
#=GS A0A1N7SWT6_9BURK/60-157     AC A0A1N7SWT6.1
#=GS A0A3Q7I175_SOLLC/193-301    AC A0A3Q7I175.1
#=GS V9GGX9_9BACL/14-111         AC V9GGX9.1
#=GS A0A0D3A632_BRAOL/173-281    AC A0A0D3A632.1
#=GS G5H7L9_9BACT/30-137         AC G5H7L9.1
#=GS A0A151Z7Z6_9MYCE/136-240    AC A0A151Z7Z6.1
#=GS A0A0C1W668_9ACTN/53-146     AC A0A0C1W668.1
#=GS A0A2G7EF19_9ACTN/104-209    AC A0A2G7EF19.1
#=GS J3L4M2_ORYBR/59-150         AC J3L4M2.1
#=GS A0A3S4NA86_9MAGN/68-180     AC A0A3S4NA86.1
#=GS A0A0E0QTG4_ORYRU/205-316    AC A0A0E0QTG4.1
#=GS A0A453T6S3_AEGTS/55-146     AC A0A453T6S3.1
#=GS A0A251U0B3_HELAN/197-305    AC A0A251U0B3.1
#=GS A0A0A2DXQ0_9PORP/67-162     AC A0A0A2DXQ0.1
#=GS A0A421GCY2_9STRA/39-145     AC A0A421GCY2.1
#=GS A0A022QD15_ERYGU/118-211    AC A0A022QD15.1
#=GS A0A1W4WFP0_AGRPL/21-117     AC A0A1W4WFP0.1
#=GS R4K5T7_CLOPA/350-474        AC R4K5T7.1
#=GS M0ZS21_SOLTU/47-135         AC M0ZS21.1
#=GS A0A3P8NDG4_ASTCA/3-91       AC A0A3P8NDG4.1
#=GS A0A2J6Q965_9HELO/73-175     AC A0A2J6Q965.1
#=GS A0A1G4WDY3_9FIRM/1120-1216  AC A0A1G4WDY3.1
#=GS A0A3B6QE71_WHEAT/1-80       AC A0A3B6QE71.1
#=GS A0A1H3VUJ4_9BACI/53-171     AC A0A1H3VUJ4.1
#=GS A0A0L9U961_PHAAN/1-86       AC A0A0L9U961.1
#=GS A0A287RUS7_HORVV/190-299    AC A0A287RUS7.1
#=GS A0A1S3CPV0_CUCME/143-246    AC A0A1S3CPV0.1
#=GS A0A074YPN2_AURSE/33-119     AC A0A074YPN2.1
#=GS A0A2Z4GHU7_9BACT/16-117     AC A0A2Z4GHU7.1
#=GS X5KTF5_9MYCO/53-146         AC X5KTF5.1
#=GS F4A079_MAHA5/50-159         AC F4A079.1
#=GS A0A445K3S0_GLYSO/64-155     AC A0A445K3S0.1
#=GS A0A117NUH7_9ACTN/76-181     AC A0A117NUH7.1
#=GS A0A453T6S8_AEGTS/55-146     AC A0A453T6S8.1
#=GS A0A287EIB5_HORVV/17-110     AC A0A287EIB5.1
#=GS X2JB52_DROME/38-142         AC X2JB52.1
A0A3B6LL81_WHEAT/85-203                .....................................................PEQIALAA.....SA..D....PS.....SL.WVSWV..T...G...............................................................................R................AQ..VGShltpld..ptairsEV.W..Y.SER.....P.AStd......................................tvgH.P.HV.......A.R..G..S......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GVIH..H.V..RLV.....G............L..TPST.RYY.......Y..RC...............GDS...SLk...............................dGLS.D.E..RSFRT............................................
A0A1L6J9X3_9SPHN/38-138                .....................................................PERIILNL.....TA.rP....AT.....EM.AVTWR..S...A...............................................................................P................G-..SAG..............VV.Q..F.ARA.....T.AG...........................................P.D.FV......kA.P..Q..Q......IA....A.T.T.-DDatld.............................................................................vqeqaGF.H..AAYH..S.A..VMT.....G............L..EPDS.VYA.......Y..RV...............GDG...R-.................................NWS.E.W..FQFRT............................................
A0A0E0HU23_ORYNI/54-145                .....................................................PQQVHITQ.....GD.yN....GK.....AV.IVSWV..T...V...............................................................................A................EP..GTS..............EV.L..Y.GKN.....E.HQ...........................................Y.D.QR.......A.E..G..T......VT....N.Y.T.FYD......................................................................................YK.S..GYIH..H.C..LVD.....G............L..EYNT.KYY.......Y..KI...............GSG...D-.................................-SA.R.E..FWFET............................................
A0A0E0GWH4_ORYNI/8-89                  .................................................ldpt--------.....--..-....--.....--.-----..-...-...............................................................................-................-A..VAS..............VV.R..Y.GLA.....A.DS...........................................L.V.RR.......A.T..G..D......AL....V.Y.S.QLYpfd...............................................................................gllnYT.S..AIIH..H.V..RLQ.....G............L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.D.I..HAFRT............................................
A0A1M6USY5_9FLAO/45-146                .....................................................PDRIVLSF.....GE.dP....ST.....SA.SVTWR..T...T...............................................................................S................EI..DTA..............YA.E..I.AIA.....T.AA...........................................P.K.FW.......R.N..A..T......TV....Q.A.S.TSTfdal.............................................................................eideaEV.L..ANYH..S.V..WFT.....D............L..KSDT.TYA.......Y..RV...............GDG...K-.................................RWS.E.W..IQFKT............................................
A0A1N6NXG8_9GAMM/46-141                .....................................................PDRIIASP.....AQ.dA....SS.....GF.AVNWR..T...N...............................................................................D................RV..QSP..............VI.E..I.RIA.....T.DSpd.......................................vgE.P.RR.......I.T..A..V......TR....A.W.Q.-AS......................................................................................NG.G..VHVH..R.A..DID.....G............L..APDT.LYM.......F..RV...............QGE...G-.................................SWS.G.W..RQLRT............................................
W5TIM5_9NOCA/115-208                   ...................................................va--GVHLQY.....GA.dA....AR.....EV.VVSWH..T...T...............................................................................T................AV..RNP..............MV.R..F.GTP.....T.AG...........................................F.G.TT.......V.E..A..Q......TR....T.Y.R.DAA.....................................................................................sGT.E..VRVH..H.A..RLT.....G............L..TPDA.EYV.......Y..AA...............GHD...G-.................................-AS.P.-..-----elgtlrt.....................................
A0A340XTR5_LIPVE/87-182                .....................................................PEQVHLSY.....PG..E....TG.....CM.TVTWT..T...W...............................................................................V................PT..PSE..............VQ.L..F.GLQ....lW.GP...........................................L.P.LR.......A.Q..G..T......FS....P.F.V.DGGi...................................................................................lwRK.L..YIHD..R.V..TLQ.....G............L..LPRV.QYV.......Y..RC...............GST...Q-.................................GWS.R.R..FLFR-a...........................................
S2YUM0_9CORY/46-132                    ...................................................qs--SVVLQP.....GS..T....GA.....EA.IVSWQ..T...V...............................................................................G................T-..APE..............QL.K..V.TGS.....F.GTr.........................................lV.D.AS.......V.P..P..T......A-....-.-.-.---......................................................................................QL.L..TQAR..T.A..TIT.....G............L..EPGE.TYR.......Y..QV...............GSE...ET.................................GWS.A.E..YEYTT............................................
A0A2T4CBI6_TRILO/34-120                .....................................................PVQQRIAV.....NG..-....PS.....SV.SIGWN..T...Y...............................................................................Q................RL..SQP..............CV.D..Y.GTS.....A.TS...........................................L.T.QQ.......A.C..S..Q......SS....V.T.-.-YQ......................................................................................TS.R..TWSN..V.V..TLS.....G............L..SSAT.TYY.......Y..KI...............VST...N-.................................--S.S.V..DHF--ls..........................................
A0A287RAK6_HORVV/1-110                 ....................................................a--------.....--..D....PT.....SL.WVSWV..T...G...............................................................................R................AQ..VGShltpld..ptairsEV.W..Y.GER.....P.ASad......................................tvgH.P.HV.......A.R..G..S......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GVIH..H.V..RLV.....G............L..RPST.RYY.......Y..RC...............GDS...SLk...............................gGLS.D.E..RSFRT............................................
A0A1U7XGC1_NICSY/168-276               .................................................pvyp----RLAQ.....GK..T....WD.....EM.TVTWT..S...G...............................................................................Yg..............iNE..AEP..............FV.E..W.GRK.....G.GQ...........................................K.G.RT.......P.A..G..T......L-....T.F.D.RSSmcgap...........................................................................artvgwRD.P..GFIH..T.S..FLK.....E............L..WPNS.LYT.......Y..ML...............GHRf.fNGt...............................yIWS.Q.M..YQFK-s...........................................
B9H0V4_POPTR/81-172                    .....................................................PQQVHITQ.....GD.hV....GK.....GV.IVSWV..T...A...............................................................................D................ES..GSN..............TV.I..Y.WSE.....S.SK...........................................Q.K.KE.......A.E..G..K......TY....T.Y.K.FYN......................................................................................YT.S..GYIH..H.C..IIR.....N............L..EFNT.KYY.......Y..VV...............GVG...N-.................................-TT.R.Q..FWF--it..........................................
A0A445LN38_GLYSO/19-127                .................................................plyp----RLAL.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yg..............iND..AEP..............FV.Q..W.GPK.....E.GD...........................................R.-.MH.......S.P..A..E......TL....T.F.T.RDSmcgap...........................................................................artvgwRD.P..GYIH..T.S..HLK.....E............L..WPNK.IYE.......Y..RI...............GHK..lNNv..............................tyIWS.G.N..YQFT-a...........................................
A0A2I0ALE8_9ASPA/209-309               .................................................plfg----HLSG.....IN.sT....GT.....SM.RLTWV..S...G...............................................................................D................S-..SPQ..............HV.Q..Y.ADG.....Q.STds.......................................evS.T.FR.......Q.D..D..M......CS....E.L.S.PAKdf..................................................................................gwHD.P..GYIH..T.A..IMT.....G............L..QPST.SYF.......Y..KY...............GSD...SV.................................GWS.K.D..INFRT............................................
A0A2A2YUS5_9ACTN/78-183                .....................................................PFGRHLAF.....GA.dP....KT.....QM.RISWQ..V...P...............................................................................L................AV..RGP..............YV.R..V.GLR.....P.DD...........................................L.S.RK.......I.E..A..E......VR....D.L.H.TPGvtg................................................................................vrpAL.D..QYYL..H.A..ALD.....G............L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................speRRS.T.I..GSFRT............................................
A0A0N5BA92_STREA/28-125                ....................................................h-EQVHLSL.....AK..N....PR.....TM.VVQWT..T...F...............................................................................Ydl............srNH..RKP..............MV.R..Y.GTI.....K.SY...........................................T.I.RI.......K.S..G..H......TK....K.L.V.ESEn....................................................................................aNI.T..RYFH..T.V..YLK.....N............L..YYDK.KYY.......Y..KV...............GDG...K-.................................TWS.K.K..FYFRT............................................
A0A0W8CCA0_PHYNI/68-165                .....................................................PQQIHLAF.....AG.aK...vGT.....AM.TVSWA..T...F...............................................................................E................DV..SDS..............SV.W..V.GSS.....E.DS...........................................L.E.LV.......D.T.pV..S......SD....S.Y.Y.SDD......................................................................................EY.N..LFHH..H.A..TIT.....G............L..KPRT.KYF.......Y..KV...............GSR...GDe...............................kYTS.D.V..SLF--it..........................................
A0A2M9IK43_9ACTN/48-143                ...................................................ft--GIILGV.....GA..N....ES.....QR.TVTWY..S...S...............................................................................A................D-..TAQ..............KV.Q..L.APT.....A.QV...........................................D.K.GE.......F.P..A..S......AI....T.F.D.ALGge.................................................................................niaTS.G..GYNR..H.A..TLT.....G............L..REHT.AYS.......Y..RV...............GSE...G-.................................NWS.S.A..YSFKT............................................
N6WMQ7_9EURY/37-120                    .........................................vsitigpypqnt--------.....--..D....LD.....SA.YIIWQ..T...N...............................................................................I................TT..VNN..............SV.H..F.GFN.....P.DC...........................................D.N.II.......Y.E..-..-......--....-.-.-.---......................................................................................NI.N..AEFH..K.I..ELD.....E............L..KPST.KYY.......Y..KV...............MSD...E-.................................IES.D.V..YMFHT............................................
A8X727_CAEBR/21-107                    .....................................................PDQVHLSF.....TG..D....MT.....EM.AVVWN..T...F...............................................................................A................E-..ASQ..............DV.Y..Y.KKI.....G.IG...........................................A.S.ST.......A.K..G..S......SE....A.W.I.YG-......................................................................................GI.T..RYRH..K.A..TMT.....G............L..DYFS.EYE.......Y..TI...............ASR...T-.................................---.-.-..FS---fktls.......................................
A0A100YU31_9FIRM/56-148                ..................................................ash---VRQII.....TR.dS....MT.....SR.TIMWQ..S...D...............................................................................F................SE..EPA..............LV.E..Y.RVK.....G.SD..........................................gD.V.FQ.......Q.Q..A..T......NE....A.F.N.DD-......................................................................................DT.T..TYVH..S.A..LLQ.....D............L..TPGT.TYE.......Y..RV...............GYG...E-.................................KRT.E.W..QEFQT............................................
A0A0E0MJN8_ORYPU/44-131                .....................................................PQQVHISA.....VG..-....SD.....KM.RVTWI..T...D...............................................................................D................D-..APA..............TV.E..Y.GTV.....S.GE...........................................Y.P.FS.......A.A..G..N......TT....T.Y.S.YIL......................................................................................YN.S..GNIH..D.A..VVG.....P............L..KPST.TYY.......Y..RC...............SND...T-.................................--S.R.E..LSFRT............................................
K7IM68_NASVI/29-120                    .....................................................PEAVHIAY.....GE..D....IH.....DI.VVTWS..T...R...............................................................................Q................DT..QES..............IV.E..Y.GIN.....G.YA...........................................L.T.AY.......G.N..S..T......LF....V.D.G.GPK......................................................................................KH.R..QYIH..R.V..WLK.....N............L..TPNS.KYV.......Y..HC...............GSG...L-.................................GWS.D.V..FYFNT............................................
A0A1B0C504_9MUSC/493-607               ......................pmqihlsfagndetkrkksyfmlsftyihtd--------.....--..T....VR.....DI.VVTWS..T...E...............................................................................L................KS..RTS..............VC.K..Y.GRR.....H.VE..........................................fA.E.EN.......I.D..G..P......TL....F.I.D.QGV.....................................................................................nRR.R..QFIH..R.V..LLK.....N............L..TENV.CYK.......Y..YC...............GSD...L-.................................GWS.P.E..YWF--cv..........................................
A0A2H3HID0_FUSOX/69-173                ................................................snnvn-----VIS.....LS.yT....PG.....GI.NIHYQ..T...P...............................................................................F...............gLG..AAP..............AV.H..W.GTS.....A.SE...........................................L.K.NK.......A.T..G..S......TT....T.Y.D.RTPpcsa.............................................................................vkavtQC.N..QFFH..D.V..QIS.....D............L..KPGK.TYY.......Y..QI...............PAA...NG................................tTKS.D.V..LSFTT............................................
A0A453K9I6_AEGTS/8-96                  ...................................................kl--NVHIST.....VG..-....HD.....EM.RVTWI..T...E...............................................................................D................D-..APA..............VV.E..Y.GMT.....S.GQ...........................................Y.P.FS.......A.T..G..T......TT....S.Y.S.YLA.....................................................................................lYR.S..GNIH..D.A..VVG.....P............L..KPST.TYY.......Y..RC...............SSD...P-.................................--S.R.E..FSFRT............................................
G0RRS8_HYPJQ/66-169                    ..........................................snnvnvisvsy--------.....--..I....PN.....GI.NIHYQ..T...P...............................................................................F...............gLG..EAP..............SV.V..W.GTS.....A.SD...........................................L.S.NT.......A.T..G..K......TV....T.Y.G.RTPpcsl..............................................................................aattQC.S..EFFH..D.V..QIS.....N............L..KSGA.TYF.......Y..RI...............PAA...NG................................tTAS.D.I..LSFKT............................................
A0A0M8T8V0_9ACTN/80-206                .....................................................PFGRHLAY.....GA.dP....RT.....QM.RVSWQ..V...P...............................................................................F................AV..KKP..............YI.R..I.GTS.....P.WS...........................................L.S.RK.......I.D..A..E......VR....H.L.T.TPAlng...............................................................................gkiaAA.E..QFYV..H.A..GLD.....R............L..RPGQ.TYY.......Y..GV...............GHD...GF.................................---.-.-..-----dpadrrnlgtlgtfttapahaenftftafgdqgvsy........
A0A0E0QGQ9_ORYRU/77-203                .....................................................PEQIALAA.....SS..D....AT.....SV.WVSWV..T...G...............................................................................Eaqvgsh....ltpldpST..VRS..............EV.W..Y.SER.....P.SPtaaaa................................gdvsghY.P.HV.......A.R..G..K......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GAIH..H.V..RLR.....G............L..RPAT.RYY.......Y..RC...............GDS...SVrg.............................gaGLS.G.E..LSFET............................................
C3Z3N2_BRAFL/38-129                    .....................................................PQQVHLSY.....AG..S....AS.....EM.MVTWS..T...A...............................................................................N................K-..TDS..............VV.E..Y.GEG.....G.--...........................................L.V.KT.......A.R..G..S......SV....E.F.E.DGGd....................................................................................eHR.V..QYIH..R.V..TLT.....G............L..TPGH.TYM.......Y..HC...............GSM...EG.................................GWS.D.L..FVFT-a...........................................
A0A0F5VT18_9ACTN/75-180                .....................................................PFGRHLAF.....GA.dP....RT.....EL.TVSWQ..V...P...............................................................................V................AV..KKP..............FL.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.Y.TPAgvg................................................................................asgDH.T..QYYV..H.A..ELS.....R............L..KPGR.TYY.......Y..GV...............GHQ...G-.................................---.-.-..-----fdpaephllgtlgtftt...........................
I4YJ71_WALMC/18-112                    .................................................tyqq----RLAY.....AG..-....DD.....GV.NIAFN..T...K...............................................................................Gn.............ntLH..STP..............TV.F..Y.GTS.....K.DD...........................................L.T.MQ.......A.Q..G..L......SS....I.Y.Q.T--......................................................................................-S.L..STTH..K.V..KLR.....N............L..NPDT.RYF.......Y..QT...............CLD..iNNe...............................cPRS.D.V..LSFKT............................................
A0A0S3RUT0_PHAAN/71-183                .....................................................PEQISLSL.....ST..T....HD.....SV.WISWI..T...G...............................................................................Efqigfn....ikpldpKT..VAS..............VV.Q..Y.GTS.....R.FD...........................................L.V.HE.......A.R..G..E......SL....I.Y.N.QLYpfd...............................................................................glrnYT.S..GIIH..H.V..RLI.....G............L..EPST.LYY.......Y..QC...............GDP...SL................................qAMS.D.I..NYFRT............................................
A0A1U8KRF7_GOSHI/141-245               .....................................................PEQIHLAL.....TG..R....EG.....EM.RVMFV..A...E...............................................................................D................P-..EER..............QV.R..Y.GEK.....E.GE..........................................wE.G.DV.......A.V..A..R......VG....R.Y.E.REDmchapa..........................................................................nesvgwRD.P..GWIF..D.A..VMS.....G............L..KGGV.KYY.......Y..QV...............GSE...SK.................................GWS.T.T..RSF--vs..........................................
A0A094GYC7_9PEZI/37-130                ....................................................n-SQIRLAY.....AG..-....DT.....GM.FVSWN..T...F...............................................................................D................HL..SNP..............TV.H..Y.GLS.....P.DA...........................................L.T.ET.......A.S..S..E......VS....-.I.T.YP-......................................................................................TS.L..TYNN..H.V..KLT.....G............L..KPDT.LYY.......Y..LP...............GHL..lTA................................tDTS.V.P..FTFKTsr..........................................
A0A3B6TM66_WHEAT/55-146                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................S................EP..APS..............QV.F..Y.SKE.....E.NR...........................................Y.D.QK.......A.Q..G..T......MT....N.Y.T.FYD......................................................................................YK.S..GYIH..H.C..LVD.....G............L..EYNT.KYY.......Y..KI...............GTG...D-.................................-SA.R.E..FLF--qt..........................................
A0A059LGY9_9CHLO/122-225               .....................................................PTGVHLLA.....GR..S....PR.....SV.LVQWT..T...F...............................................................................N................P-..GSP..............QV.W..F.GTS.....P.DR...........................................L.Q.WS.......A.P..A..S......SD....T.Y.T.PATlcggr...........................................................................asnegwLE.P..GYLH..T.A..DML.....N............L..PKAT.DIF.......Y..QV...............GDA..vTG.................................VKS.R.V..YSF--fs..........................................
S2D0A0_9BACT/27-112                    .....................................................PHAFYLTW.....TE.dP....TS.....SM.DVDWH..T...D...............................................................................S................S-..EPL..............NL.Y..L.RRK.....G.TA...........................................D.W.RS.......L.V..S..A......VL....P.Y.-.--P......................................................................................FS.E..RHVH..R.V..AVR.....G............L..RPDT.AYE.......L..RF...............VEN...G-.................................---.T.V..YYFKT............................................
A0A1D6KKC7_MAIZE/204-316               ..................................................pvf---PRLAQ.....GT..S....HD.....EM.TVTWT..S...G...............................................................................Ya..............iDE..AYP..............FV.E..W.GAL.....V.AGg........................................vrH.T.AR.......A.P..A..G......TL....T.F.N.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FLR.....D............L..WPNK.EYH.......Y..RI...............GHEl.pDGs...............................vVWG.K.P..YSFR-a...........................................
S3B9K3_9BURK/56-200                    .....................................................PNRIVVTI.....KG.dP....RT.....SR.GFSWF..M...N...............................................................................A................AP..DDL..............NV.E..L.SPS.....S.DFaqi.....................................triP.V.QT.......V.Q..V..Q......SR....-.-.-.--Flertadghflfraekadstilgyft....................................degrsvkwrpkdgarksdhveigvlTR.P..ETIC..R.A..EVS.....S............L..SPGT.LWY.......W..RI...............AAK...GK.................................VLS.P.V..GSFKT............................................
A0A1V9G210_9BACT/54-151                .................................................tpyl--------.....QQ.pT....PD.....SM.VVMFI..T...N...............................................................................L................P-..AYS..............WV.E..F.GET.....T.TL...........................................G.-.QK.......A.Q..S..-......--....V.T.N.GLV......................................................................................DA.Y..NRVN..R.I..RLG.....K............L..KPGT.KYY.......Y..RV...............ISK...EI.................................---.-.-..-----tgfepykltygdtlesdllsfst.....................
A0A2H5PFE3_CITUN/174-282               .................................................plyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Yd..............iSE..AAP..............FV.E..W.GLK.....G.DL...........................................Q.M.HS.......P.A..G..T......LT....F.F.Q.NDMcgspa............................................................................rtvgwRD.P..GFIH..T.S..FLK.....N............L..WPNT.VYT.......Y..RI...............GHLl.hNGs...............................yVWS.K.I..YSFR-a...........................................
V4MHN2_EUTSA/172-280                   ..................................................pvy---PRLAL.....TK..N....WD.....EM.TVTWT..S...G...............................................................................Y................NI..NEAv............pFI.E..W.SSK.....G.LP...........................................S.R.RS.......P.A..G..T......I-....T.F.N.RNSmcgdp...........................................................................argvgwRD.P..GFFH..T.A..FLK.....E............L..WPNR.EYT.......Y..RL...............GHEl.vNGs...............................tIWS.K.N..YTF--vs..........................................
A0A3E0HFY7_9PSEU/62-173                .....................................................PTARHLAF.....GR.nP....RT.....EM.RVGWQ..V...P...............................................................................A................PV..RKP..............FV.R..V.GTD.....P.KH...........................................L.S.QR.......I.P..A..E......VR....A.L.H.SEVpg.................................................................................viaPY.D..QYYL..H.A..ELC.....G............L..RPGQ.SYY.......Y..TV...............GHE...GYegga........................lstfrT--.-.-..-----aparwlptrpftf...............................
A0A314XUJ8_PRUYE/49-136                .....................................................PQQVHISL.....VG..-....KD.....HM.RVSWV..T...D...............................................................................S................KH..GKS..............VV.E..Y.GKA.....P.GK...........................................Y.N.GK.......A.T..G..E......DI....S.Y.K.YFF......................................................................................YS.S..GKIH..H.V..TIG.....P............L..EPAT.IYY.......Y..RC...............GGS...E-.................................---.Q.E..FSFKT............................................
A0A251T3U9_HELAN/253-361               .............................................pnyprlaq--------.....GK..L....WN.....VT.TVTWT..S...G...............................................................................Ys..............iRE..SEP..............FV.E..W.GKQ.....G.EK...........................................Q.R.R-.......S.T..A..K......TL....T.F.N.RNSmcgap...........................................................................aktvgwRD.P..GYFH..T.S..FLT.....G............L..WPNS.LYT.......Y..KL...............GHK..lSNn..............................tvIWS.Q.V..YEFK-s...........................................
K7LFF7_SOYBN/72-174                    .................................................plyg----HISS.....ID.sT....GT.....SM.RLTWV..S...G...............................................................................D................K-..EPQ..............QI.Q..Y.GNG.....K.TV...........................................T.S.AV.......T.T..F..S......QD....D.M.C.SSTlpspa............................................................................kdfgwHD.P..GYIH..S.A..LMT.....G............L..KPSS.TFS.......Y..RY...............GSG...SV.................................GWS.E.E..IKFST............................................
A0A0M3RE16_9BACI/985-1090              .................................................ikni----LSNP.....TG.dP....YK.....TK.SFTWM..S...S...............................................................................P...............lTE..AGA..............MV.K..F.ARK.....Q.DYerk.....................................gedA.F.ET.......A.T..G..T......S-....-.-.-.--Ssqvfsg..........................................................................eldikkNG.I..VRVN..E.V..KLS.....K............L..QQDT.TYV.......Y..QV...............GDG...E-.................................NWS.P.I..EEFTT............................................
R7CGS9_9FIRM/55-149                    ...................................................ft--KVSLTP.....GA..D....DT.....QL.NFAWY..S...E...............................................................................Kg..............dSD..ATP..............VV.H..F.GTD.....K.DN...........................................L.E.-T.......F.E..G..T......AG....D.V.D.QSLt....................................................................................gDK.A..YEYN..H.V..TVT.....G............L..EPNT.TYY.......Y..TV...............EKN...G-.................................EQT.E.V..SEYKT............................................
A0A3B6C6V6_WHEAT/47-134                .....................................................PQQVHLSV.....VG..-....AN.....HM.RVSWV..T...D...............................................................................A................KH..GHS..............VV.E..Y.GRA.....S.GS...........................................Y.T.TS.......A.T..G..E......HT....S.Y.R.YYL......................................................................................YS.S..GKIH..H.V..TIG.....P............L..DPDT.VYY.......Y..RC...............GVV...G-.................................---.-.-..-----defalkt.....................................
A0A168LPI5_9BACL/89-188                ....................................................v-NKITVTF.....NG.dT....TT.....SK.GFTWY..S...K...............................................................................V...............tDS..VYG..............DL.Q..V.VEM.....K.EG...........................................S.Q.ID.......F.T..S..S......QN....F.V.A.RSSia..................................................................................knSP.T..ELMY..K.A..EAT.....S............L..KPDT.AYY.......F..RI...............GNEl.lN-.................................SWS.D.V..GTFRT............................................
V4RIF8_9ROSI/78-189                    .....................................................PEQIALAI.....SS..-....PT.....SM.WVSWV..S...G...............................................................................Daqigsn....vtpldpST..VAS..............DV.W..Y.GKQ.....S.GK...........................................Y.T.SK.......R.G..G..N......AT....V.Y.S.QLYpfk...............................................................................gllnYT.S..GIIH..H.V..KID.....G............L..DPGT.KYY.......Y..KC...............GDS...KI................................pAMS.A.E..HVFET............................................
H3GZF9_PHYRM/91-189                    .....................................................PQQFHLAF.....AGeeA....GT.....GM.AISWT..T...F...............................................................................A................LD..SDP..............TL.W..L.GRS.....E.TK...........................................L.K.VVs.....sA.K..I..E......TK....S.Y.Y.KDK......................................................................................DY.E..LYSY..H.A..VVS.....G............L..KPNK.EYF.......Y..KV...............GNA...DNk...............................lFQS.G.V..SSFTT............................................
A0A1C4IE37_9ACTN/48-143                ...................................................at--GIILGV.....GA..N....ET.....QR.TVSWY..T...S...............................................................................E................D-..SAQ..............QV.Q..L.VPT.....A.RL...........................................A.N.GE.......F.P..A..D......AA....V.F.D.ASGsa.................................................................................niaTS.G..GFNR..H.A..TLT.....G............L..QEHT.AYS.......Y..RV...............GTA...G-.................................SWS.P.T..YSFKT............................................
A0A453D6Z0_AEGTS/1-79                  .....................................................--------.....--..-....--.....-M.RISWV..T...D...............................................................................D................RN..TPS..............VV.E..Y.GES.....R.GN...........................................Y.T.AS.......A.T..G..D......QA....T.Y.K.YFF......................................................................................YE.S..GAIH..H.V..TIG.....P............L..APGT.TYH.......Y..RC...............GKA...GD.................................---.-.-..-----eltlrtppas..................................
A0A3B6MT22_WHEAT/170-278               ..................................................pvy---PRLAL.....GK..T....WN.....EM.TVTWT..S...G...............................................................................Yg..............iSE..AHP..............FV.E..W.GMK.....G.SH...........................................P.-.VH.......A.P..A..D......TV....T.F.G.RESlcgep...........................................................................arsvgwRD.P..GFIH..T.A..FLK.....N............L..SPEK.EYY.......Y..KI...............GHT..lHDg..............................kvVWG.K.P..KSFR-a...........................................
A0A3N4U092_9ACTN/48-141                ...................................................ia--AIHLEL.....VT.lA....ED.....HA.VITWH..T...G...............................................................................Vpdgr.......grllpVV..TEG..............EV.V..Y.GTH.....P.GR...........................................L.T.RV.......A.G..-..-......--....-.-.-.--S......................................................................................ER.P..TAHH..H.I..ELT.....G............L..EPGQ.TYY.......Y..QA...............RSR...G-.................................---.-.-..-----vtatptplhlv.................................
A0A1Y1UMI4_9TREE/63-147                ...................................................as--QIRTAY.....RG..-....CN.....GM.SVSWS..T...N...............................................................................G................RN..VVP..............TV.L..Y.GTS.....N.SS...........................................L.N.WT.......A.T..S..S......VS....-.I.T.-YE......................................................................................TS.L..KWEN..H.V..VLE.....N............L..EPNT.KYY.......Y..SV...............CG-...--.................................--S.P.V..NSFTT............................................
F9WZK8_ZYMTI/29-116                    .....................................................PVQQRLAY.....AG..-....PD.....SM.SVGWN..T...Y...............................................................................A................RQ..DQS..............CV.T..Y.GTS.....S.SS...........................................L.P.WQ.......A.C..S..S......NS....Q.T.-.-YA......................................................................................TS.R..TWYN..T.V..TLT.....G............L..KPAT.TYY.......Y..KI...............VSG...N-.................................--S.S.V..EHF--vsp.........................................
A0A445IJ75_GLYSO/47-134                .....................................................PQQVHISL.....VG..-....ND.....HM.RVSWI..T...D...............................................................................D................KH..SES..............VV.E..Y.GTK.....K.GE...........................................Y.S.TK.......A.T..G..E......HT....S.Y.H.YFL......................................................................................YE.S..GKIH..H.V..VIG.....P............L..QPNT.IYY.......Y..RC...............GGS...G-.................................---.S.E..FSFKT............................................
G4YJW0_PHYSP/154-259                   .....................................................PKHGHLSL.....TD..D....DT.....AM.AIMFN..T...A...............................................................................S................S-..KTP..............MV.K..Y.GEN.....P.QD...........................................L.K.HQ.......A.T..G..T......ST....T.Y.G.ADDlchapan........................................................................vlgqrafRD.P..GYMH..T.I..IMK.....D............L..KPDT.YYY.......Y..QY...............GHE...EY.................................GLS.H.V..RRFK-s...........................................
A0A2T7EIB6_9POAL/170-278               .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yd..............iTE..AVP..............FV.E..W.GEK.....G.GR...........................................-.Q.FL.......A.P..A..G......TL....T.F.D.KNSmcgap...........................................................................artvgwRH.P..GYIH..T.S..YLK.....D............L..WPDS.LYT.......Y..RL...............GHRl.mNGt...............................rIWS.K.S..YSFK-a...........................................
A0A287PH98_HORVV/22-130                .................................................pvyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Ys..............tKE..ATP..............FV.E..W.GIQ.....G.QI...........................................Q.I.LS.......-.P..A..G......TL....T.F.S.RDTmcgpp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNL.KYT.......Y..RI...............GHRl.fNGq...............................iVWG.R.Q..YSFK-a...........................................
A0A0Q9B4F6_9ACTN/73-178                .....................................................PFGRHLAY.....GN.dP....RT.....EM.TVSWQ..V...P...............................................................................V................AV..QKP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.Y.TPAgvg................................................................................asgDH.T..QYYV..H.A..ELT.....C............L..KPGR.TYY.......Y..GV...............GHA...G-.................................---.-.-..-----fdpaaphllgtlgtftt...........................
A0A329SKP7_9STRA/95-193                .....................................................PQQFHLAF.....AGkeA....GT.....GM.AISWT..T...F...............................................................................A................LE..EDP..............AV.W..M.GAT.....E.GK...........................................L.T.QV.......K.D..A..T......IE....T.K.S.YYKd....................................................................................dHY.E..LYSY..H.A..VVE.....G............L..KPNK.EYF.......Y..KV...............GSA...SKt...............................kFQS.A.V..SSFTT............................................
X8CGV6_MYCIT/60-153                    ..................................................igg---LHLQF.....GR.dA....AT.....EV.VVSWH..T...T...............................................................................D................AV..RNP..............RV.L..L.GTP.....T.SG...........................................F.G.RT.......V.A..A..E......TR....T.Y.R.DAK.....................................................................................sGT.E..VRVN..H.A..RLT.....D............L..TPDT.DYV.......Y..AA...............VHD...G-.................................AEP.E.Q..-----gtvrt.......................................
A0A250X2B5_9CHLO/5-47                  ...............................................tlrsyi--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.-.--.......-.-..-..-......--....-.-.-.---......................................................................................--.S..PLIS..H.V..VLH.....D............L..QPGT.TYF.......Y..MV...............GDG...AD.................................SWS.T.A..KSFST............................................
D8LE49_ECTSI/164-278                   ...................................................vl--HLHLAL.....TS..D....VD.....SM.RVSWV..T...G...............................................................................E................AS..QAP..............AV.M..F.REV.....A.VGaqegv................................tetqvdP.W.QE.......V.A..A..E......SS...iT.Y.G.--Redmcge.........................................................................patsngfHN.P..GLLH..S.A..VLP.....G............L..IPGH.PYE.......Y..KA...............GDS...D-.................................-AQ.E.W..G----sssff.......................................
K7LXJ7_SOYBN/67-178                    ....................................................a-EQIALAI.....SS..-....PT.....SM.WVSWV..T...G...............................................................................Daqigln....vtpidsAS..VES..............EV.W..Y.GKE.....S.GK...........................................Y.I.SV.......R.K..G..D......SV....V.Y.S.LLYpfe...............................................................................glwnYT.S..GIIH..H.V..KLK.....G............L..EPST.RYY.......Y..KC...............GDS...ST................................pAMS.R.E..FIFET............................................
A0A059BMC4_EUCGR/165-252               ....................................................h-ETVHISL.....AG..-....EG.....HM.HISWV..T...D...............................................................................G................KS..SPS..............YM.E..Y.GTS.....P.GR...........................................Y.D.ST.......A.Q..G..E......ST....S.Y.S.YLF......................................................................................YS.S..GRIH..H.T..VIG.....P............L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.P.-..-----efqlkt......................................
A0A287EI94_HORVV/3-74                  .................................................rrta--------.....--..-....--.....--.-----..-...-...............................................................................-................-S..APS..............VV.E..Y.GTS.....P.GN...........................................Y.T.AS.......A.E..G..S......HT....T.Y.R.CSS.....................................................................................yYS.S..GAIH..E.V..TIG.....P............L..KPST.TYY.......Y..RC...............GKV...G-.................................---.-.-..-----dadmslrtp...................................
A0A2R7KY54_9SPHI/35-116                ................................................gpylq--------.....-A.aS....ST.....GI.VVRWR..T...D...............................................................................V................S-..SRS..............RV.R..F.GVS.....P.DR...........................................L.D.QQ.......V.D..D..T......RL....-.-.-.---......................................................................................--.-..LTEH..Q.V..KLN.....D............L..KPYT.KYY.......Y..AI...............GGF...--.................................---.-.-..-----qdtlqvgkdnsfmt..............................
A0A1S4DIR5_TOBAC/168-276               .................................................pvyp----RLAQ.....GK..T....WD.....EM.TVTWT..S...G...............................................................................Yg..............iNE..AEP..............FV.E..W.GRK.....G.GQ...........................................K.G.RT.......P.A..G..T......L-....T.F.D.RSSmcgap...........................................................................artvgwRD.P..GFIH..T.S..FLK.....E............L..WPNS.LYT.......Y..ML...............GHRf.fNGt...............................yIWS.Q.M..YQFK-s...........................................
A0A2P7PY99_9ACTN/55-149                ...................................................vl--GVHLQF.....GS.dP....SS.....EM.TVSWI..T...P...............................................................................Q................SV..RRP..............QV.R..L.GTP.....E.GG..........................................hG.G.RV.......V.E..A..E......TR....T.Y.R.DGL.....................................................................................sKE.E..VYVH..H.A..RIT.....G............L..RSSA.TYL.......Y..AA...............GHD...G-.................................ATP.E.T..GSFTT............................................
A0A078M3X7_9STAP/80-231                .....................................................PNRIITTI.....NG.nT....QT.....EM.AFNWY..T...T...............................................................................D................LF..EDA..............KV.W..V.SKS.....G.NFd........................................dtL.E.FK.......A.E..A..T......KV....T.S.S.YGErdktgnyifaevkensegepvedenge...............................pvlngyytdrqahgddwmsgdyghieltDV.T..EYSY..K.A..KAT.....D............L..EQNT.DYY.......Y..QV...............GSE...SG.................................KVS.E.T..GTFKT............................................
A0A423XFT1_9PEZI/33-120                .....................................................PVQTRLAI.....SG..-....AN.....SI.SVGWN..T...Y...............................................................................E................EL..DQP..............CV.K..Y.GTE.....S.DS...........................................L.D.LE.......S.C..S..T......IS....V.T.-.-YN......................................................................................TS.R..TWSN..T.V..ILS.....N............L..TAGS.TYY.......Y..QI...............VST...N-.................................--S.T.V..ESF--lsp.........................................
A0A3B6LL30_WHEAT/85-203                .....................................................PEQIALAA.....SA..D....PS.....SL.WVSWV..T...G...............................................................................R................AQ..VGShltpld..ptairsEV.W..Y.SER.....P.AStd......................................tvgH.P.HV.......A.R..G..S......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GVIH..H.V..RLV.....G............L..TPST.RYY.......Y..RC...............GDS...SLk...............................dGLS.D.E..RSFRT............................................
A0A3L6PLL3_PANMI/40-131                ..................................................yva---VHISA.....VG..-....EG.....RK.GITWV..T...D...............................................................................D................RS..APS..............VV.E..Y.GTA.....P.GK...........................................Y.S.AS.......E.A..G..Y......HT....A.Y.Q.FLS......................................................................................YT.S..GAIH..R.V..TIG.....P............L..APGT.TYY.......Y..RC...............GEA...GD.................................EFS.L.W..-----tppat.......................................
A0A409YDC4_9AGAR/37-127                .....................................................PVQIRQAY.....AG..-....PT.....GM.LVSWN..T...F...............................................................................S................KL.pATP..............SV.H..Y.GFS.....P.EF...........................................L.P.FV.......S.S..S..R......NT....E.S.V.TYP......................................................................................TS.L..TFNN..H.V..RLT.....N............L..FPNT.KYY.......W..RP...............AFS...N-.................................-AT.S.I..FSFTT............................................
R0G573_9BRAS/57-148                    .....................................................PQQVHITQ.....GD.vE....GK.....AV.IVSWV..T...Q...............................................................................E................AK..GSN..............KV.I..Y.WKE.....N.SS...........................................K.K.YK.......A.H..G..K......TN....T.Y.K.YYN......................................................................................YT.S..GYIH..H.C..PIR.....N............L..EYDT.KYY.......Y..VV...............GVG...E-.................................-TE.R.Q..F----wfft........................................
W2PQU2_PHYPN/95-193                    .....................................................PQQFHLAF.....AGkvA....GT.....GM.TISWT..T...F...............................................................................A................LE..KKP..............AV.W..I.GTS.....E.SK...........................................L.T.IV.......K.D..A..T......IE....T.K.S.YYKd....................................................................................dHY.E..LYSY..H.A..VVG.....G............L..KPNK.EYF.......Y..KV...............GSG...SEt...............................kFQS.A.V..SSFTT............................................
U2T819_LEIAQ/19-112                    ...................................................qt--DIVLGV.....GA..D....QS.....QR.NFSWY..S...A...............................................................................A................D-..VAQ..............VV.Q..V.GYA.....S.EV...........................................V.G.GA.......F.P..Q..V......VK....S.I.P.ATGg...................................................................................ltTS.N..EYNR..F.A..TVT.....G............L..KENT.SYV.......Y..RV...............GTE...G-.................................DWS.A.T..YTFRT............................................
A0A1U7ZUJ1_NELNU/169-277               .................................................pvyp----RLAQ.....GK..A....WN.....EM.TVTWT..S...G...............................................................................Ys..............iNE..AEP..............FV.E..W.GKQ.....G.GD...........................................Q.M.RS.......-.P..A..G......TL....T.F.N.RNSmcgap...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNS.VYT.......Y..KV...............GHHl.fNGt...............................yVWS.Q.T..YSFR-a...........................................
A0A1R3JF97_COCAP/171-279               .................................................pvyp----RLAQ.....GK..V....WN.....EM.TVTWT..S...G...............................................................................Yg..............iDE..AVP..............FV.E..W.APK.....G.GL...........................................P.V.RS.......-.P..A..G......TL....T.F.D.RNSmcgep...........................................................................artvgwRD.P..GFIH..T.S..FLK.....E............L..WPNT.LYT.......Y..KL...............GHIl.sNGt...............................yVWS.Q.Q..YSFR-a...........................................
A0A3Q0RBC2_AMPCI/118-205               .....................................................PLQPVLTV.....LS.aT....ED.....SM.VVSWR..S...I...............................................................................G................D-..GSC..............RL.R..Y.RTK.....D.KS...........................................K.W.TQ.......V.P..D..S......IS....A.F.A.---......................................................................................--.-..DQRM..T.Y..TMK.....N............L..LPFT.IYR.......A..AV...............ACR...GDt...............................gIWS.D.W..SS---ei..........................................
A0A1Y3MX01_PIRSE/195-294               ...........................................mintgpgvdc--------.....--..-....SK.....EM.SIAWH..S...P...............................................................................Y................E-..-AN..............YI.E..Y.TLA.....S.DT...........................................G.F.KK.......A.I..R..K......NV....S.G.I.YVGesrew...........................................................................idenvkSV.T..FYSC..K.A..YLN.....N............L..TPKS.NYI.......Y..RV...............GNK...Y-.................................EVS.E.V..KKFKT............................................
A0A151I267_9HYME/131-220               ..........................................aatgdiyhnih--------.....--..-....--.....DI.VVTWS..T...K...............................................................................N................DT..KES..............IV.E..Y.GIG.....G.FI...........................................L.R.AE.......G.N..S..T......LF....V.D.G.GEK......................................................................................KR.K..QYIH..R.V..WLK.....N............L..TPNS.KYI.......Y..HC...............GSR...Y-.................................GWS.N.V..FYMRT............................................
A0A1V9FMS0_9BACT/203-286               .................................................rgpy-----LQM.....GN..-....QT.....AV.TLRWR..T...N...............................................................................T................A-..TNS..............RI.E..V.GTV.....F.GT...........................................Y.N.LS.......A.T..N..S......TS....T.-.-.---......................................................................................--.-..-TEH..E.V..RIT.....G............L..AADT.RYY.......Y..RF...............GSS...TQi..............................lqSAS.-.-..-----dnyfitv.....................................
A0A445G567_GLYSO/85-176                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...T...............................................................................E................EP..GHS..............HI.Q..Y.GTS.....E.NK...........................................F.Q.TS.......E.E..G..T......VT....N.Y.T.FHK......................................................................................YK.S..GYIH..H.C..LIE.....G............L..EYET.KYY.......Y..RI...............GSG...D-.................................-SS.R.E..FWFKT............................................
A0A1U7W6Z9_NICSY/46-134                .....................................................PEQVHISL.....VG..-....KD.....HM.RVTWI..T...S...............................................................................D................KH..AKS..............IV.E..Y.GAS.....P.GN..........................................yQ.S.SS.......M.T..G..E......RT....S.Y.R.YFF......................................................................................YS.S..GEIH..H.V..TIG.....P............L..EPNT.TYY.......Y..RC...............GGS...E-.................................---.P.E..FSFKT............................................
I2GL27_9BACT/31-127                    .....................................................PDRVILGW.....QG.nP....AT.....SQ.SVNWR..T...D...............................................................................S................TV..SNA..............VG.A..I.TEA.....D.PSpd......................................lagK.A.MV.......V.P..A..T......TE....R.V.V.I-D......................................................................................GK.T..VLYH..S.V..HFT.....N............L..KPAT.QYN.......Y..RV...............GDG...E-.................................HWT.E.W..FQFKT............................................
A0A1L9VBR1_ASPGL/35-124                .....................................................PYQQRLAI.....YG..-....PN.....AV.SVGWN..T...Y...............................................................................A................AQ..NRS..............CV.Q..Y.GSS.....P.DS...........................................L.K.SQ.......V.C..S..S......QS....S.T.-.-YD......................................................................................TS.R..TYSH..T.A..ILN.....N............L..TPAT.DYF.......Y..KI...............VST...N-.................................--S.S.V..EQF--lsprt.......................................
A0A1R3L047_9ROSI/2-58                  ............................................ghslvysql--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.-.--.......-.-..-..-......--....-.-.-.--Ypfq...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPDT.LYY.......Y..QC...............GDP...SI................................pAMS.D.V..YYFKT............................................
R4LSU4_9ACTN/40-135                    .....................................................PTAIILGV.....GA..N....ES.....QR.IVTWY..T...T...............................................................................T................D-..TAQ..............QI.Q..L.APT.....A.DL...........................................T.G.GA.......F.P..A..S......AA....T.F.A.ALGga.................................................................................nlaTS.G..GYNR..H.A..TIT.....G............L..KEHT.AYS.......Y..RV...............GAE...G-.................................AWS.S.T..YTFKT............................................
A0A2T7EJN5_9POAL/55-146                .....................................................PQQVHITL.....GD.qD....GT.....AM.IVSWV..T...P...............................................................................N................EL..GNS..............TV.M..Y.GGA.....P.DK...........................................L.E.LR.......A.E..G..V......HT....R.Y.D.YFN......................................................................................YT.S..GFIH..H.C..FLK.....N............L..KHRT.KYY.......Y..AM...............GFG...H-.................................-TV.R.T..FWFTT............................................
A0A1Y4RIY8_9FIRM/55-147                ....................................................y-TQVSLTP.....GC..A....AT.....EI.NFAWY..N...Q...............................................................................G................TE..GSP..............IV.Y..F.GTD.....P.QN...........................................L.K.AY.......H.-..G..T......SN....S.V.D.PSLt....................................................................................gGK.S..YCYN..Y.V..TVT.....G............L..AENT.TYY.......Y..AV...............AKG...D-.................................TVS.A.T..EVY--rt..........................................
L1LZW1_PSEPU/38-134                    ....................................................a-DRIVLTP.....GA.nP....AR.....EM.AVTFR..T...D...............................................................................S................RQ..TSS..............HL.Q..L.APA.....L.DGpq......................................lekR.A.TL.......V.E..G..S......SQ....P.L.D.TE-......................................................................................NG.A..ARYH..Q.V..RLA.....G............L..QPDT.PYV.......Y..RV...............KGA...E-.................................GWS.E.W..LQLRT............................................
A0A167J0B9_CALVF/70-172                ...........................................nninvisysy--------.....--..L....PD.....GV.HIHFQ..T...P...............................................................................F................GI.gGEP..............CV.N..W.GTQ.....A.DK...........................................L.W.HN.......T.K..G..T......TR....T.Y.D.RTPpcsl..............................................................................vsvtQC.S..QFFH..E.V..SLT.....G............L..APGK.TYY.......Y..QI...............PGG...NG................................tTQS.D.I..LYFST............................................
A0A2N7VPK1_9BURK/56-152                .....................................................PEQIHLTW.....GE.dP....TS.....EV.VISWA..S...Q...............................................................................A................AA..IQP..............RV.T..V.TSD.....H.GH...........................................S.-.KT.......V.H..A..V......QR....T.Y.T.DGL.....................................................................................sGV.V..VFSY..H.A..RVH.....D............L..KPDA.TYR.......Y..EV...............TAD...NSsa............................lgnP--.-.-..-----fsasfkt.....................................
A0A453NAR6_AEGTS/1-80                  .....................................................--------.....--..-....--.....-M.RITWV..T...D...............................................................................D................NS..VPS..............VV.D..Y.GTK.....S.NA...........................................Y.T.SS.......S.N..G..E......ST....S.Y.S.YLM......................................................................................YS.S..GKIH..H.V..VIG.....P............L..EDNT.IYY.......Y..RC...............GGR...GS.................................---.-.-..-----efqlktppsqf.................................
A0A0D2BAX9_9EURO/68-171                ..................................................tnn---VNVIQ.....LS.yL....PN.....GI.NIHYQ..T...P...............................................................................F...............gLG..VSP..............TV.F..W.GTT.....A.GK...........................................L.D.RK.......A.Q..G..Y......SR....T.Y.D.RTPpcsl..............................................................................vavtQC.S..QFFH..D.V..QIT.....G............L..DPGT.TYY.......Y..QI...............PAA...NG................................tTTS.Q.V..MSFST............................................
V4RJD8_9ROSI/86-198                    .....................................................PEQISVSL.....SS..T....HD.....SV.WISWI..T...G...............................................................................Efqignn....lkpldpKS..VAS..............VV.R..Y.GTL.....R.SQ...........................................L.N.RR.......A.T..G..H......SL....V.Y.N.QLYpfl...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPDT.LYH.......Y..QC...............GDP...SI................................pAMS.G.A..YCFRT............................................
Q10Q09_ORYSJ/172-280                   .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yg..............tNE..ATP..............FV.K..W.GLQ.....G.QI...........................................Q.S.LS.......P.A..G..T......-L....T.F.S.RSTmcgpp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNF.KYT.......Y..RI...............GHR..lSDg..............................siIWG.H.E..YSFQ-a...........................................
A0A1R3JMB4_9ROSI/62-153                .....................................................PQQVHITQ.....GD.yD....GT.....AV.IISWV..T...P...............................................................................D................EP..APS..............KV.Q..Y.GTS.....A.GH...........................................Y.K.FT.......A.E..G..K......MT....N.Y.S.FYE......................................................................................YK.S..GYIH..H.V..LVD.....G............L..EYDT.KYY.......Y..KI...............GSG...D-.................................-VA.R.E..FWFQT............................................
A0A2K8XNS5_9FLAO/52-161                .....................................................PDRIIVNL.....TE.dP....NH.....SF.AVNWR..T...N...............................................................................Q................QI..DTA..............YV.E..V.AKE.....T.HG...........................................P.D.FL.......L.E..H..N......IK....R.V.I.AKTalleie.........................................................................ntrdnepLV.K..ASYH..S.V..IVK.....N............L..EPGT.TYV.......Y..RV...............GDG...GKn..............................kdTWS.E.W..FQIKT............................................
A0A1S3XQH6_TOBAC/60-151                .....................................................PQQVYITQ.....GD.hE....GK.....GV.IASWT..T...P...............................................................................D................EP..GSN..............SV.L..Y.WAE.....N.SN...........................................V.K.SS.......A.E..G..F......VV....S.Y.R.YYN......................................................................................YT.S..GYIH..H.C..TIK.....D............L..EFDT.KYY.......Y..EV...............GLE...N-.................................-TT.R.K..FWFVT............................................
A0A0P0V8Z3_ORYSJ/1-87                  ....................................................i------TQ.....GN.hD....GT.....AM.IISWV..T...T...............................................................................I................EP..GSS..............TV.L..Y.GTS.....E.DN...........................................L.N.FS.......A.D..G..K......HT....Q.Y.T.FYN......................................................................................YT.S..GYIH..H.C..TIK.....K............L..EFDT.KYY.......Y..AV...............GIG...Q-.................................-TV.R.K..FWFRT............................................
A0A1E7K8D8_9ACTN/105-210               .....................................................PFGRHLAF.....GA.dP....AS.....QM.RISWQ..V...P...............................................................................L................PV..RRP..............YL.R..V.GTA.....P.WD...........................................L.G.GR.......V.A..A..E......VR....A.L.Y.TPAlss................................................................................tlpSV.E..QLHL..H.V..GLE.....G............L..RPGT.TYY.......Y..GV...............GHD...GFdp............................aapA--.-.-..-----rshtvdfftt..................................
A0A1U8AYA4_NELNU/50-141                .....................................................PQQVHISL.....VG..-....RD.....HM.RISWI..T...Q...............................................................................K................H-..APS..............IV.E..Y.GKT.....P.GK...........................................Y.D.AS.......V.T..G..D......HT....S.Y.H.YFF......................................................................................YL.S..GKIH..Q.A..TIG.....P............L..DPDT.NYY.......Y..RC...............SGT...G-.................................---.E.-..-----eftlktppttf.................................
Q9VZ56_DROME/38-141                    .....................................................PEQVHLSF.....GE.rT....DS.....EI.VVTWS..T...R...............................................................................S................LP..PDQevg........avsVV.E..Y.GQL.....V.DGq........................................vrL.T.QQ.......A.R..G..K......AT....K.F.V.DGGh....................................................................................kQA.T..QFIH..R.V..TLR.....D............L..EPNA.TYS.......Y..HC...............GSD...F-.................................GWS.A.I..FQFRT............................................
A0A075KBC7_9FIRM/38-129                .....................................................PRNIALTF.....TG.mP....AS.....TQ.TITWQ..T...G...............................................................................R................YS..SGS..............RV.E..Y.TKV.....T.DT...........................................L.H.SV.......R.E..G..T......TQ....Q.V.A.TD-......................................................................................RG.M..ITVH..S.V..QLT.....D............L..EPAT.RYQ.......Y..RV...............GDG...L-.................................FWS.S.Y..HTFTT............................................
A0A2R6Q3B7_ACTCH/46-133                .....................................................PQQVHISL.....VG..-....KD.....HM.RVSWV..T...S...............................................................................D................HH..TRS..............KV.E..Y.GKA.....P.GR...........................................Y.E.SS.......A.T..G..E......HT....K.Y.Q.YFF......................................................................................YS.S..GKIH..H.V..KIG.....P............L..EPAT.TYY.......Y..RC...............GGS...G-.................................---.P.E..FS---lrt.........................................
A0A2K8XNM2_9FLAO/24-110                ..............................................eiapylq--------.....-D.aE....PN.....AI.KIMWQ..T...N...............................................................................F................G-..EES..............VV.H..W.GTK.....K.NE...........................................L.Q.NN.......T.K..G..I......AF....D.I.-.--N......................................................................................FT.E..KRVH..E.V..SLT.....G............L..KKFT.TYF.......Y..KV...............QTG...K-.................................AIS.D.I..YQFKT............................................
U4TRK2_DENPD/26-117                    .....................................................PQQVHIAF.....GD..N....IH.....QI.VVTWS..T...Y...............................................................................N................PT..DDS..............IV.E..Y.GIG.....G.--...........................................L.I.NT.......A.T..G..Q......SR....L.F.V.DGGp....................................................................................eKH.S..QYIH..R.V..VLS.....D............L..APDS.RYE.......Y..HC...............GGS...D-.................................GWS.D.L..FWFKT............................................
A0A0Q3EIJ1_BRADI/166-274               .................................................pvyp----RLAQ.....GK..S....WN.....EM.TITWT..S...G...............................................................................Yn..............iKE..AVP..............FI.E..W.GAK.....V.GP...........................................R.F.L-.......S.P..A..G......TL....T.F.D.RNSmcgap...........................................................................artvgwRH.P..GYIH..T.S..FLK.....D............L..WPDS.LYT.......Y..RL...............GHMl.pNGt...............................hIWS.K.S..YSFK-a...........................................
A0A1C5BRA3_9ACTN/223-316               .....................................................PERIVLTP.....TE.tP....ST.....SQ.AVTWR..T...G...............................................................................S................GT..TSG..............EA.Q..F.RPE.....G.SN..........................................sA.W.RK.......A.K..A..T......TN....E.E.L.LSN......................................................................................GV.P..TRTH..S.A..VME.....G............L..KPGK.AYE.......Y..RV...............GHG...D-.................................KLS.E.R..YVFT-s...........................................
M9M127_PAEPP/37-137                    ..................................................pvs---LGTTI.....KG.dP....RT.....SR.AFTWH..T...A...............................................................................S................SG..SQG..............KV.Q..V.TEG.....A.KAdpw.....................................dgeN.V.LT.......F.T..A..E......SA....N.I.I.SGE......................................................................................GK.P..QSVH..K.A..EAI.....G............L..KPGT.TYV.......Y..RV...............GNG...ED................................eGWS.E.P..AIFVT............................................
A0A1M6CNU8_9FLAO/21-112                ..................................................dky----RLTL.....RG.nP....AT.....SI.VIGWN..Q...I...............................................................................S................G-..SNP..............TV.Y..F.GTT.....D.FG...........................................T.N.YN.......N.Y..P..N......SK...sP.D.R.IVS......................................................................................YK.G..MNNH..F.A..RLT.....G............L..QPNT.AYY.......F..VI...............RDS...Q-.................................GTS.E.R..FWFKT............................................
A0A1S3C514_CUCME/68-181                .....................................................PEQISVSL.....SV..D....YD.....SV.WISWI..T...G...............................................................................Dfqigdd....iqpldpEG..VAS..............IV.M..Y.GKF.....R.MA...........................................M.D.NR.......A.E..G..Y......SL....I.Y.N.QLYpfe...............................................................................glrnYT.S..GIIH..H.V..RLT.....G............L..EPDT.LYQ.......Y..QC...............GDP...SVa...............................eEMS.D.V..YFFRT............................................
A0A3B6KFK0_WHEAT/53-140                .....................................................PQQVHVSA.....VG..-....PD.....KM.RVTWI..T...D...............................................................................D................D-..APA..............TV.D..Y.GTA.....S.GQ...........................................Y.P.FS.......A.T..G..T......TA....V.Y.S.YLL......................................................................................YH.S..GNIH..D.A..VVG.....P............L..KPST.TYY.......Y..RC...............SSD...T-.................................--S.R.E..FSFRT............................................
A0A2G2ZHG4_CAPAN/144-247               .....................................................PEQIHLAL.....TG..R....ED.....EM.RVMFV..T...P...............................................................................D................G-..KES..............YV.R..Y.GLT.....R.NG...........................................L.G.RV.......V.K..T..R......VV....R.Y.E.REDmcdapa..........................................................................nssigwRD.P..GYIH..D.G..IML.....N............L..KKVK.KYY.......Y..QA...............GSD...SG.................................GWS.S.I..FSF--vs..........................................
A0A2G5F4P8_AQUCA/143-246               .....................................................PEQIHLSF.....TD..N....EN.....EM.RVMFI..S...D...............................................................................D................G-..KES..............YV.K..F.GKK.....E.SR...........................................L.D.EV.......V.K..T..E......VK....R.Y.E.REDmcdspa..........................................................................ngsigwRD.P..GFIH..D.G..VMR.....N............L..KNGK.RYY.......Y..KV...............GSD...EG.................................GWS.V.T..HSF--is..........................................
A0A417PS02_9CLOT/67-159                .................................................iryl----SVTV.....GA..A....ES.....DV.NMTWY..S...P...............................................................................S................S-..ASG..............EV.L..L.TTA.....D.DTd........................................faN.A.QS.......F.P..A..S......DP....T.A.S.EI-......................................................................................TS.G..YYIN..R.A..AVS.....G............L..SPET.EYI.......Y..KV...............GNE...E-.................................GYS.P.V..YSYTT............................................
A0A4P1QSE1_LUPAN/169-277               .................................................pvyp----RLAQ.....GK..T....WN.....EI.TVTWT..S...G...............................................................................Yd..............iSD..AEP..............FV.E..W.GPK.....E.GN...........................................L.V.ET.......P.A..G..T......L-....T.F.D.RNTmcgap...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPNR.EYT.......Y..KL...............GHRl.fNGt...............................tIWS.K.K..YHFK-a...........................................
A0A1I8GHM8_9PLAT/29-120                .....................................................PEQVHLSV.....TN..D....PT.....QM.VVTWV..T...Q...............................................................................S................PT..NGT..............SV.D..Y.GTN.....R.FD...........................................R.S.AS.......G.I..Q..E......KF....V.D.G.GSA......................................................................................KR.V..IYIH..R.A..VMS.....G............L..RPGQ.RYV.......Y..RV...............GSE...L-.................................GWS.D.V..FLFT-a...........................................
A0A067GD80_CITSI/59-150                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................H................EP..GPS..............TV.S..Y.GTS.....A.DK...........................................F.D.FT.......A.E..G..T......VN....N.Y.T.FYK......................................................................................YK.S..GYIH..Q.C..LVD.....G............L..EYDT.KYY.......Y..KI...............GSG...D-.................................-SS.R.E..FWFQT............................................
A0A1Y0IEK4_9GAMM/598-684               ...............................................eviapy-------L.....QN.pS....SD.....AI.YVTWK..T...R...............................................................................T................S-..EES..............VV.H..Y.GTS.....P.GQ...........................................L.N.QV.......A.S..G..D......YE....N.L.-.---......................................................................................GT.F..YNFH..T.V..KIN.....N............L..TPDT.PYY.......Y..QV...............VSR...N-.................................QTS.A.V..HRFRT............................................
A0A0C2T2K3_AMAMU/1-87                  ....................................................m--QLRLAY.....AG..-....PT.....GM.VVSWN..T...F...............................................................................S................KL..SRP..............TV.R..Y.GRE.....P.KA...........................................L.A.HT.......A.F..S..T......VS....V.T.-.-YP......................................................................................TS.L..TYNN..H.V..KLT.....G............L..QPNT.QYY.......Y..LP...............EYS...N-.................................-ST.V.P..YTFKT............................................
A0A314Y028_PRUYE/89-129                ................................................rvkcn--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.-.--.......-.-..-..-......--....-.-.-.---......................................................................................-M.S..GYIH..H.C..LVD.....G............L..EHDT.KYY.......Y..KI...............GSG...D-.................................-SS.R.E..FWFTT............................................
A0A3A5N177_9MICO/48-141                ...................................................qs--DIVLHV.....GA..D....ET.....MR.NFSWY..S...A...............................................................................A................D-..TAQ..............VV.Q..V.ALA.....A.NV...........................................V.D.GA.......F.P..G..L......AT....S.I.S.ATGg...................................................................................ltTS.G..EYNR..F.A..TMT.....D............L..AENT.AYV.......Y..RV...............GSE...G-.................................DWS.N.T..YSFRT............................................
A0A061FSS3_THECC/252-355               .................................................plyg----HLSS.....MD.sT....GT.....SM.RLTWV..S...G...............................................................................D................K-..EPQ..............QV.K..Y.GDG.....K.SQ...........................................T.S.DV.......T.T..F..S......AD....D.M.C.--Ssvvvps.........................................................................pakdfgwHD.P..GYIH..T.A..VMT.....G............L..QPSS.TCN.......Y..KY...............GSD...SV.................................GWS.D.Q..IQFRT............................................
A0A2M9EBX6_9GAMM/42-137                .....................................................PDRIVATP.....AQ.nP....AR.....GF.AVNWR..T...Q...............................................................................Q................GV..DAP..............LL.E..I.VKA.....G.DS...........................................P.D.VG.......V.P..R..Q......IS....A.L.T.RTLg...................................................................................sgAQ.A..ANYH..R.A..DID.....G............L..EPDT.LYM.......F..RV...............AGA...G-.................................TWS.G.W..RQLRT............................................
A0A2R6QGD6_ACTCH/175-283               .................................................plyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Yn..............tDE..AIP..............FV.E..W.GLK.....G.DL...........................................Q.K.RS.......P.A..G..T......-L....T.F.H.RGSmcgsp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....A............L..WPNS.VYT.......Y..KM...............GHLl.sNGs...............................hVWS.K.M..YSFK-s...........................................
A0A0K1Q8B7_9DELT/14-82                 ........................frnepqaldqtrtgfgwttpppsigfgsn--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.-.--.......-.-..-..-......--....-.-.-.---......................................................................................EP.E..TYMH..E.V..HLC.....G............L..EPGT.TYY.......Y..QV...............GGG...SP................................eVWS.A.T..QSFTT............................................
A0A397KW81_BRACM/52-149                .....................................................PEQVHLTQ.....GD.hD....GR.....AM.IVSWV..T...P...............................................................................L...............nLA..GTN..............VV.T..Y.WIA.....G.NSsd......................................vkpA.K.KK.......A.H..G..S......TS....S.Y.R.FYD......................................................................................YT.S..GFLH..H.A..TIK.....G............L..EYDT.KYI.......Y..EV...............GTA...K-.................................-SV.R.Q..FHFTT............................................
M0YS05_HORVV/47-135                    .....................................................PQQVHLSV.....VG..-....AN.....HM.RVSWV..T...D...............................................................................A................KH..GHS..............VV.E..Y.GRA.....S.GN...........................................Y.T.SS.......A.T..G..E......HS....S.Y.R.YYL......................................................................................YS.S..GKIH..H.V..TIG.....P............L..DPDT.VYY.......Y..RC...............GMV...G-.................................---.-.-..-----deftlktp....................................
A0A1V0DGR2_9BACT/234-315               ..............................................tvrtpyl--------.....QQ.aT....PT.....SI.LIAWQ..T...A...............................................................................T................E-..TTG..............TV.E..Y.GPT.....R.D-...........................................L.G.FR.......V.E..T..-......--....-.-.-.---......................................................................................GA.P..AYRH..A.V..TLD.....G............L..TPNT.TYY.......Y..RV...............LSG...SE.................................VFY.P.I..TPFRT............................................
A0A2G3BCE0_CAPCH/6-94                  .....................................................PVQVHISL.....AG..-....DK.....HM.RVTWV..T...N...............................................................................D................GA..SPS..............IV.E..Y.GTS.....P.EK...........................................Y.S.AT.......A.Q..G..E......ST....K.Y.S.YLL......................................................................................YS.S..GKIH..H.T..VIG.....P............L..QENT.TYF.......Y..KC...............GGE...G-.................................---.P.-..-----efqlktp.....................................
A0A388LFV4_CHABU/218-321               .....................................................PTQIHLAL.....TG..K....QG.....EM.RVTWT..T...R...............................................................................G................RG..RAP..............YV.R..W.GMT.....A.GD...........................................Y.T.SS.......S.P..A..N......TT....T.Y.T.RTEmcggp...........................................................................arsigwVA.P..GYFH..T.A..VMN.....G............L..TVGT.NIF.......Y..SV...............GDD...GY.................................AHS.N.P..KSF--yv..........................................
A0A348ALY0_9FIRM/53-150                .....................................................PDHVTLTW.....SG.dP....AT.....TQ.TITWR..T...N...............................................................................T................TV..SNG..............VI.Q..Y.STT.....T.TG...........................................R.A.AL.......T.N..G..V......QT....V.T.A.ALEtl.................................................................................ksdLG.D..ANLH..S.A..MVS.....G............L..RPGT.KYN.......Y..RV...............GDG...V-.................................NWS.S.V..SSFTT............................................
A0A287KQG4_HORVV/25-108                ...............................................kpldpg--------.....--..-....--.....--.-----..-...-...............................................................................-................-T..VGS..............VV.R..Y.GLA.....A.DS...........................................V.V.RE.......A.T..G..D......AL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLQ.....G............L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.A.V..HAFRT............................................
A2R1M4_ASPNC/70-173                    ..........................................nnvnvislsyi--------.....--..-....PK.....GM.HIHYQ..T...P...............................................................................F...............gLG..QLP..............AV.R..W.GKD.....P.RN...........................................L.N.ST.......A.Q..G..Y......SH....T.Y.D.RTPscsq.............................................................................vkaitQC.S..QFFH..E.V..SID.....G............L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.D.V..LSFKT............................................
R6SXH0_9BACE/32-130                    ................................................wlcdm--------.....--..T....EN.....AV.TVVWK..T...D...............................................................................V................P-..ATG..............WV.E..F.TEN.....H.GQ...........................................H.F.YS.......E.E..-..H......ER....V.Y.D.ARFg...................................................................................rrLT.H..ETIH..S.V..RLT.....G............L..KPGT.NYM.......Y..RI...............FSQ...AL................................tG--.-.-..-----wgtsddarlgeiassvvy..........................
G4ZZW6_PHYSP/96-194                    .....................................................PQQFHLAF.....AGkkA....GS.....GM.TISWT..T...F...............................................................................D................LE..EDP..............AV.W..I.GSS.....E.DE...........................................L.T.PV.......K.D..A..Tf....eTK....S.Y.Y.KDK......................................................................................SY.S..LYSY..H.A..IVT.....G............L..KPNT.EYF.......Y..KV...............GSA...STk...............................kFQS.A.V..SSFKT............................................
A0A1U7XDM9_NICSY/60-151                .....................................................PQQVYITQ.....GD.hE....GK.....GV.IVSWT..T...P...............................................................................D................EP..GSN..............SV.L..Y.WAE.....N.SN...........................................V.K.SS.......A.E..G..F......VV....S.Y.R.YYN......................................................................................YT.S..GYIH..H.C..TIK.....D............L..EFDT.KYY.......Y..EV...............GLE...N-.................................-TT.R.K..FWFVT............................................
A0A0M2GUF3_9ACTN/79-208                .....................................................PFGRHLAY.....GT.dP....RT.....EM.TVSWQ..V...P...............................................................................V................AV..KKP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.F.TPTgvg................................................................................asgNH.T..QYYL..H.A..KLT.....H............L..RPGR.TYY.......Y..GV...............GHQ...G-.................................---.-.-..-----fdpadphllgtlgtfttapahktpftftafgdegvsyhala...
A0A3B6SI68_WHEAT/135-248               ..................................................pvf---PRLAQ.....GK..T....HD.....EM.AVTWT..S...G...............................................................................Y................DI..GEAy............pFV.E..W.GVV.....A.SGgr.......................................ggN.P.TR.......P.P..A..G......TL....T.F.S.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FMR.....G............L..WPNK.EYF.......Y..KI...............GHE..lSDg..............................tvMWG.K.P..YTFR-a...........................................
A0A242K391_9ENTE/37-136                ...............................................iynlnq------SL.....RD.dV....TS.....TV.HLNYR..T...A...............................................................................Etas..........srdSQ..PET..............TI.Y..Y.YLT.....D.ED...........................................F.N.VE.......A.N..Q..S......VS....A.A.A.-TK......................................................................................SS.K..ISYH..K.A..DID.....G............L..KQGT.TYN.......Y..RI...............VDE..vSG.................................AIS.K.E..YSFTT............................................
A0A0M0G114_SPOGL/986-1092              ...................................................ik--NVISTP.....TG.dP....YK.....SK.GFTWI..S...S...............................................................................Pl..............gKE..NSS..............FI.Q..Y.ARK.....K.DY...........................................D.K.KG.......E.Q..S..L......QT....-.V.A.GSSsdqvfs.........................................................................geqditkNG.I..VRVN..E.V..TLK.....R............L..KKDT.TYV.......Y..RV...............GDG...V-.................................NWS.Q.I..QEFTT............................................
G3XQ08_ASPNA/70-173                    ..........................................nnvnvislsyi--------.....--..-....PK.....GM.HIHYQ..T...P...............................................................................F...............gLG..QLP..............AV.R..W.GKD.....P.RN...........................................L.N.ST.......A.Q..G..Y......SH....T.Y.D.RTPscsq.............................................................................vkaitQC.S..QFFH..E.V..SID.....G............L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.D.V..LSFKT............................................
T1KXV2_TETUR/32-123                    .....................................................PEQVHLSL.....GV..N....PS.....EM.IVTWT..T...F...............................................................................D................PI..SLP..............SA.A..Y.GIS.....T.LN...........................................E.T.TY.......G.Y..S..T......KF....V.D.G.GSE......................................................................................KR.V..MYIH..R.V..TMN.....N............L..KPDQ.KYV.......Y..RV...............GSD...A-.................................GWS.E.I..FWFKT............................................
A0A0E0AY17_9ORYZ/177-288               .................................................pvyp----RLAQ.....GK..S....YD.....EM.TVTWT..S...G...............................................................................Yd..............iSE..AYP..............FV.E..W.GMV.....V.AGa........................................aaP.T.RT.......A.A..G..T......L-....T.F.N.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FLR.....D............L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.K.Q..YTFR-a...........................................
A0A2A2LRU6_9BILA/24-112                .....................................................PEQVHLAF.....HG..D....TS.....EM.AVIWT..T...F...............................................................................Y................D-..GLH..............HV.Y..Y.GTD.....V.KN...........................................M.N.QV.......A.I..E..T......SI....K.K.W.TSG......................................................................................SV.T..RYSH..R.A..KMS.....N............L..KPST.TYY.......Y..KI...............E--...--.................................---.-.-..-----grvfefktlsa.................................
A0A1S2Z1X7_CICAR/79-191                .....................................................PEQISLSL.....ST..T....FD.....SV.WITWI..T...G...............................................................................Eyqigyn....ikpldpKI..VSS..............VV.Q..F.GTS.....R.FE...........................................L.V.NE.......A.K..G..Q......SL....I.Y.N.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..EPST.LYY.......Y..QC...............GDP...SL................................hAMS.D.I..YYFRT............................................
A0A453K9U8_AEGTS/1-86                  ....................................................d---VHVSA.....VG..-....PD.....KM.RVTWI..T...D...............................................................................D................D-..APA..............MV.D..Y.GTA.....S.GQ...........................................Y.P.FS.......A.T..G..T......TA....D.Y.S.YLM......................................................................................YH.S..GNIH..D.A..VVG.....P............L..KPST.TYY.......Y..RC...............SSD...P-.................................--S.R.E..FSFRT............................................
A0A445HTS1_GLYSO/62-153                .....................................................PQQVHITQ.....GD.qV....GR.....AM.IVSWV..T...V...............................................................................D................EP..GKS..............LV.H..Y.WSD.....A.SQ...........................................H.K.RV.......A.K..G..N......HV....T.Y.R.YFN......................................................................................YS.S..GFIH..H.C..TLT.....D............L..EFNT.KYY.......Y..EV...............GIG...H-.................................-TT.R.Q..FWFV-t...........................................
A0A1S3E8V6_CICAR/65-177                .....................................................PEQISLSL.....ST..S....HD.....SV.WVSWI..T...G...............................................................................Efqigen....iepldpEK..VAS..............IV.K..Y.GRF.....G.RS...........................................I.N.RQ.......A.V..G..Y......SL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..RANT.LYQ.......Y..QC...............GDP...SL................................sAMS.D.I..HYFRT............................................
A0A0C1Y224_9CYAN/48-162                ..............................................dpflqlp--------.....--..T....AT.....SV.RVVWF..T...E...............................................................................F................PG..QTH..............TV.Y..Y.GPR.....S.GArl.......................................adN.A.ST.......V.P..A..T......TR....L.L.S.RLQedqasnlp.....................................................................sgealeapaPR.L..VWRH..E.A..EVT.....G............L..QPGQ.RWP.......Y..RV...............ESV...TDdg.............................eiLTS.E.E..FT---lsa.........................................
D3BJ35_POLPP/15-114                    .....................................................PNNVNLAF.....TT..S....QS.....EM.RATWY..T...V...............................................................................N................Q-..TVG..............AV.R..F.SSQ.....Q.FSadt....................................adsvD.M.SL.......S.P..S..T......FT....E.Y.-.--Ge...................................................................................fpGW.S..GFVN..T.A..VMS.....N............L..NALQ.QYF.......Y..QV...............GDS...QQ................................nLWS.P.V..YNFTT............................................
J3NEE7_ORYBR/165-273                   .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yd..............iKE..AVP..............FV.E..W.GAK.....G.GP...........................................R.L.LS.......P.-..A..G......TL....T.F.D.RNSmcgap...........................................................................artvgwRH.P..GYIH..T.S..YLK.....E............L..WPDS.LYT.......Y..RL...............GHRl.pNGt...............................hIWS.K.S..YSFK-a...........................................
M1AD80_SOLTU/53-144                    .....................................................PQQVHITQ.....GD.yE....GK.....AV.IVSWV..T...P...............................................................................D................KP..GSS..............EV.R..Y.GLS.....K.GK...........................................Y.D.FT.......A.K..G..S......FT....N.Y.T.FYT......................................................................................YK.S..GYIH..K.C..FLN.....G............L..QYDT.KYY.......Y..EI...............GNG...D-.................................-SA.R.N..FWF--et..........................................
A0A162LLJ0_9ACTN/1-94                  .....................................................---MHLTF.....GP.dP....AT.....SM.VVSWI..T...R...............................................................................G................PV..RRP..............RV.R..L.RPR.....E.CD...........................................Q.R.LS......aA.K..Q..Q......IE....A.V.T.RSYvd.................................................................................avtAR.E..IHTH..H.A..LLT.....G............L..EPDT.EYH.......Y..EI...............SHQ...--.................................---.-.-..-----aprpgrfar...................................
A0A1I3RR51_9SPHI/245-340               .....................................................PDQVILTL.....PD.dA....KH.....GM.TVQWR..C...T...............................................................................P................DV..QHG..............WI.K..Y.WQP.....G.AE...........................................D.T.VR.......V.D..V..D......GT....L.L.E.DRMl...................................................................................rnDR.Y..VSRF..R.V..QLD.....S............L..QPGT.VYQ.......Y..RV...............GHG...A-.................................VTG.E.T..ATFTT............................................
F6HKK1_VITVI/2-80                      ...................................................vg--------.....--..-....AD.....KM.RITWV..T...K...............................................................................D................E-..TPA..............EV.H..Y.GTA.....Q.GQ...........................................L.G.SS.......A.T..G..S......TR....S.Y.K.YVV......................................................................................YT.S..GTIH..D.V..VIG.....P............L..NANT.VYY.......Y..RC...............GSS...G-.................................---.P.E..FSFKT............................................
A0A2G1XMF1_STRCJ/54-148                ...................................................vl--GVHLQF.....GS.dP....SS.....EM.TVSWI..T...P...............................................................................Q................SV..RRP..............QV.R..L.GSP.....E.GG...........................................HgG.RL.......V.E..A..E......TR....T.Y.R.DGL.....................................................................................sKE.E..VYVH..H.A..RIT.....G............L..RPSA.TYL.......Y..AA...............GHD...G-.................................ATP.E.T..GSFTT............................................
D3BF43_POLPP/46-187                    .....................................................PRQINLAL.....TY..N....AN.....DM.LVNWI..T...K...............................................................................D................EI..TQP..............VV.Y..Y.YIG.....D.CMwdtdsdd............................eddsksssS.-.--.......-.-..-..-......--....-.-.-.-SSsspssssashsksnsksnsk.............................................aekkkrntdikmtmgttktyyPY.K..GYLH..S.V..KLQ.....H............L..SSGV.GYC.......Y..RV...............GGN...FVpta...........................datSWS.K.W..RSFRT............................................
A0A345HUW5_9ACTN/79-184                .....................................................PFGRHLAF.....GA.dP....KT.....RM.TVSWQ..V...P...............................................................................L................PV..RNP..............YV.R..I.GTE.....P.WE...........................................L.S.RK.......I.R..A..E......VR....P.L.R.TPAlsa................................................................................klpAV.D..QYYL..H.A..SLE.....R............L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................daaRIG.T.V..GSFRT............................................
B4FKP7_MAIZE/52-139                    .....................................................PQQVHVSA.....VG..-....EK.....HV.RVSWV..T...D...............................................................................D................MR..AQS..............VV.D..Y.GKA.....S.RN...........................................Y.T.AS.......A.T..G..E......HT....S.Y.R.YFL......................................................................................YS.S..GKIH..H.V..SIG.....P............L..EPST.VYY.......Y..RC...............GKA...GK.................................EFS.-.-..-----lrt.........................................
A0A1P9WWX7_9BACT/42-124                ..................................................ylq--------.....-K.aT....PT.....SI.TIRWR..T...E...............................................................................P................A-..SVG..............VV.R..F.GTA.....A.NQ...........................................L.T.QS.......V.G..E..S......SP....-.-.-.---......................................................................................--.-..TVDH..E.V..TLT.....G............L..TPAT.QYF.......Y..AI...............ETP...DN.................................---.-.-..-----rlqgdtsnyfhtfpt.............................
D2RNV9_ACIFV/60-153                    ...................................................ar--NIRQVM.....TA.dP....AH.....SR.VIMWQ..S...D...............................................................................Y................AV..KEP..............VL.E..Y.RME.....G.KE...........................................N.G.ET.......V.P..V..Q......AE....K.F.T.DG-......................................................................................GK.N..TWIY..R.A..RIS.....G............L..EPGQ.TYG.......Y..RI...............RDG...KKa...............................tAW-.-.-..MS---lkafa.......................................
A0A2G7ESS6_9ACTN/56-149                ...................................................aa---VHLEL.....VT.lA....ED.....RA.VITWY..T...Gvpgtdd...................................................................gfghmlP................AV..TEG..............EV.V..Y.GTH.....P.GR...........................................L.T.RV.......A.A..-..-......--....-.-.-.--E......................................................................................DG.P..VAHH..Y.V..ELT.....D............L..EPGQ.TYY.......Y..QA...............RSR...G-.................................---.-.-..-----vaatptplh...................................
A0A3B6KGB0_WHEAT/51-139                .....................................................PMQVHIST.....VG..-....HD.....EM.RVTWI..T...E...............................................................................D................D-..APT..............VV.E..Y.GTT.....S.GQ...........................................Y.P.FS.......A.T..G..T......TT....S.Y.S.YLA.....................................................................................lYH.S..GKIH..D.A..VVG.....P............L..KPST.TYY.......Y..RC...............SSD...P-.................................--S.R.E..FSFRT............................................
A0A1B8WC10_9BACI/55-157                ...................................................ir--DIALNP.....GA..D....ES.....KL.NFAWL..T...P...............................................................................G................QP..AAS..............IV.Q..M.AKK.....S.DL...........................................N.G.NA.......F.P..E..Aa....kVV....T.F.T.GTAipa...............................................................................ttvtDS.V..YYSN..K.A..TAT.....G............L..ANQT.EYV.......Y..RV...............GDG...NE................................dHWS.P.I..YNYTT............................................
A0A1Y3MX08_PIRSE/188-291               ...............................................knigmi----NTGP.....GT.dC....SK.....EM.SVSWH..S...P...............................................................................Y................E-..-SN..............YI.E..Y.TVA.....S.DT...........................................N.F.KY.......A.T..V..I......NI....T.G.T.YRNksrew...........................................................................idsrakSV.T..FYVC..K.A..YLS.....N............L..KPNT.NYI.......Y..RV...............GNK...Y-.................................KIS.E.I..KKFKT............................................
A0A0S3R6Y5_PHAAN/53-144                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................D................EP..GPS..............HV.Q..Y.GTS.....K.SR...........................................L.R.TS.......K.E..G..T......VA....N.Y.T.FYN......................................................................................YK.S..GYIH..H.C..LVE.....G............L..KYNT.KYY.......Y..RI...............GSG...DS.................................--A.R.D..FW---fet.........................................
D0NUG4_PHYIT/1-83                      .....................................................--------.....--..-....--.....-M.AVSWT..T...F...............................................................................E................LD..KDP..............TV.W..L.SRT.....K.SK...........................................L.K.IV.......V.N..A..E......IE....T.K.S.YYKd....................................................................................kTY.E..LYSY..H.A..VVG.....G............L..KANT.EYF.......Y..KV...............GNA...DNe...............................hFQS.G.E..SSFTT............................................
A0A3B6GX00_WHEAT/205-308               .....................................................PLNGHLSS.....TD.sT....AT.....SM.KLTWV..S...G...............................................................................D................G-..RPQ..............QV.Q..Y.AGG.....R.AA...........................................A.S.VA.......T.T..F..T......QK....D.M.C.SAPllpsp...........................................................................akdfgwHD.P..GYIH..S.A..VMT.....G............L..QPSQ.SYD.......Y..RY...............GSD...SV.................................GWS.D.T..VKFRT............................................
A0A2R6S2M0_ACTCH/52-143                .....................................................PEQVHITQ.....GD.hV....GR.....GV.IISWV..T...P...............................................................................L................LK..HPN..............VV.T..Y.WEA.....E.GK...........................................H.K.RR.......A.H..S..T......IT....S.Y.R.YYN......................................................................................YS.S..GYIH..H.A..TIR.....N............L..KYDT.RYF.......Y..EL...............GTH...H-.................................-VT.R.R..FSFTT............................................
A0A2N5X6T3_9GAMM/55-141                .....................................................PERLFLQQ.....VG..-....SD.....RA.IIKWR..G...N...............................................................................Td..............gGA..EAD..............AV.C..F.GTE.....M.DF...........................................L.D.ED.......S.L..T..A......--....-.-.-.-AE......................................................................................VT.A..TGHS..E.A..LLQ.....G............L..TPDT.TYY.......Y..SV...............GGA...G-.................................SAQ.A.Q..HSFRT............................................
W2PUE4_PHYPN/1-82                      .....................................................--------.....--..-....--.....-M.TVSWA..T...F...............................................................................E................DV..SDS..............SV.W..V.GSS.....E.DS...........................................L.E.LV.......D.T.pV..S......SD....S.Y.Y.SDD......................................................................................EY.N..LFHH..H.A..TIT.....G............L..KPRT.KYF.......Y..KV...............GSR...GDe...............................kYTS.D.V..SSFIT............................................
A0A2H5NCK4_CITUN/59-150                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................H................EP..GPS..............TV.S..Y.GTS.....E.DK...........................................F.D.FT.......A.E..G..T......VN....N.Y.T.FYK......................................................................................YK.S..GYIH..Q.C..LVD.....G............L..EYDT.KYY.......Y..KI...............GSG...D-.................................-SS.R.E..FWFQT............................................
A0A1B1MA95_STRLN/73-178                .....................................................PFGRHLAY.....GN.dP....RT.....EM.TVSWQ..V...P...............................................................................V................AV..KKP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.Y.TPAgvg................................................................................asaDH.T..QYYV..H.A..ALT.....H............L..RPGR.TYY.......Y..GV...............GHQ...G-.................................---.-.-..-----fdpaephllgtlgtftt...........................
R6PJ75_9CLOT/19-110                    .....................................................PDHIMLSF.....WG.dA....KT.....ST.AISWR..T...D...............................................................................E................NS..GDS..............YI.L..Y.RRE.....G.SA...........................................D.L.LR.......Q.E..A..V......TR....S.A.E.TD-......................................................................................ID.R..SNYH..W.V..RLS.....G............L..EPGC.KYC.......Y..TV...............GDD...E-.................................HRS.G.E..FTFET............................................
W2K0C2_PHYPR/208-314                   .....................................................PLQIRLAL.....TG..K....KG.....EM.RVTWV..S...G...............................................................................Q................V-..FGP..............NV.E..F.GTA.....T.SG..........................................lL.E.RR.......A.E..A..T......SG....S.Y.D.ALDmcdglar........................................................................irssvyfRH.P..GYLH..D.A..LMT.....D............L..VPGI.KYI.......Y..RV...............GSV...TG.................................VSS.P.E..MEFT-f...........................................
I1I8W6_BRADI/173-285                   ..................................................pvf---PRLAQ.....GK..S....HD.....EM.TVTWT..S...G...............................................................................Y................DI..GEAy............pFV.E..W.GMV.....G.KNp........................................tpT.P.RR.......T.P..A..G......TL....T.F.S.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FMR.....D............L..WPNK.DYI.......Y..KV...............GHEl.lDGt...............................vVWG.K.P..YSFR-a...........................................
A0A1G4W0G1_9FIRM/41-136                ...................................................fs--KVMLAP.....GA..D....ES.....QL.NFAWY..S...T...............................................................................S................Q-..TEP..............VV.Q..I.VKA.....D.AA...........................................F.D.EA.......A.P..A..F......TG....T.S.T.TAYrn.................................................................................aetGT.Q..YYSN..K.V..TAK.....G............L..EPDT.TYR.......Y..RY...............KTD...G-.................................DWS.E.I..YTYKT............................................
A0A0U2N9Q7_9BACL/1076-1175             .....................................................PYNVNVNM.....GA.dP....KS.....SR.GFTWH..T...H...............................................................................P................SV..QTT..............VV.E..L.AKK.....E.GFtgf.....................................dgpN.V.IK.......V.T..G..E......NS....L.F.V.TYD......................................................................................LG.T..VRVH..K.A..AVS.....G............L..EPGT.EYV.......Y..RV...............GDG...AS.................................HYS.A.Q..GSFAT............................................
A0A1Y1XJ05_9FUNG/166-257               ....................................................f-ERLSVNP.....GE..D....ES.....KL.NFAWY..S...R...............................................................................S................D-..ENP..............VV.R..L.SQN.....E.DM..........................................sD.Y.KE.......F.T..G..S......NS....Y.I.K.KYL......................................................................................GD.K..YYSN..M.V..TVE.....G............L..KPKS.TYY.......Y..QR...............---...--.................................---.-.-..-----llndewenpikytt..............................
A0A3Q7J5N1_SOLLC/11-103                .....................................................PLQVHISL.....AG..-....DK.....HM.RITWI..T...N...............................................................................D................GS..SPS..............IV.E..Y.GTS.....P.GK...........................................Y.S.AI.......S.Q..G..E......ST....K.Y.S.YLL......................................................................................YS.S..GKIH..H.T..VIG.....P............L..QENT.TYF.......Y..RC...............GGG...G-.................................---.-.-..-----lefqlktppskf................................
A0A090II36_9GAMM/225-311               ..................................................vqi---THLSV.....IE.rG....DE.....SA.TLSWR..T...N...............................................................................K................P-..TTG..............MV.K..Y.GLT.....E.DL...........................................E.E.DS.......I.T..L..-......--....-.-.-.---......................................................................................-P.L..AKEH..Q.V..TIN.....N............L..NNDT.HYF.......Y..RV...............EAN...VDpk.............................dtIQS.K.M..QSFDT............................................
A0A1U7VAI1_NICSY/68-180                .....................................................PEQIALAL.....SS..S....PT.....SM.WVSWV..T...G...............................................................................Eaqigln....vtphdpTT..VAS..............EV.W..Y.GKE.....S.GK...........................................Y.T.MK.......K.T..G..V......SV....V.Y.S.QLYpfe...............................................................................glwnYT.S..GIIH..H.V..KID.....G............L..EPET.KYY.......Y..KC...............GDS...SL................................aAMS.K.E..LEFET............................................
A0A2P6VHX5_9CHLO/166-269               .....................................................PMQGHLSL.....MG..A....PR.....EV.MVQWV..T...R...............................................................................D................AG..AAP..............TV.R..W.GTS.....P.DA...........................................L.A.AA.......A.H..G..D......SL....T.Y.S.RADmcgap...........................................................................anasgwME.P..GMLH..G.A..VMG.....G............L..QPLT.AYY.......Y..QY...............GDK...EL.................................GWS.E.V..ESF--vs..........................................
ACP7_HUMAN/32-125                      .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A287R077_HORVV/102-220               .....................................................PEQIALAA.....SA..D....PI.....SL.WVSWV..T...Graqigs...................................................................hltpldP................TA..IRS..............EV.W..Y.GER.....P.ASad......................................tvgH.P.HV.......A.R..G..S......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GVIH..H.V..RLV.....G............L..RPST.RYY.......Y..RC...............GDS...SLk...............................gGLS.D.E..RSFRT............................................
A0A314XJF9_PRUYE/10-70                 .....................................................PDQIHLSY.....TD..A....DD.....EM.RVMFL..T...S...............................................................................D................A-..AER..............TV.R..Y.GPS.....D.DS...........................................L.D.DV.......A.V..A..H......LE....R.Y.E.RE-......................................................................................--.-..----..-.-..---.....-............-..----.---.......-..--...............---...--.................................---.-.-..-----hmcdspana...................................
I1R438_ORYGL/55-142                    .....................................................PQQVHISA.....VG..-....SD.....KM.RVTWI..T...D...............................................................................D................D-..APA..............TV.E..Y.GTV.....S.GE...........................................Y.P.FS.......A.A..G..N......TT....T.Y.S.YVL......................................................................................YH.S..GNIH..D.V..VIG.....P............L..KPST.TYF.......Y..RC...............SND...T-.................................--S.R.E..LSFRT............................................
A0A2I4BIN5_9TELE/28-121                .....................................................PEQVHLSY.....AG..V....PN.....SM.VVTWT..T...F...............................................................................N................K-..TQS..............RV.E..Y.GLV.....G.GR..........................................pF.Q.MN.......A.E..G..D......VTl..fV.D.S.GAE......................................................................................KR.Q..MFIH..R.V..TLT.....G............L..KPAA.TYV.......Y..HC...............GGD...E-.................................GWS.D.V..FLFT-a...........................................
A0A1P8XRS2_9ACTN/48-142                ...................................................at--GIVLGV.....GA..G....ES.....QR.VVSWY..T...S...............................................................................A................D-..TPQ..............VV.Q..V.APT.....S.QV...........................................R.G.GQ.......F.P..K..N......SA....T.F.S.ATVaa..................................................................................nsVS.G..GYNA..H.A..TID.....S............L..RKNT.TYS.......Y..RV...............GTQ...G-.................................SWS.P.T..YSFKT............................................
A0A1D7VS89_9ACTN/63-168                .....................................................PFGRHLAF.....GA.dP....RS.....QM.RVSWQ..V...P...............................................................................F................AV..RRP..............YL.R..V.GLT.....P.WD...........................................L.G.RK.......I.E..A..E......VR....P.L.H.TPAlsa................................................................................klpAV.D..QYYL..H.A..ALD.....G............L..RPGT.TYY.......Y..GV...............GHE...GFdpa...........................eprHFS.T.V..GTFRT............................................
A0A067FSP1_CITSI/169-277               .................................................pvyp----RLAQ.....GK..V....WN.....EM.TVTWT..S...G...............................................................................Yg..............iNE..AEP..............FV.E..W.GPK.....G.GD...........................................R.T.YS.......P.A..G..T......LT....-.F.G.RGSmcgap...........................................................................artvgwRD.P..GYIH..T.G..FLR.....E............L..WPNA.MYT.......Y..KL...............GHRl.fNGt...............................yIWS.S.E..YQFK-a...........................................
A0A2U9P1N8_STRAS/74-179                .....................................................PFGRHLAY.....GN.dP....RT.....EM.TISWQ..V...P...............................................................................V................AV..KKP..............FV.R..I.GAH.....P.WD...........................................L.S.RR.......I.E..A..E......VR....A.L.H.TPAgvg................................................................................asgDH.T..QYYL..H.A..KLT.....H............L..RPGR.TYY.......Y..GV...............GHD...G-.................................---.-.-..-----fdpadahllgtlgtftt...........................
A0A0D2E4L5_9EURO/69-172                ..................................................tnn---VNVVQ.....LS.yL....PN.....GI.NIHYQ..T...P...............................................................................F...............gLG..ELP..............TV.M..W.GTS.....A.GK...........................................L.S.NK.......T.Q..G..H......TH....T.Y.D.RTPpcsl..............................................................................vavtQC.S..QFFH..E.V..QIK.....G............L..TAGT.TYY.......Y..QI...............PAA...NG................................tTTS.P.V..MKFTT............................................
V4PJ70_9CAUL/53-154                    .....................................................PERIILNL.....TN.dP....QH.....EM.AVTWR..T...S...............................................................................A................DR..PAG..............RV.Q..Y.AVS.....E.PG...........................................P.N.FV.......K.N..T..R......EV....-.M.A.KSDvltld............................................................................veeqaGF.K..ARYN..S.L..VLT.....G............L..EPST.RYI.......Y..RV...............GDG...T-.................................NWS.E.W..FQFST............................................
A0A183QH72_9TREM/30-137                peqvhialggkatinykyymgyarkyrefnctlxxxxxxxxxxxxxxxxxxxl--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.N.MK.......S.T..G..Y......V-....-.-.-.--Kefid..............................................................................ggreQR.K..MYVH..R.V..ILS.....D............L..IAGT.IYY.......Y..KC...............GSL...D-.................................GWS.D.V..LNFR-a...........................................
A0A0E0GI82_ORYNI/66-157                .....................................................PQQVHITL.....GD.qT....GT.....AM.TVSWV..T...M...............................................................................E................EA..GNS..............TV.L..Y.GLA.....M.DK...........................................L.D.MA.......A.D..A..T......VT....T.Y.T.YYN......................................................................................YT.S..GFIH..H.C..TLT.....N............L..QYGV.KYY.......Y..AM...............GFG...FT.................................VRS.F.W..FT---t...........................................
G9N7D3_HYPVG/66-169                    ..........................................tnnvnvisisy--------.....--..V....PN.....GI.NIHYQ..T...P...............................................................................F...............gLG..EAP..............SV.V..W.GTS.....A.SD...........................................L.S.NT.......A.T..G..K......SV....T.Y.G.RTPscsl..............................................................................vvttQC.S..EFFH..D.V..QIG.....N............L..KPGT.TYY.......Y..QI...............PAA...NG................................tTAS.D.V..LSFKT............................................
S2Z186_9CORY/32-119                    ...................................................yd---LYLGV.....GP..D....ET.....SA.NMSWY..M...P...............................................................................S................R-..QQQ..............YV.E..V.KDA.....S.GH...........................................V.T.RV.......A.G..T..N......T-....R.L.T.T--......................................................................................TR.A..EYST..F.A..NLT.....G............L..TPGE.SYQ.......Y..RV...............GSD...EV.................................GWT.I.W..FDLKT............................................
A0A0P0XNU8_ORYSJ/186-294               .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yd..............iKE..AYP..............FV.E..W.GMK.....W.SP...........................................P.T.RT.......A.A..G..T......V-....T.F.D.RESlcgep...........................................................................artvgwRD.P..GFIH..T.A..FLT.....D............L..WPNK.EYY.......Y..KI...............GHMl.pDGk...............................iVWG.K.F..YSFK-a...........................................
V4UHD2_9ROSI/43-130                    .....................................................PQQVHISL.....AG..-....DS.....HM.RVTWI..T...D...............................................................................D................ES..SPS..............VV.E..Y.GTS.....P.GG...........................................Y.N.CG.......A.E..G..E......ST....S.Y.R.YLF......................................................................................YR.S..GKIH..H.T..VIG.....P............L..EHDT.VYF.......Y..RC...............GRQ...G-.................................---.P.E..FEFKT............................................
A0A1Y2D212_9FUNG/151-241               ...............................................krlsvl-------P.....GK..D....ES.....QL.NFGWY..S...T...............................................................................T................T-..EYP..............LI.R..F.GTT.....K.EL..........................................tE.E.DE.......V.K..G..D......NY....E.C.K.AIN......................................................................................GV.Q..YYCN..Q.V..SVT.....G............L..KPNS.IYY.......Y..KR...............NLD...G-.................................TWE.E.T..IEFKT............................................
A0A3B3YSN0_9TELE/28-121                .....................................................PEQVHLSY.....PG..V....LG.....SM.VLTWT..T...F...............................................................................N................K-..TDS..............KV.E..Y.GLQ.....G.GR...........................................LfE.TS.......A.E..G..D......AT....V.F.V.DSGe....................................................................................eKR.K..MFIH..R.V..TLT.....G............L..KPAA.TYV.......Y..HC...............GSD...E-.................................GWS.D.I..FSFT-a...........................................
A0A2S9BQF9_9MICO/53-149                .....................................................PDRIVLTP.....AA.dA....TT.....QQ.SVTWR..T...S...............................................................................A................TT..DRG..............LV.Q..Y.RTM.....T.PApyp.....................................ggvL.E.AE.......A.A..H..T......--....E.V.T.TDI......................................................................................GY.T..QNMH..T.A..TIT.....G............L..QPGV.EYM.......Y..RV...............GDG...T-.................................NFS.E.W..QDFAT............................................
A0A1H4CEF0_9BACT/30-124                .................................................lcdm--------.....--..T....RD.....GV.TVVWT..T...S...............................................................................K................P-..ALS..............WV.E..V.APD.....D.GRs.........................................fY.A.QE.......H.A..R..H......YQ....T.V.A.GRR......................................................................................LA.D..RTLH..A.V..RLK.....G............L..KPGT.DYC.......Y..RI...............FSQ...EV................................tAW-.-.-..-----pqrgkatygsvvas..............................
A0A059BLE4_EUCGR/1-75                  .....................................................--------.....--..-....--.....-M.RISWV..T...D...............................................................................G................KS..SPS..............YV.E..Y.GTS.....P.GR...........................................Y.D.ST.......A.Q..G..E......ST....S.Y.S.YLF......................................................................................YS.S..GKIH..H.T..VIG.....P............L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.P.-..-----efqlkt......................................
K9B9F6_9STAP/72-224                    .....................................................PNRIIANF.....NG.dT....KS.....QM.GFSWY..T...T...............................................................................D................QF..KDA..............KV.W..V.SKS.....K.DFs........................................daK.E.FD.......A.E..S..K......EV....T.S.N.YVErdkhgniifadvkkddegnpveddkgnk..............................vingyytdknakgpewtsgdmhgdvkttKE.K..EYTY..K.A..KAE.....G............L..DPNT.EYY.......Y..RV...............GSE...NG.................................PKS.E.V..GTFKT............................................
A0A199UA04_MANES/49-136                .....................................................PQQVHISM.....VG..-....ED.....KM.RISWI..T...D...............................................................................D................P-..TPS..............IV.D..Y.GTS.....P.GV...........................................Y.S.SS.......A.N..G..T......SS....S.Y.R.YIT......................................................................................YN.S..GEIH..N.V..VIG.....P............L..NPNT.VYY.......Y..RC...............SSN...S-.................................--A.R.Q..FSFKT............................................
A0A3Q0I4Q8_PHODC/70-182                .....................................................PEQISVSL.....SA..T....PD.....SV.WISWV..T...G...............................................................................Nfqiged....ikpldpTS..VAS..............VV.R..Y.GRL.....R.QP...........................................L.T.QK.......A.V..G..H......SL....V.Y.S.QLYpfe...............................................................................glknYT.S..GIIH..H.V..RLT.....G............L..KPGS.KYY.......Y..RC...............GDA...SL................................qAMS.N.I..HVFKT............................................
A0A1B6PD28_SORBI/64-157                .....................................................PQQVHITL.....GD.qE....GT.....AM.TVSWV..T...A...............................................................................S................EL..GNS..............TV.K..F.GEK.....P.DPe.........................................kM.E.RR.......A.E..G..T......HT....R.Y.D.YFN......................................................................................YT.S..GFIH..H.C..TLK.....H............L..KHST.KYY.......Y..AM...............GFG...H-.................................-TV.R.T..FSFTT............................................
A0A067LF84_JATCU/46-133                .....................................................PQQVHISL.....AG..-....KD.....HM.RVSWV..T...E...............................................................................N................KH..VRS..............NV.E..Y.GKE.....P.GK...........................................Y.N.EM.......A.T..G..E......NT....S.Y.R.YFF......................................................................................YS.S..GRIH..H.V..KIG.....P............L..EPNT.TYY.......Y..RC...............GGS...G-.................................---.P.E..FSFRT............................................
A0A316ELC0_9FLAO/56-162                .....................................................PDRIISNL.....TE.dA....AH.....SF.AVNWR..T...D...............................................................................Q................QV..PNG..............VV.E..V.ALA.....T.DGpef.....................................llgK.V.RQ.......I.K..A..V......SQ....L.F.E.NQNrn..................................................................................epLV.K..ATYH..S.A..KID.....G............L..QPNT.TYV.......Y..RV...............GNG...QKd..............................ngYWS.E.W..FQITT............................................
I1QLK5_ORYGL/177-288                   .................................................pvyp----RLAQ.....GK..S....YD.....EM.TVTWT..S...G...............................................................................Yd..............iSE..AYP..............FV.E..W.GMV.....V.AGa........................................aaP.T.RT.......A.A..G..T......L-....T.F.N.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FLR.....D............L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.K.Q..YTFR-a...........................................
A0A415DXJ7_9BACT/269-364               ..............................................ylqnpvg--------.....--..-....-N.....GI.TVMWQ..T...T...............................................................................V................P-..TYS..............WV.E..Y.GTD.....K.NQ...........................................L.K.KA.......R.T..L..V......--....-.-.D.GQV......................................................................................IC.N..DIQQ..K.I..RLE.....N............L..EPGK.TYY.......Y..RV...............CSQ...EImlyqay....................kkifgetAVS.D.F..HSF--tl..........................................
A0A366R5Q9_9HYPO/109-210               .........................................yipakheeatvg--------.....--..-....--.....-I.NIHYQ..T...P...............................................................................F...............gLA..TEP..............SV.Q..W.DTG.....A.SA...........................................L.N.NL.......A.T..G..K......SK....T.Y.D.RTPpcsl.............................................................................innviQC.S..QFFH..N.V..HIE.....N............L..EPGT.TYY.......Y..QI...............PAA...NG................................tPQS.D.V..LSFIT............................................
A0A287S1W1_HORVV/67-180                .....................................................PEQVAVAL.....SA..A....PT.....SA.WVSWI..T...G...............................................................................Efqmggt....vkpldpRT..VGS..............VV.R..Y.GLA.....A.DS...........................................L.V.RE.......A.T..G..D......AL....V.Y.S.QLYpfe...............................................................................glhnYT.S..GIIH..H.V..RLQ.....G............L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.A.V..HAFRT............................................
A0A0D2V8Z6_GOSRA/1-76                  .....................................................--------.....--..-....--.....--.MVSWV..T...A...............................................................................D................KP..GSS..............RV.Q..Y.GTS.....E.KK...........................................Y.D.FK.......A.D..G..T......VA....N.Y.T.FYN......................................................................................YK.S..GYIH..H.C..LVD.....G............L..EYET.KYY.......Y..KI...............GEG...H-.................................-SS.R.E..FWFQT............................................
Q0AVG7_SYNWW/44-137                    .....................................................PDHIMLSW.....TD.dP....QT.....TR.TMAWR..S...D...............................................................................S................AA..DQE..............WV.Q..Y.LPA.....A.NY...........................................N.G.SF.......T.S..A..S......RV....A.A.V.KTE......................................................................................LY.T..GYSH.cE.A..TLF.....Q............L..APDC.KYI.......Y..RV...............GRE...G-.................................VWS.E.P..ASFST............................................
J0N5M6_9CLOT/56-152                    ....................................................y-QQVSLTP.....GK..N....ET.....EL.NLGWY..S...K...............................................................................T...............gTT..ATP..............VV.R..L.ATK.....E.DM..........................................sD.A.KT.......F.T..G..T......TS....P.-.-.--A......................................................................................ID.G..YISN..K.V..TVS.....G............L..KENS.TYY.......Y..TY...............QVN...GV.................................---.-.-..-----esnpvkyatksfssfk............................
J3N632_ORYBR/1-75                      .....................................................--------.....--..-....--.....-M.RVTWI..T...G...............................................................................D................D-..APA..............TV.E..Y.GTT.....S.GQ...........................................Y.P.FS.......A.T..G..S......TD....T.Y.S.YVL......................................................................................YH.S..GKIH..D.V..VIG.....P............L..KPST.TYY.......Y..RC...............SND...T-.................................--S.R.E..FSFRT............................................
B1BZV7_9FIRM/238-330                   ..................................................qka---LNLTV.....GK..D....ET.....EM.NLTWY..A...N...............................................................................T................S-..EIG..............TV.E..Y.AKA.....S.ED...........................................G.E.FP.......S.E..F..T......TVn..aT.G.N.QSN......................................................................................DN.G..FYYN..Q.A..TLT.....N............L..EENT.KYV.......Y..RL...............VND...D-.................................TVS.K.T..YEFTT............................................
A0A1Z5SQM7_HORWE/70-174                ............................................tnnvnvisl--------.....-A.yV....PG.....GM.NIHYQ..T...P...............................................................................F...............gLG..EAP..............CI.S..Y.GVF.....P.HA...........................................L.S.HV.......A.T..G..K......SR....T.Y.G.RTPscsq.............................................................................idaitQC.N..EFFH..D.V..QIA.....N............L..TSDT.TYY.......Y..RI...............EAA...NG................................tTES.P.I..LSFKT............................................
N1S1R9_FUSC4/70-173                    ...........................................nnvnvislsy--------.....--..S....PG.....GI.NIHYQ..T...P...............................................................................F...............gLG..AAP..............AV.H..W.GTS.....A.SE...........................................L.K.NK.......A.T..G..S......TT....T.Y.D.RTPpcsa.............................................................................vkavtQC.N..QFFH..D.V..QIS.....D............L..KPGK.TYY.......Y..QI...............PAA...NG................................tTKS.D.V..LSFTT............................................
A0A453T6U0_AEGTS/55-125                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................S................EP..APT..............QV.F..Y.SKE.....E.NR...........................................Y.D.QK.......A.Q..G..T......MT....N.Y.T.FYD......................................................................................YK.S..GYIH..H.C..LVE.....G............L..E---.---.......-..--...............---...--.................................---.-.-..-----v...........................................
A0A0E0MCI6_ORYPU/139-227               .....................................................PQQVHISI.....VG..-....EK.....NM.RISWV..T...D...............................................................................D................LN..APS..............VV.E..Y.GTS.....P.GK...........................................Y.T.AS.......A.T..G..D......HT....T.Y.R.YFF......................................................................................YK.S..GAIH..H.V..TIG.....P............L..DAST.TYY.......Y..RC...............GKA...GD.................................---.-.-..-----eftlrtp.....................................
A0A1B6PF13_SORBI/73-166                .....................................................PQQVHIGL.....AD.qT....GT.....SM.FVSWV..T...V...............................................................................E................AE..GNS..............TV.L..Y.GLA.....A.DK...........................................L.D.LA.......A.E..G..T......IT....R.Y.T.YYN......................................................................................YT.S..GYIH..H.A..TLT.....N............L..QHGT.RYH.......Y..AV...............GVG...VG.................................DTV.R.A..FWFTT............................................
A0A2C9JIZ3_BIOGL/30-122                .....................................................PEQIHISY.....GA..K....PN.....QM.MIVWS..Q...L...............................................................................N................QT..QIN..............GV.R..Y.GLN.....G.QL...........................................D.Q.QK.......L.G..N..S......TK....F.V.D.GGT......................................................................................EH.R.fQFIS..K.V..LLD.....D............L..IPGK.VYT.......Y..IV...............GNE...Y-.................................EFS.D.K..FTFQ-a...........................................
A0A0D9WSJ1_9ORYZ/133-224               .....................................................PQQVHITQ.....GD.yD....GK.....AV.IVSWV..T...V...............................................................................S................EP..GTS..............EV.F..Y.GKN.....E.HH...........................................Y.D.QR.......A.E..G..T......VT....N.Y.T.FYD......................................................................................YK.S..GYIH..H.C..LVD.....G............L..EYST.KYY.......Y..KI...............GSG...D-.................................-SA.R.E..FWFET............................................
A0A2N5N0S5_9BACL/229-341               .....................................................PQSVALTF.....HG.dP....RT.....EL.GVAWY..T...Y...............................................................................E................DY..PGT..............KL.Q..V.AEK.....S.GApagg..................................gfpadK.A.LT.......F.E..G..S......AE....R.V.E.TYQtkad.............................................................................kaagkKT.V..YQSH..K.A..KAV.....G............L..KPGT.DYV.......F..RV...............GDG...ED................................gHWS.G.T..GSFRT............................................
M4DT62_BRARP/176-285                   ..................................................pvy---PRLAL.....GK..E....WN.....EM.TVTWT..S...G...............................................................................Yg..............pDV..AEP..............VV.E..W.GIK.....G.GK...........................................R.K.L-.......S.P..A..R......TL....T.Y.G.RNDlcgpp...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPSS.KYT.......Y..KV...............GHR..lSNag.............................afIWS.K.E..YHFK-s...........................................
A0A2G5TG67_9PELO/21-104                .....................................................PEQVHIAF.....YT..S....PW.....DI.SVSWI..T...F...............................................................................E................Q-..AEP..............SL.S..F.GTS.....T.ST...........................................M.Q.-N.......V.S..G..T......TN....T.W.V.F-G......................................................................................GI.T..RHSH..S.V..ILK.....D............L..KPST.QYY.......Y..QI...............EK-...--.................................---.-.-..-----rlfnfrs.....................................
A0A2P5DFV2_TREOI/116-224               .................................................plyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Yn..............iDE..AVP..............FV.E..W.GMR.....G.GN...........................................Q.V.RS.......P.A..G..T......L-....T.F.G.RHSmcgsp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....N............L..WPNT.VYT.......Y..RM...............GHL..lSNg..............................lyVWS.R.I..YSFK-s...........................................
A0A395MWK9_9HYPO/27-115                .....................................................PVQQRLAF.....NG..-....PN.....SV.TIGWN..T...Y...............................................................................A................KQ..VKS..............CV.N..Y.GTS.....K.DA...........................................L.N.QQ.......A.C..S..D......VS....-.L.T.-YP......................................................................................TS.R..TWAN..T.V..TLD.....N............L..SPAT.TYY.......Y..KI...............GSK...KS.................................---.-.-..-----aidqflspr...................................
A0A1A5YTE1_9BACL/598-704               .....................................................PQYVQTYV.....SE.dM....SS.....QL.SAAWQ..T...R...............................................................................P................DR..AVT..............YI.E..Y.REA.....S.LEgvgid................................sdsngiR.R.LQ.......A.E..S..E......LQ....V.L.S.MKEn...................................................................................gtKG.E..IRFH..N.A..LIE.....G............L..KPNT.AYN.......Y..RV...............GYE...G-.................................NWS.E.W..FLYRT............................................
A0A2G3BW56_CAPCH/14-78                 ...............................................ynapqq--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.SKA.....N.SK...........................................M.K.QK.......A.E..G..T......VT....S.Y.K.YHT......................................................................................YT.S..GYIH..H.C..SIQ.....N............L..EYNT.KYY.......Y..MV...............GIG...H-.................................-TT.R.T..FWFVT............................................
A0A498I6L6_MALDO/180-288               .................................................plyp----RLAL.....GK..H....WD.....EM.TVTWT..S...G...............................................................................Yd..............iSE..AVP..............FV.E..W.GFA.....G.EA...........................................R.T.RS.......P.A..G..T......L-....T.F.P.RGSmcdep...........................................................................artvgwRD.P..GFFH..T.S..FLK.....D............L..WPNS.KYT.......Y..KL...............GHRl.yNGs...............................yIWS.K.T..YNFT-s...........................................
A0A2Y9ASE9_9MICO/64-161                .....................................................PDRITLTP.....AD.dP....TT.....GQ.RITWR..T...G...............................................................................T................GI..AEP..............MV.E..Y.RTL.....T.PApy......................................pggV.Q.RT.......L.A..A..S......ST....E.H.T.TDL......................................................................................GY.T..QVVH..T.V..ELS.....G............L..AAGT.QYM.......Y..RV...............GDG...T-.................................NFS.E.W..QDFAT............................................
A0A059ANQ1_EUCGR/68-159                .....................................................PQQVHITQ.....GD.hV....GK.....GV.IVSWV..T...P...............................................................................D................EP..GSS..............VV.L..Y.WSK.....N.SE...........................................H.K.KK.......A.K..G..K......VN....R.Y.E.FYN......................................................................................YT.S..GYIH..H.C..TLN.....D............L..MYNT.KYY.......Y..EV...............GIG...H-.................................---.-.-..-----tvrqfwfit...................................
A0A1S3DYU7_CICAR/116-224               ..................................................pvy---PRLAL.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yg..............iSD..AEP..............VV.E..W.GPK.....G.ED...........................................H.V.HS.......P.A..G..T......LT....-.F.T.RDSlcgap...........................................................................aksvgwRD.P..GYIH..T.S..YLK.....E............L..RPNI.IYE.......Y..KI...............GHR..lNNg..............................tyIWS.K.Q..YQFR-a...........................................
A0A3Q7HZC0_SOLLC/1-76                  .....................................................--------.....--..-....--.....-M.RVTWI..T...S...............................................................................H................KH..EKS..............IV.E..Y.GTS.....P.GN...........................................Y.D.KS......sT.T..G..E......RM....S.Y.R.YFF......................................................................................YN.S..GVIH..H.I..TIG.....P............L..GPNK.TYY.......Y..RC...............GGN...G-.................................---.P.E..FSFKT............................................
A0A1Y3MUE5_PIRSE/1-100                 ..................................................min-----TGP.....GT.dC....SN.....EI.SIAWH..S...P...............................................................................Y................E-..-KN..............YV.E..Y.TTA.....S.DS...........................................N.F.KN.......S.K..K..L......NV....T.C.S.FRNkdref...........................................................................indklnPV.T..FYAC..K.T..SLK.....S............L..SSNT.DYI.......Y..RV...............GND...Y-.................................SRS.D.S..KKFKT............................................
A0A0P1AKJ6_PLAHL/86-192                .....................................................PKHVHTAY.....GH..T....AG.....SL.AVQWM..T...K...............................................................................Ef..............cGE..GTA..............QI.Q..M.IEG.....Y.HAriete................................gpnmtpV.V.AW.......A.N..S..T......LF....E.D.D.GEK......................................................................................QS.K..RWLH..V.V..RLN.....G............L..KVDT.RYT.......Y..VV...............GNA...HY................................aSWS.I.P..YVTKT............................................
A0A067DW36_CITSI/2-102                 ...............................yivwinefagefqignniksln--------.....--..-....--.....--.-----..-...-...............................................................................P................KS..VTS..............VV.R..Y.GTL.....R.SQ...........................................L.N.RR.......A.T..C..H......SL....V.S.N.QLYpff...............................................................................rpskLH.L..WNHT..Q.C..SSH.....I............L..KPDT.LYY.......Y..QC...............GDP...SI................................pAMS.G.T..YYFRT............................................
T1LMZ2_TRIUA/160-269                   ..................................................pvf---PRLSQ.....GK..Q....WN.....EM.AVTWT..S...G...............................................................................Y................NI..GEAy............pFV.E..W.RMK.....G.EE...........................................T.S.KR.......T.P..A..G......TL....T.F.T.RGHlcgnp...........................................................................argqgyRD.P..GYIH..T.A..FLK.....D............L..WPNR.EYS.......Y..QI...............GHE..lQDg..............................tvAWG.K.S..ATFR-a...........................................
A0A2V3JQC5_9EURY/544-631               ................................................pvits-----VHA.....TG.iT....NN.....SA.VITWD..T...D...............................................................................E................M-..SDS..............LV.K..Y.GTE.....S.GN...........................................Y.P.IT.......T.Y..N..E......IN....-.-.-.---......................................................................................--.-..VTFH..S.I..NLA.....G............L..SPGT.TYY.......Y..AV...............NST...DQsn.............................npAQS.T.E..YNFTT............................................
A0A1U8GAY3_CAPAN/60-151                .....................................................PQQVYITQ.....GD.hD....GK.....GV.IVSWT..T...P...............................................................................N................EP..GAN..............TV.L..Y.WTE.....N.SC...........................................V.K.SS.......A.E..G..F......VV....R.Y.K.YCN......................................................................................YT.S..GYIH..H.C..TIN.....D............L..EFDT.KYY.......Y..EV...............GLG...N-.................................-TT.R.Q..FWFVT............................................
A0A251V2W9_HELAN/60-151                .....................................................PQQVHITQ.....GD.hV....GK.....AV.IVSWV..T...V...............................................................................D................EP..GSS..............TV.L..Y.WPQ.....D.GT...........................................Q.K.DQ.......A.T..G..Q......IT....T.Y.K.YYN......................................................................................YT.S..GYIH..H.C..TLH.....N............L..EFNT.KYY.......Y..EV...............GID...H-.................................-TT.R.T..FWFVT............................................
A0A383VSN8_TETOB/161-263               .....................................................PLQRHLAL.....TG..D....NT.....QM.MVQWV..T...K...............................................................................N................S-..SNP..............TV.K..W.GTS.....P.GA...........................................Y.N.HS.......A.A..A..V......SS....T.Y.S.RQElcgpp...........................................................................andagfVD.P..GLFH..A.A..LVE.....G............L..TPGQ.RYY.......Y..VV...............GDE...EW.................................GFS.P.E..ASF--va..........................................
A0A287PGX7_HORVV/85-193                .................................................pvyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Ys..............tKE..ATP..............FV.E..W.GIQ.....G.QI...........................................Q.I.LS.......-.P..A..G......TL....T.F.S.RDTmcgpp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNL.KYT.......Y..RI...............GHRl.fNGq...............................iVWG.R.Q..YSFK-a...........................................
A0A345HN20_9ACTN/76-178                .....................................................PDRILLTP.....TT.tP....AT.....SQ.KVTWR..A...K...............................................................................A................EA..PYA..............QA.Q..F.MEA.....P.RA...........................................L.G.DV.......A.P..A..A......GA....V.T.S.VQAeatns............................................................................vntslGY.A..STYH..T.A..QFT.....G............L..KPAT.RYT.......Y..RV...............GDG...T-.................................NWS.P.W..TDFTT............................................
A0A371FZ86_MUCPR/169-277               ..................................................pvy---PRLAL.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yg..............iSD..AEP..............FV.Q..W.GPK.....G.GD...........................................H.V.HS.......P.A..G..T......L-....T.F.T.RDSmcgap...........................................................................artvgwRD.P..GYIH..T.S..HLK.....E............L..WPNR.IYE.......Y..RI...............GHK..lNNa..............................tyIWS.G.N..YQFR-a...........................................
A0A2P5EC92_TREOI/55-142                .....................................................PQQVHISL.....VG..-....KD.....HM.RVSWI..T...E...............................................................................H................KH..TKS..............IV.E..Y.GKS.....P.GE...........................................Y.S.DT.......S.T..G..E......HT....S.Y.K.YFF......................................................................................YS.S..GRIH..H.V..TIG.....P............L..ELST.TYY.......Y..RC...............GGS...G-.................................---.P.E..FSFRT............................................
A0A0M3CFJ3_9SPHI/38-135                .....................................................PDRITLTW.....SD.qP....ST.....TQ.SVSWR..I...N...............................................................................G................SA..TKA..............VG.Q..V.VEE.....Q.SS...........................................P.D.LE.......K.S..A..Q......TV....L.G.V.TSPlk.................................................................................iegQT.A..DNYG..Q.V..SFQ.....G............L..KPGT.IYT.......Y..RV...............GDG...T-.................................NWS.A.W..NQFRT............................................
A0A1Y3N1A2_PIRSE/52-159                ....................................................f-ERISVFV.....GD..N....ES.....NI.NFAWY..S...T...............................................................................E................Q-..STP..............LI.K..V.CKN.....E.AMtdd.....................................cttY.E.GT.......F.E..A..Q......IE....R.S.D.DKSknyie...........................................................................kdlkinGK.R..YFTN..R.V..TAS.....N............I..ERNT.TYF.......Y..QR...............YIH...G-.................................EWE.E.S..IQFNT............................................
A0A075K6R6_9FIRM/39-135                ....................................................a-DHITLTW.....AG.dP....RT.....TQ.TITWR..T...E...............................................................................V................TT..AAG..............QV.Q..Y.AEV.....T.ESk.........................................lL.P.NA.......A.K..I..A......IA....E.V.E.QLFt....................................................................................nMG.S..MSIH..S.A..TLT.....G............L..KPNT.RYK.......Y..QV...............GDG...S-.................................LWS.E.P..RTFLT............................................
R5YAM8_9FIRM/62-155                    ....................................................y-EHVSLTP.....GA..D....ET.....QL.NYAWY..S...H...............................................................................T................V-..ETP..............KV.R..V.ATK.....Q.NM...........................................DgA.IE.......F.E..G..T......QT....E.A.V.TID......................................................................................GV.K..YYSN..K.V..IVK.....N............L..KADT.NYY.......Y..QV...............MQN...G-.................................KWQ.D.A..EVY--ttks........................................
A0A428TYU1_9HYPO/5-100                 ...............................................sywlkg--------.....--..-....--.....-I.NVHFQ..T...P...............................................................................F...............gLG..ESP..............SV.R..W.GKS.....P.NS...........................................L.T.NT.......A.K..G..S......SK....T.Y.D.RTPpcsm.............................................................................ikavtQC.S..QFFH..N.V..EIT.....G............L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.D.V..LSFKT............................................
A0A061EK97_THECC/643-755               .....................................................PEQISVSL.....SS..N....CS.....SV.WISWV..T...G...............................................................................Efqfgdd....ikpldpQS..VAS..............VV.Q..Y.GTF.....N.SS...........................................R.N.NQ.......A.T..G..N......SL....V.Y.S.QQYpye...............................................................................glksYT.S..GIIH..C.V..LVT.....G............L..DPDT.LYE.......Y..QC...............GDP...SI................................pAMS.D.V..HYFRT............................................
A0A1K1PT88_SELRU/42-131                ..............................................ealrqli--------.....TS.dP....RT.....SR.TIMWQ..S...K...............................................................................T................PL..EDC..............RL.Q..Y.QAD.....G.AP...........................................S.Q.SL.......P.V..A..M......ES....L.T.-.-ED......................................................................................RV.T..NYYY..T.V..YLQ.....S............L..TPGT.TYH.......Y..RI...............WQG...N-.................................MAT.P.W..QEFIT............................................
A0A2D3V946_9PEZI/80-184                ...................................................nn--NINVIS.....TS.yV....PR.....GM.NVHFQ..T...P...............................................................................F...............gLG..TAP..............TV.H..W.GLS.....P.KN...........................................L.C.NT.......T.R..G..Q......TQ....T.Y.D.RTPpcse.............................................................................iavitQC.S..QYFH..D.V..QLT.....N............L..KSFT.KYY.......Y..KI...............EAA...NG................................tTAS.Q.I..LEFTT............................................
A0A0D3D354_BRAOL/54-148                .....................................................PEQVHITQ.....GD.hN....GR.....GM.IISWV..T...P...............................................................................I...............nDD..GSN..............VV.Q..Y.WVA.....D.GDe.........................................sT.K.KS.......A.E..A..S......TS....T.Y.R.YYD......................................................................................YA.S..GFLH..H.A..TIK.....K............L..EYST.KYF.......Y..EL...............GTG...R-.................................-ST.R.R..FSFTT............................................
A0A176J5D3_9BACI/1115-1215             .....................................................PERLNVTF.....TG..K....PS.....SR.NISWT..T...A...............................................................................P................QV..TDS..............VV.Q..I.AKL.....E.DY...........................................K.K.DG.......F.N..G..K......RF....T.A.K.NGKstp...............................................................................lamdEG.E..LQAH..T.A..EVI.....G............M..VPGQ.MYM.......Y..RA...............GDG...TP................................eGWS.E.P..AEIK-a...........................................
A0A452ZW22_AEGTS/79-192                ..................................................pvf---PRLAQ.....GK..T....HD.....EM.TVTWT..S...G...............................................................................Yn..............iDE..AYP..............LV.E..W.GMV.....A.PGgg.......................................vrN.P.TR.......T.P..A..G......TL....T.F.N.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FMR.....D............L..WPNK.EYT.......Y..KS...............GHE..lSDg..............................tmVWG.K.S..YTFR-a...........................................
A0A167QME1_9HYPO/73-174                ..................................................inv---ISLSY.....AG..-....ST.....GV.NIHYQ..T...P...............................................................................F...............gLG..SAP..............SV.S..W.GTS.....H.DA...........................................L.D.KT.......A.N..G..A......SH....S.Y.A.RTPpcse..............................................................................vavtQC.S..QYYH..D.V..QIK.....D............L..KPDT.TYY.......Y..KI...............AAA...NG................................tTAS.D.V..LSFKT............................................
A0A452S774_URSAM/28-117                ...............................................apfspg--------.....--..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TPS..............EV.Q..F.GLQ....lT.GP...........................................L.P.LL.......A.Q..G..T......FS....P.F.V.DGGa....................................................................................lRR.K..LFIH..R.V..TLR.....G............L..LPGV.QYV.......Y..RC...............GSS...Q-.................................GWS.R.R..FRFR-a...........................................
A0A2P6NST0_9MYCE/38-133                ....................................................v-DHIHLAV.....TG..I....KG.....EM.IVMFA..T...S...............................................................................I................NV..SSA..............QV.E..Y.WTA.....S.NTsa.......................................rlL.S.DV.......A.T..L..T......QY....N.T.N.-DS......................................................................................YT.S..PFIQ..S.V..TLK.....G............L..QAGT.QYF.......Y..RC...............GDP...SL.................................VWS.A.D..FNFTT............................................
A0A2K9PKI4_9FLAO/22-114                .................................................tnky----RLTI.....RD.nP....AT.....SI.VIGWN..Q...V...............................................................................S................G-..SNA..............VV.Y..Y.GTT.....D.FG...........................................T.N.WS.......S.Y..P..N......SK....T.V.SrSVN......................................................................................YK.S..MNNR..F.A..RLT.....G............L..QPNT.NYY.......F..VL...............RDN...Q-.................................GTS.R.R..FWFRT............................................
I1PL09_ORYGL/52-141                    .....................................................PQQVHVSL.....VG..-....AN.....HM.RVSWI..T...E...............................................................................D................KH..VKS..............VV.E..Y.GKV.....S.GN...........................................Y.T.AS.......A.T..G..E......HT....S.Y.R.YFL......................................................................................YS.S..GKIH..H.V..KIG.....P............L..DPGT.VYY.......Y..RC...............GMA...G-.................................---.-.-..-----defglrtpp...................................
A0A0X3SMJ8_9ACTN/66-183                .....................................................PFGRHLAF.....GA.dP....RS.....QM.RISWQ..V...P...............................................................................L................AV..RKP..............FV.R..V.GLK.....P.WE...........................................L.S.RR.......I.E..A..E......VR....H.L.H.TPPlsd................................................................................qvpGV.D..QFYP..H.A..ALD.....G............L..RPGT.TYY.......Y..GV...............GHE...G-.................................-WD.-.-..-----padprhygslgtfrtapgtaevftfta.................
A0A2T4ABT7_TRIHA/22-112                ....................................................n-SQIRIAY.....HG..-....DD.....GM.MVSWN..T...F...............................................................................D................HV..PRP..............SV.F..W.GRS.....K.EH...........................................L.T.NV.......A.S..S..A......VS....V.T.-.-YP......................................................................................TS.T..TYNN..H.V..LIK.....G............L..RPDT.TYY.......Y..LP...............AQL...NE................................dVCY.E.P..FNFTT............................................
A0A1L9U7H7_ASPBC/1-77                  .....................................................--------.....--..-....--.....--.MVSWN..T...F...............................................................................H................KL..GKP..............TV.H..F.GLS.....A.NN...........................................L.N.ET.......A.S..S..H......IS....V.T.-.-YP......................................................................................TS.L..TYNN..H.V..LLT.....G............L..SPDT.TYF.......Y..LP...............AHL...AD................................sHSS.V.P..YNFTT............................................
A0A225WZ84_9STRA/183-289               .....................................................PKHVHTAY.....GL..K....PG.....SL.AVQWM..T...K...............................................................................Ef..............cGE..GDA..............QL.Q..L.MEG.....Y.HArieve................................gpnatpV.T.AW.......A.N..T..T......LF....E.D.D.GEK......................................................................................QS.K..RWMH..V.V..RLE.....G............L..KPDT.RYT.......Y..VV...............GNA...HY................................aSWS.I.P..YVTKT............................................
A0A445A6Q5_ARAHY/64-156                .....................................................PQQVHITQ.....GD.lE....GK.....AV.IVSWV..T...M...............................................................................D................EK..GSN..............QV.R..Y.WSE.....K.DK..........................................sK.P.KV.......S.N..G..K......VV....T.Y.K.YHT......................................................................................YK.S..GYIH..H.C..TIK.....K............L..EHNT.KYY.......Y..EV...............GTG...KS.................................--A.R.Q..FW---fmt.........................................
A0A1Q3D2K1_CEPFO/70-161                .....................................................PQQVHITQ.....GD.hV....GK.....AV.IVSWV..T...A...............................................................................N................EP..GSN..............TV.L..Y.WSE.....G.SE...........................................I.K.KK.......A.E..G..K......VH....T.Y.T.YSN......................................................................................YT.S..GYIH..H.C..TIR.....N............L..EDNT.KYH.......Y..VI...............GID...H-.................................---.-.-..-----tmrkfwfit...................................
A0A251U9Q9_HELAN/101-216               .....................................................PEQISISL.....ST..N....YH.....SI.WISWI..T...G...............................................................................Efqigds....ikpldpDS..VAS..............VV.Q..Y.GKV.....K.SLd........................................kvH.S.QR.......A.E..G..Y......SL....I.Y.N.QLYpfe...............................................................................glhnYT.S..GIIH..H.V..KLT.....G............L..SPDT.VYY.......Y..RC...............GDP...SI................................gAMS.D.V..FRFKT............................................
A0A1W4V154_DROFC/34-128                .....................................................PEQVHLAF.....GD..N....LR.....DI.VVTWS..T...R...............................................................................G................SP..NAS..............VV.N..F.ARN.....Y.LT..........................................dK.L.TS.......V.N..G..T......WQ....R.F.V.DGGk....................................................................................kAR.T..QFIH..N.V..ELK.....D............L..EPET.RYE.......Y..SC...............GSP...L-.................................GWS.S.V..FSFKT............................................
A0A078JJN4_BRANA/76-187                .....................................................PEQISLAL.....SS..N....YD.....SI.WVSWI..T...G...............................................................................Efqigmn....vtpldpTS..IAS..............IV.Q..F.GTL.....G.DS...........................................L.I.HT.......A.T..G..S......SL....V.Y.N.QLYpfe...............................................................................gllnYT.S..GIIH..H.V..RIT.....G............L..QPST.VYY.......Y..RC...............GDP...SH.................................GMS.K.I..HHFKT............................................
A0A0K0EAF3_STRER/25-113                ....................................................h-EQVHLAL.....TK..D....PR.....SI.VVSWT..T...F...............................................................................Ydi...........slyK-..RKP..............SV.K..Y.GTI.....K.SS...........................................L.S.KV.......K.R..G..S......TG....S.T.R.KLIep.................................................................................nnsTI.I..RYFH..T.I..YLQ.....N............L..LYNK.RYY.......Y..KV...............GD-...--.................................---.-.-..-----............................................
V4SW87_9ROSI/216-319                   .................................................plyg----HLSS.....VD.sT....GT.....SM.RVTWV..S...G...............................................................................D................K-..EPQ..............QV.E..Y.GDD.....G.KT...........................................L.T.SE.......V.S..-..-......--....T.F.T.KENmcssalp.......................................................................spakdfgwHD.P..GYIH..T.A..VMT.....G............L..QPSS.TVS.......Y..RY...............GSE...AV.................................DWS.D.K..IQFRT............................................
A0A2U1PCC0_ARTAN/52-139                .....................................................PQQVHISL.....AG..-....DK.....HI.RVTWT..T...S...............................................................................D................SS..SPS..............LV.E..Y.GTS.....P.GE...........................................Y.T.YR.......G.H..G..D......TT....S.Y.S.YLL......................................................................................YN.S..GTIH..H.T..VIG.....P............L..DHNT.VYY.......Y..RC...............GGQ...G-.................................---.P.E..LSFKT............................................
A0A2M9JV36_9ACTN/77-182                ....................................................p-FARHLAY.....GT.dA....RT.....EM.TVSWQ..V...P...............................................................................V................AV..KNP..............YI.R..V.GVH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....P.L.Y.TPAgvg................................................................................tgaDH.T..QYYL..H.A..QLT.....R............L..RPGT.TYY.......Y..GV...............GHD...G-.................................---.-.-..-----fdpaaahlagtlgtfrt...........................
G7L615_MEDTR/54-141                    .....................................................PQQVHISL.....VG..-....KD.....KM.RVSWI..T...E...............................................................................D................KE..TET..............MV.E..Y.GTK.....A.GE...........................................Y.S.EK.......T.M..G..E......HT....S.Y.Q.YFF......................................................................................YN.S..GKIH..N.A..VIG.....P............L..EPNT.TYF.......Y..RC...............GGL...G-.................................---.P.E..FSFKT............................................
A0A1R3IY57_COCAP/60-151                .....................................................PQQVHITQ.....GD.yL....GK.....GV.IISWV..T...P...............................................................................D................EP..GSN..............LV.H..Y.WAE.....N.SK...........................................V.K.SS.......A.E..S..I......VL....T.Y.K.YYN......................................................................................YT.S..GYIH..H.C..TIK.....D............L..KYDT.KYY.......Y..EV...............GIG...N-.................................-SS.R.Q..FWFRT............................................
D6K1I5_9ACTN/83-188                    .....................................................PFGRHLAY.....GN.dP....RT.....EI.TVSWQ..V...P...............................................................................V................AV..KKP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.Y.TPAgvg................................................................................asgDH.T..QYYL..H.A..KLT.....H............L..RPGR.TYY.......Y..GV...............GHQ...G-.................................---.-.-..-----fdpaqahlagtlgtftt...........................
R4K6T8_CLOPA/49-144                    ...................................................ft--DISLSV.....GS..N....PT.....DL.NLTWY..S...L...............................................................................N................SK..GTA..............TV.Q..V.ALK.....S.DY...........................................N.G.TS.......F.P..A..D......KA...rV.F.T.GTTs...................................................................................lgNN.G..FTSY..K.V..NTN.....G............F..AEST.QYV.......Y..RL...............GDG...T-.................................NWS.P.V..YNYNT............................................
A0A287LTF1_HORVV/91-194                .....................................................PLHGHLSS.....TD.sT....AT.....SM.RITWV..S...G...............................................................................D................G-..RSQ..............QV.Q..Y.AGG.....R.VA...........................................A.S.AA.......T.T..F..T......QK....E.M.C.--Svpvlps.........................................................................pakdfgwHD.P..GYIH..S.A..VMT.....G............L..QPSQ.SYD.......Y..RY...............GSD...SV.................................GWS.D.T..VKFRT............................................
A0A059BMI9_EUCGR/44-131                .....................................................PQQVHISL.....AG..-....EG.....HK.CISWV..T...D...............................................................................G................KS..SPS..............YV.E..Y.GTS.....P.GR...........................................Y.D.ST.......A.Q..G..E......ST....S.Y.S.YLF......................................................................................YS.S..GKIH..H.T..VIG.....P............L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.-.-..-----pefrlkt.....................................
H3GBF7_PHYRM/67-161                    .........................................nanaaaselrlg--------.....--..-....--.....-M.TVSWA..T...E...............................................................................V................KT..TKS..............TV.R..Y.GLD.....K.DA...........................................L.S.TV.......Q.Q..A..Ee....pCE....Q.Y.D.FCT......................................................................................YT.S..PWLH..H.V..TIP.....Gd..........kL..VADT.TYY.......Y..QC...............GDE...TG.................................GWS.P.V..YSFKT............................................
A0A1R3J1D7_9ROSI/76-188                .....................................................PEQISVSL.....ST..T....YD.....SV.WISWI..T...G...............................................................................Eyqigen....ikplepKT..VGS..............VV.R..Y.GRL.....K.FP...........................................L.T.HR.......A.M..G..H......SL....V.Y.S.QLYpfq...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPDT.LYY.......Y..QC...............GDP...SI................................pAMS.D.V..YYFKT............................................
A0A060WH96_ONCMY/29-123                .....................................................PEQVHISY.....AG..F....AG.....SM.EITWT..T...F...............................................................................N................ET..EES..............TV.E..Y.GLW.....G.GR..........................................lF.E.LT.......A.K..G..K......ATl..fV.D.G.GSE......................................................................................GR.K..MYIH..R.V..TLT.....D............L..RPAS.AYV.......Y..HC...............GSE...A-.................................GWS.D.V..FSFT-a...........................................
A0A445FM29_GLYSO/94-206                .....................................................PEQISLSL.....SA..S....HD.....SV.WISWI..T...G...............................................................................Efqigdn....iepldpET..VAS..............IV.Q..Y.GRF.....G.RS...........................................M.R.HQ.......A.T..G..Y......SL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..RPNT.LYQ.......Y..KC...............GDP...SL................................sGMS.D.V..HYFRT............................................
A0A2P9HA73_PARUW/45-133                ....................................................s-ETVYLTW.....QK.dP....TT.....TM.TIQWI..S...S...............................................................................K................KE..KEV..............QL.F..Y.RQS.....T.EA...........................................N.W.IQ.......V.K..G..I......IF....N.F.-.-PH......................................................................................SP.S..YFIN..R.V..ELT.....N............L..EPDT.EYI.......F..KI...............ETN...S-.................................---.-.-..-----qtqlfrtl....................................
A0A0N4YBN9_NIPBR/40-134                .....................................................PEQVHLSL.....GT..S....LS.....EM.VVTWL..T...F...............................................................................D................DT..EKT..............MV.E..F.GPI.....T.DK..........................................kP.T.KI.......V.E..G..R......CS....A.F.S.DNPk....................................................................................sKQ.K..RFIH..R.V..LLT.....G............L..VPGK.TYQ.......Y..RV...............GSE...Y-.................................GWS.A.L..YRFT-a...........................................
A0A3M2RJ04_9HYPO/33-122                .....................................................PVQQRLSL.....DG..-....PN.....SV.TIGWN..T...Y...............................................................................S................KQ..NKP..............CV.K..Y.GTS.....R.DV...........................................L.N.KE.......A.C..S..D......TS....-.I.T.-YP......................................................................................TS.R..TWTN..A.V..KLT.....D............L..KPAT.TYY.......Y..KI...............TST...NS.................................SVD.E.F..FS---prt.........................................
F2DF56_HORVV/68-181                    .....................................................PEQVAVAL.....SA..A....PT.....SA.WVSWI..T...G...............................................................................Efqmggt....vkpldpRT..VGS..............VV.R..Y.GLA.....A.DS...........................................L.V.RE.......A.T..G..D......AL....V.Y.S.QLYpfe...............................................................................glhnYT.S..GIIH..H.V..RLQ.....G............L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.A.V..HAFRT............................................
I1IXG9_BRADI/49-136                    .....................................................PQQVHVSL.....VG..-....AN.....HM.RVSWI..T...D...............................................................................A................KH..GQT..............VV.E..Y.GRA.....S.RN...........................................Y.T.AS.......A.T..G..D......HT....S.Y.T.YFL......................................................................................YT.S..GKIH..H.V..TIG.....P............L..DPGT.VYY.......Y..RC...............GMA...GD.................................EFS.-.-..-----lkt.........................................
A0A1Y1XJ07_9FUNG/96-187                ....................................................f-ERVSIYP.....SE..D....ES.....ML.NFAWY..T...R...............................................................................T................P-..TDS..............FI.R..V.SQN.....E.DM...........................................TdY.TE.......F.T..G..T......SE....Y.I.R.IYL......................................................................................GE.K..FYTN..K.V..TIK.....G............L..NRKS.TYY.......Y..QR...............KMN...N-.................................KWE.T.-..-----pvklnt......................................
A0A024TI22_9STRA/80-177                .....................................................PRQVHLAY.....AGrtP....GT.....GM.TVSWA..T...Y...............................................................................H................RV..NDS..............TL.W..V.GST.....P.TN...........................................LsL.AT.......V.D..A..E......TL....S.Y.Y.ADD......................................................................................VY.T..LYTY..H.A..TVR.....G............L..TPRS.KYF.......Y..RV...............GSA...SNd...............................sHVS.P.V..YHFHT............................................
M4F3X6_BRARP/43-130                    .....................................................PEQVHISL.....AG..-....DK.....HM.RVSWV..T...N...............................................................................D................KS..SPS..............FV.E..Y.GTS.....P.GK...........................................Y.S.FL.......G.Q..G..E......ST....S.Y.S.YIF......................................................................................YR.S..GKIH..H.A..VIG.....P............L..EPDT.VYY.......Y..RC...............GGG...G-.................................---.P.E..FH---lkt.........................................
A0A2P6NA57_9MYCE/61-149                ..................................................vry---VHLAL.....TG..N....TT.....EM.SVGWY..T...E...............................................................................D................A-..SKS..............TV.R..W.GDK.....P.GD...........................................Y.P.FS.......A.V..G..T......SS....E.W.-.--H......................................................................................ND.Y..GYNH..F.A..TII.....N............L..RPNT.RYY.......Y..VC...............GDA...SG.................................GWS.R.E..FSFK-s...........................................
A0A1Y1VM23_9FUNG/173-271               ................................................erlsv------FP.....GE..D....ET.....KL.NFGWY..S...T...............................................................................T................K-..TLP..............SI.R..Y.SVN.....K.DM...........................................S.D.AV.......QyD..G..Y......FE....Q.H.Y.KLN......................................................................................GT.Q..YYSN..K.V..TIE.....D............L..KPNT.VYY.......Y..QR...............LLN...G-.................................---.-.-..-----ewekpviklktrdpynfk..........................
R6BPC8_9FIRM/75-172                    ...................................................ss--RIILTP.....GK..T....AK.....DL.GFAWY..S...Q...............................................................................K................K-..GEP..............AV.K..I.GKK.....E.DL..........................................sD.A.QE.......F.K..G..T......AT....E.I.N.RSNq....................................................................................kNT.Y..KASN..K.V..TVE.....G............L.fEENT.TYY.......Y..SY...............TDD..vKN................................pNWS.E.V..QSYTT............................................
A0A061EBE6_THECC/176-284               .................................................pvyp----RLAQ.....GK..V....WN.....EM.TVTWT..S...G...............................................................................Yg..............iGE..AVP..............FV.E..W.SWK.....G.GL...........................................P.I.H-.......S.P..A..G......TL....T.F.D.SNSmcgep...........................................................................amtvgwRD.P..GFIH..T.S..FLK.....E............L..WPNT.LYT.......Y..RL...............GHV..lSDg..............................tyVWS.Q.Q..YSFK-a...........................................
A0A498KEC8_MALDO/64-155                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................D................EP..GDS..............KV.Q..Y.GTS.....E.KK...........................................Y.E.FS.......A.K..G..V......VT....N.Y.T.YYQ......................................................................................YK.S..GYIH..H.C..LVG.....G............L..EYDT.KYY.......Y..EI...............GNG...S-.................................-SS.R.E..FWFTT............................................
A0A2H5NWK6_CITUN/189-292               .............................................dntfqlhi--------.....--..-....--.....QM.TVTWT..S...G...............................................................................Yg..............iNE..AEP..............FV.E..W.GPK.....G.GD...........................................R.T.YS.......P.A..G..T......LT....-.F.G.RGSmcgap...........................................................................artvgwRD.P..GYIH..T.G..FLR.....E............L..WPNA.MYT.......Y..KL...............GHRl.fNGt...............................yIWS.S.E..YQFK-a...........................................
A0A1H9L4N7_9SPHN/41-138                .....................................................PDRIMLTP.....AA.dP....TQ.....GM.AVAYR..T...D...............................................................................T................AQ..ATS..............EA.Q..I.AIS.....V.DGpt......................................leeK.A.AT.......V.T..G..P......AG....T.V.K.NSA......................................................................................NG.P..ALYH..Q.I..RFD.....K............L..TPDT.VYA.......Y..RL...............KGS...A-.................................GWS.E.W..LQFRT............................................
D8SYQ0_SELML/73-183                    .....................................................PEQIALAQ.....GT..D....SS.....SM.FVSWI..T...G...............................................................................Efqvgqd....vtplnpSL..IKS..............VV.E..Y.GIF.....K.--...........................................L.D.HF.......A.V..G..K......AS....V.Y.S.QLYpyk...............................................................................glnnYT.S..GIIH..H.V..KLQ.....G............L..KSST.TYY.......Y..RC...............GDP..fAK.................................AMS.P.V..YSFTT............................................
M0ZS86_SOLTU/47-135                    .....................................................PQQVHISM.....VG..-....ED.....KM.RISWI..M...E...............................................................................D................SG..SPA..............TV.K..Y.GTS.....P.GS...........................................Y.P.FS.......A.N..G..D......TT....K.Y.R.YIL......................................................................................YK.S..GEIH..N.V..VIG.....P............L..KPNT.VYY.......Y..IC...............GPF...T-.................................--S.P.E..FNFKT............................................
W2RI01_PHYPN/62-159                    .....................................................PQQLHLAY.....AGasA....GT.....GM.TLSWS..T...Y...............................................................................S................QV..QDS..............SV.W..I.GKS.....K.DT...........................................L.A.LV......nT.P..V..S......QS....S.Y.Y.SDN......................................................................................TY.N..MFHH..H.A..TIS.....G............L..TPHT.KYF.......Y..KV...............GSK...STp...............................dYVS.A.V..YSFVT............................................
A0A0F7U1T8_9EURO/34-123                .....................................................PFQQRLAV.....YG..-....AN.....AV.SVGWN..T...Y...............................................................................E................QL..NKS..............CV.A..Y.GTS.....A.DS...........................................L.T.SS.......A.C..S..T......TS....S.T.-.-YA......................................................................................TS.R..TWSN..Y.A..VLT.....G............L..TPAT.TYY.......Y..KI...............VSG...N-.................................--S.S.V..DHF--lsprt.......................................
A0A166ES63_DAUCS/52-139                .....................................................PQQVHISL.....VG..-....ND.....KM.RISWI..T...D...............................................................................D................L-..VES..............TV.E..Y.GTS.....A.GF..........................................kA.G.TS.......A.T..G..T......YS....T.Y.K.YAV......................................................................................YT.S..GYIY..D.V..IIG.....P............L..KPST.TYF.......Y..RC...............GGS...S-.................................---.Q.E..FNFET............................................
M2XXL8_GALSU/129-244                   .....................................................PEQFHLAL.....TS..N....PG.....EV.IISYS..T...L...............................................................................S................NPepYGQ..............CV.T..I.EDD.....I.DG...........................................L.G.NT.......F.T..G..K......VF....C.T.N.DTRtftigsg........................................................................qpplicrNY.T..GYFH..H.V..KVT.....G............L..IPGK.KYY.......Y..SA...............NAY...SN.................................---.-.-..-----rysfiapygtnsshvtf...........................
G7KLC0_MEDTR/71-182                    .....................................................PEQIALAI.....SS..-....PT.....SM.WISWI..T...G...............................................................................Ksqigln....vtpldpAS..IGS..............EV.W..Y.GKK.....S.GK...........................................Y.T.NV.......G.K..G..D......SL....V.Y.S.QLYpfe...............................................................................gllnYT.S..GIIH..H.V..KLE.....G............L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.Q.E..NYFET............................................
L8G379_PSED2/35-128                    ....................................................n-SQIRLAY.....AG..-....DT.....GM.FVSWN..T...F...............................................................................E................HL..SNP..............TV.H..Y.GLS.....L.DA...........................................L.T.ET.......A.S..S..E......VS....-.I.T.YP-......................................................................................TS.L..TYNN..H.V..KLT.....G............L..KPDT.LYY.......Y..LP...............GHL..lTA................................tDTS.V.P..FTFKTsr..........................................
A0A0K9PZI5_ZOSMR/149-253               .....................................................PEQVHLAL.....TE..R....EN.....EM.RVMWI..T...G...............................................................................N................K-..DEC..............FV.E..Y.GRR.....K.EG..........................................kL.E.ER.......I.K..A..V......LA....R.Y.E.ISHmcdkpa..........................................................................ntsigwRD.P..GWVH..D.A..VMT.....G............L..KRGT.RYY.......Y..RV...............GSD...AL.................................GWS.P.T..YSF--is..........................................
B9RGF7_RICCO/220-322                   .................................................plyg----HISS.....ID.sT....AT.....SM.KVTWV..S...G...............................................................................S................K-..EPQ..............QV.E..Y.GDD.....K.KV...........................................A.S.QV.......T.T..F..S......QK....D.M.C.--Ssvlpsp..........................................................................akdfgwHD.P..GYIH..S.A..VMT.....G............L..KPSS.NYT.......Y..RY...............GSA...LV.................................GWS.S.Q..TQFRT............................................
A0A3B6DL92_WHEAT/145-236               .....................................................PQQVHIST.....VG..-....RN.....KM.RISWV..T...D...............................................................................D................RN..TPS..............VV.E..Y.GES.....R.GN...........................................Y.T.AS.......A.T..G..D......QA....T.Y.K.YFF......................................................................................YE.S..GAIH..H.V..TIG.....P............L..APGT.TYH.......Y..RC...............GKA...GD.................................---.-.-..-----eltlrtppas..................................
A0A3R7H1C5_9STRA/72-170                .....................................................PQQFHLAF.....AGeeA....GT.....GM.AISWT..T...F...............................................................................A................LE..SKP..............AV.W..I.GAK.....K.TKv.........................................aL.V.KS.......A.K..I..E......TK....S.Y.Y.KDD......................................................................................DY.E..LYSY..H.A..VVG.....G............L..KPNT.EYF.......Y..KV...............GSD...TEt...............................kWQS.T.V..SSFKT............................................
A0A1Y3N6J5_PIRSE/46-144                .................................................ferl----SVFV.....GD..N....ES.....EI.NFGWY..S...A...............................................................................T................E-..NEA..............KI.R..I.GKK.....E.DM..........................................sD.A.TT.......F.K..G..T......SE....P.Q.S.EYGlsk...............................................................................lkllGT.R..YYTN..R.V..TIS.....G............L..ERNS.VYY.......Y..QR...............KLN...G-.................................QWE.K.A..IQFKT............................................
A0A2V3JQC5_9EURY/640-727               .............................................pgitnvmn--------.....TT.pT....GT.....SV.TITWD..T...D...............................................................................E................A-..SDS..............LV.R..Y.GTE.....P.GN...........................................Y.T.LS.......A.S..N..E......SF....V.-.-.---......................................................................................--.-..-LEH..S.I..NLI.....V............L..NPNT.VYH.......Y..VV...............NST...DQss.............................nsNES.A.E..YSFTT............................................
A0A327X3D2_9BACT/37-133                .....................................................PHHISISW.....ET.aP....VS.....SQ.SISWR..T...H...............................................................................D................TV..RVS..............FV.E..Y.LET.....T.ATpf......................................fkdQ.V.KR.......L.P..A..K......TE....R.H.T.-AD......................................................................................DG.T..WNHH..S.A..NIQ.....G............L..KPNT.TYS.......Y..RV...............GNH...T-.................................YWS.E.W..AEFTT............................................
A0A1T2XAT8_9BACL/313-421               .....................................................PKSVNMTF.....NG.dP....KT.....SI.AFAWY..T...D...............................................................................L................M-..TDS..............IV.Q..V.VDA.....S.DV...........................................Q.G.GV.......F.P..Q..T......GF...vT.Y.S.GHGkeidtfma......................................................................ksdrttqtYT.E..FISH..K.V..IAD.....A............L..TPGT.TYN.......F..RV...............GNG...T-.................................AWS.P.I..GSFTT............................................
A0A3M7RSU3_BRAPC/36-128                .....................................................PEQVHLSY.....GA..R....PD.....QM.VVTWV..T...M...............................................................................S................PV..PES..............VV.E..Y.GID.....K.ID...........................................S.N.VS.......G.T..S..S......IF....V.D.G.GFL......................................................................................RR.N..MTVH..R.V..VLE.....K............L..IPGK.SYK.......Y..HC...............GSP...KY.................................GWS.D.I..FYFT-a...........................................
C0PDY0_MAIZE/66-179                    .....................................................PEQIAVAL.....SA..S....PT.....SA.WVSWI..T...G...............................................................................Dyqmgga....vepldpGA..VGS..............VV.R..Y.GLA.....A.DA...........................................L.D.HE.......A.T..G..E......SL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLQ.....G............L..EPGT.RYL.......Y..RC...............GDP...AIp...............................dAMS.D.V..HAFRT............................................
B4L6R8_DROMO/1-95                      ................................................mhrcl-----LSF.....AD..S....LQ.....DI.VVTWS..T...R...............................................................................S................ST..NQS..............LV.N..F.AQD.....Y.VH..........................................dA.L.SS.......V.S..G..S......WQ....F.F.Q.DGGk....................................................................................qGR.S..QYIH..K.V..TLS.....S............L..KPNT.HYE.......Y..SC...............GSD...L-.................................GWS.A.V..YSFKT............................................
A0A1M4XAZ9_9FIRM/60-152                ...............................................dyirqi-------I.....TK.dS....QT.....SR.TIMWH..S...P...............................................................................Y................EQ..DGA..............EV.V..W.RAA.....G.GE...........................................E.Y.VS.......V.P..A..S......NE....H.Y.T.DD-......................................................................................GQ.D..IYLH..S.A..HIE.....G............L..SKGA.SYE.......Y..RI...............IAK...DSg...............................tEW-.-.-..-----mplktds.....................................
Q86IH2_DICDI/184-299                   ...................................................ic--NFILTV.....PE.nL....SN.....SI.IVGWH..S...N...............................................................................D................EP..IGS..............FA.Y..Y.DTT.....S.HSdyfkdglv..........................mkienfknlY.G.FS.......V.N..G..T......YF....E.M.D.NIR.....................................................................................qEE.Q..RYVS..W.A..DIT.....G............L..TPST.VYY.......I..VV...............GIE...KSdg.............................elIFY.P.E..RKFRT............................................
W4FTY6_9STRA/128-237                   .....................................................PQHGHLAF.....ND..H....ID.....QM.VIMYN..S...A...............................................................................S................NR..TIP..............SV.K..Y.SRR.....D.PSg........................................stN.V.FV.......R.S..G..T......SS....T.Y.S.ASDmchmpat........................................................................ivgqqwfRH.P..GYMH..T.V..VMD.....S............L..DLNA.TYS.......Y..QF...............GND...ID.................................GWS.A.T..YSFQ-s...........................................
Q741N5_MYCPA/69-162                    ...................................................va--GLHLQF.....GK.nA....GT.....EV.VVSWH..S...T...............................................................................D................AV..RNP..............RV.V..F.GTP.....A.SG...........................................F.G.RT.......V.A..A..D......TR....T.Y.R.DAK......................................................................................SGiE..VRVN..H.A..RLT.....G............L..TPDT.DYV.......Y..AA...............LHD...G-.................................AQP.Q.Q..G----tvrt........................................
A0A0A0MW17_PAPAN/32-125                .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A1I8N4S5_MUSDO/33-126                .....................................................PEQIHLSY.....GE..N....VY.....EY.VVTWS..T...R...............................................................................D................NT..KAS..............VC.K..Y.GVG.....N.LT...........................................NiA.NN.......K.Y..G..P......SK....F.T.D.G-Gk....................................................................................aKK.T..QYIH..R.V..SLK.....N............L..KENT.RYI.......Y..HC...............GSA...L-.................................GWS.S.L..YWFKT............................................
A0A0D2W8U8_GOSRA/56-147                .....................................................PQQVHITQ.....GN.yD....GN.....AV.IISWI..T...F...............................................................................D................EP..GSS..............KV.Q..Y.GKS.....D.KN...........................................Y.E.FS.......A.E..G..K......MT....N.Y.T.FYK......................................................................................YN.S..GYIH..H.V..LVD.....G............L..EYDT.KYY.......Y..KT...............GDG...D-.................................-SA.R.E..FWFQT............................................
A0A3B6LPL1_WHEAT/173-281               ..................................................pvy---PRLAV.....GK..T....WN.....EM.TVTWT..S...G...............................................................................Yg..............iSE..AHP..............FV.E..W.GKK.....G.SR...........................................P.G.-H.......A.P..A..D......TV....T.F.G.RESlcgep...........................................................................arsvgwRD.P..GSIH..T.A..FLK.....N............L..SPEK.EYY.......Y..KI...............GHM..lHDg..............................kvIWG.K.P..KSFR-a...........................................
S2XLY7_9BACL/483-586                   ..................................................ftp----TVNV.....GA..T....DE.....EV.GITLV..T...D...............................................................................S................VL..KEA..............HV.Q..Y.MPT.....S.EK...........................................D.W.SN.......A.S..V..M......ET....K.V.S.YFEsayge...........................................................................nidnssYR.V..LASH..E.A..DLA.....D............L..KRGT.TYQ.......Y..RY...............GLT..pEG.................................PWG.Q.A..YSFET............................................
V6MGX3_9BACL/38-138                    .....................................................PHSVVTNF.....KG.nP....QT.....SR.AFTWH..T...K...............................................................................S................PD..AAT..............VL.Q..L.APG.....S.GVtsf.....................................dgkD.V.MT.......F.Y..G..K......TS....Q.I.R.LKD......................................................................................GV.L..QGVH..K.V..EAT.....D............L..APGT.RYS.......Y..RV...............GNG...EK................................nGWS.Q.P..AEFET............................................
V7AEU9_PHAVU/54-145                    .....................................................PQQVHITQ.....GD.lV....GR.....AM.IISWV..T...M...............................................................................D................EP..GSS..............AV.R..Y.WSE.....K.NG...........................................R.K.RI.......A.K..G..K......MS....T.Y.R.FFN......................................................................................YS.S..GFIH..H.T..TIR.....K............L..KYNT.KYY.......Y..EV...............GLR...N-.................................-TT.R.R..FSFIT............................................
A0A394DKZ0_LUPAN/57-148                .....................................................PQQVHITQ.....GD.lV....GQ.....AM.IISWV..T...V...............................................................................D................EP..GSN..............EV.I..Y.WSD.....S.SL...........................................L.N.FT.......A.E..G..Q......VF....T.C.T.FYN......................................................................................YT.P..GFIH..H.T..TIT.....N............L..EFNT.KYY.......Y..EV...............GIG...N-.................................-TT.R.Q..FWF--it..........................................
A0A1S2R3M2_9BACI/52-153                ...................................................sk--DIALNP.....GS..N....ES.....EL.RFTWY..S...T...............................................................................V................NP..DKA..............IV.Q..M.AKK.....S.DM...........................................T.G.NE.......F.P..A..D......KA...vT.F.T.GTAspa...............................................................................atvgTT.A..YYSN..K.V..TVT.....S............L..EPST.QYV.......Y..RV...............GDG...KN................................gDWS.P.V..YNYAT............................................
A0A0C1MXN9_9CYAN/19-103                .................................................vrgp----YLQL.....GS..-....ES.....SI.AIRWA..T...D...............................................................................T................P-..VQG..............RV.W..Y.GES.....P.ER...........................................L.C.LV.......Q.D..E..T......T-....-.-.-.---......................................................................................--.I..ACNH..A.V..KLS.....Q............L..APDT.KYY.......Y..AV...............GTP...EGl..............................laGKT.E.D..F----ffvt........................................
A0A1Q4YI80_9ACTN/82-210                .....................................................PFGRHLAY.....GA.dP....RT.....RM.AVSWQ..V...P...............................................................................F................AV..RRP..............YL.R..I.GAK.....P.WA...........................................L.S.RR.......I.D..A..E......VR....H.L.T.TPElng...............................................................................gkiaTA.E..QFYV..H.A..SLD.....R............L..RPGT.TYY.......Y..GV...............GHD...GF.................................---.-.-..-----dpadtrnlgtlgtfttapahaesftftafgdqgvsyha......
A0A3Q8WSD5_9ACTO/68-187                .............................................lpylqrpg--------.....--..-....AT.....EM.TVNWF..S...E...............................................................................T................GG..AST..............IT.V..Y.GPGl...pA.EG...........................................Q.E.FT.......V.E..G..E......QN....P.V.N.GYQeaelkqgdlsratva........................................................gtnkkgilaqgtwirAD.N..PYKH..S.I..RID.....N............L..QPES.TYT.......Y..AV...............NED...G-.................................-YV.H.E..ASFET............................................
B9RHA3_RICCO/58-149                    .....................................................PQQVHITQ.....GD.hD....GK.....AV.IVSWV..T...E...............................................................................D................EP..GSS..............NV.L..Y.WSK.....S.SP...........................................H.K.KQ.......A.K..G..K......YT....T.Y.K.FYN......................................................................................YT.S..GYIH..H.C..TIR.....N............L..EYNT.KYY.......Y..AV...............GIG...H-.................................-TT.R.Q..FWFV-t...........................................
W2Q499_PHYPN/198-304                   .....................................................PKHVHTAY.....GR..T....PG.....SL.AVQWM..T...K...............................................................................Ef..............cGK..GNA..............QL.Q..M.VEG.....Y.HArieve................................gpnatpV.T.AW.......A.N..T..T......LF....E.D.D.GEK......................................................................................QS.K..RWLH..V.V..RLE.....G............L..KPDT.RYT.......Y..VV...............GNAy.yT-.................................SWS.I.P..YVTKT............................................
L7F9E2_9ACTN/77-193                    .....................................................PFGRHLAW.....GN.dP....RT.....EI.TVSWQ..V...P...............................................................................V................AV..KKP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....T.L.Y.TPAgig................................................................................asgDH.T..QYYL..H.A..ELT.....H............L..RPGR.TYY.......Y..GV...............GHA...G-.................................---.-.-..-----fdpaeahllgtlgtfttapnhkkpftft................
A0A1H5NS10_9ACTN/74-179                .....................................................PFGRHLAF.....GN.dA....GT.....EM.TISWQ..V...P...............................................................................V................AV..KKP..............FV.R..I.GTH.....A.SH...........................................L.S.VK.......I.D..A..E......IR....T.L.Y.TPAgvg................................................................................asgDH.T..QYYV..H.A..KLA.....N............L..KPGH.TYF.......Y..GV...............GHD...GF.................................---.-.-..-----dpaspkfagtigtftt............................
A0A2G3CRK9_CAPCH/72-184                .....................................................PEQISVSL.....SS..T....YD.....SL.WISWV..T...G...............................................................................Eyqiggk....ikpldpSK..VGS..............VV.Q..Y.GKD.....K.SS...........................................L.R.RK.......A.I..G..Q......SL....I.Y.N.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..QLT.....G............L..KPAT.LYY.......Y..RC...............GDP...YI................................pAMS.S.I..YHFKT............................................
A0A1S3Y2F4_TOBAC/52-143                .....................................................PQQVHITQ.....GD.yE....GK.....AV.LVSWI..T...P...............................................................................D................KP..GPS..............QV.R..Y.GLS.....E.GK...........................................Y.E.FT.......A.E..G..S......VT....N.Y.T.FYN......................................................................................YT.S..GYIH..Q.C..FLD.....G............L..QYDT.KYY.......Y..EI...............GDG...D-.................................-SA.R.K..FWF--et..........................................
A0A445AVY5_ARAHY/53-144                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...T...............................................................................D................EP..GSC..............KV.Q..Y.GTS.....E.NK...........................................L.H.DS.......A.D..G..S......FT....N.Y.T.FYQ......................................................................................YK.S..GFIH..Q.C..LIE.....D............L..EYDT.KYY.......Y..RI...............GSG...D-.................................-SS.R.D..FWFKT............................................
M0SE93_MUSAM/55-146                    .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...E...............................................................................S................ET..GTS..............EV.L..Y.GTE.....E.HK...........................................Y.E.HI.......A.Q..G..T......TT....N.Y.T.FYN......................................................................................YK.S..GFIH..H.C..LVD.....G............L..KYNT.KYH.......Y..KI...............GTG...A-.................................-SA.R.E..FWFQT............................................
Q5BAS0_EMENI/33-121                    ....................................................p-VQQRLAI.....YG..-....PN.....SI.SIGWN..T...Y...............................................................................E................KL..NES..............CV.E..Y.GTS.....S.EK...........................................L.D.RR.......A.C..A..L......VE....P.T.T.YP-......................................................................................TS.R..TYEN..V.V..ILT.....D............L..TAGT.TYY.......Y..KI...............VST...N-.................................--S.T.V..DHF--lsp.........................................
A0A1I6MS20_9GAMM/58-151                ................................................llldm--------.....--..A....DT.....SV.VIAWM..T...D...............................................................................A................P-..SDA..............KV.S..Y.GEG.....K.IE...........................................Q.E.VV.......P.Q..V..D......--....-.-.-.-GL......................................................................................VP.V..GTMH..R.V..VIR.....G............L..SPGH.TYQ.......Y..RV...............SSR...RVialkpy....................wpdrgrtVES.P.V..DSFTT............................................
A0A402CXZ2_9BACT/51-147                .................................................sask-------L.....KE..N....DD.....TL.VVAWQ..T...E...............................................................................D................AA..ADF..............TV.A..Y.GLS.....K.KYgqi....................................avpiQ.G.AR.......A.I..G..D......AA....V.-.S.GDA......................................................................................AL.K..RRNY..N.A..ALT.....G............L..KLGR.KYY.......Y..QV...............QGK...GK.................................---.-.-..-----viaegyattrq.................................
A0A443P8J2_9MAGN/68-180                .....................................................PEQISISL.....SA..A....HD.....SV.WVSWI..T...G...............................................................................Dfqigdn....ikplnhES..VAS..............VV.R..Y.GQL.....R.YP...........................................L.T.HE.......A.T..G..Y......SL....V.Y.N.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPKT.RYF.......Y..RC...............GDP...SI................................pAMS.S.I..LSFKT............................................
H3GMG0_PHYRM/183-288                   .....................................................PKHGHLSL.....TD..D....ET.....AM.VIMFN..S...G...............................................................................S................N-..KKP..............VV.K..Y.GES.....P.QN...........................................L.D.SQ.......A.T..G..T......ST....T.Y.G.AGDmchppat........................................................................tlgqrsfRD.P..GFMH..T.I..IMT.....D............L..KPDT.YYY.......Y..QY...............GHE...EY.................................VWS.H.V..RRFK-s...........................................
A0A2A2LRT7_9BILA/24-111                .....................................................PEQVHLAF.....HG..D....TS.....EM.AVIWT..T...F...............................................................................Y................D-..GLH..............HV.Y..Y.GTD.....V.KN...........................................M.N.QV.......A.I..E..T......SI....K.K.W.TSG......................................................................................SV.T..RYSH..R.A..KMS.....N............L..KPST.TYY.......Y..KI...............E--...--.................................---.-.-..-----grvfefktls..................................
A0A182R6C0_ANOFN/29-120                .....................................................PEQVHLSF.....GE..T....PL.....EI.VVTWS..T...M...............................................................................T................AT..NES..............VV.E..Y.GIG.....G.LI...........................................L.S.AT.......G.T..E..E......EF....V.D.G.GAG......................................................................................KH.T..QYIH..R.V..VLR.....D............L..QPSS.RYE.......Y..HC...............GSQ...W-.................................GWS.P.E..FYFHT............................................
A0A397YF88_BRACM/143-246               .....................................................PEQIHLAF.....ED..G....VN.....GM.RVTFV..A...G...............................................................................D................G-..EER..............FV.R..Y.GER.....K.ER...........................................L.G.NS.......A.P..A..R......GV....R.Y.E.REHmcnapa..........................................................................ntsigwRD.P..GWIF..D.A..VMK.....N............L..NGGV.KYY.......Y..QV...............GSD...SK.................................GWS.E.I..HSF--ia..........................................
A0A2P5DVU0_TREOI/53-145                .....................................................PQQVHITQ.....GD.hI....GK.....AV.IVSWV..T...V...............................................................................D...............ePA..GSS..............KV.L..Y.WSE.....N.SK...........................................Q.K.KL.......A.E..G..K......LV....T.Y.R.FFN......................................................................................YT.S..GYIH..H.C..TIT.....D............L..KFNT.KYY.......Y..VV...............GIG...H-.................................-T-.-.-..-----erkfwfit....................................
G3J4A5_CORMM/73-174                    ..................................................inv---ISLSY.....AG..-....ST.....GV.NIHYQ..T...P...............................................................................F...............gLG..SAP..............SV.R..W.GTS.....R.DA...........................................L.E.KT.......A.N..G..A......SH....S.Y.D.RTPpcse..............................................................................vavtQC.S..QHYH..D.V..QIK.....D............L..APGT.TYY.......Y..QI...............TAA...NG................................tTAS.D.V..LHFAT............................................
A0A2U1NDU4_ARTAN/193-301               ................................................plypr-----LAH.....GK..S....WD.....EM.TVTWS..S...G...............................................................................Y................SIveAVP..............FI.E..W.GMK.....G.QK...........................................R.S.RS.......P.A..G..T......-V....T.F.T.QKDmcgga...........................................................................argvgwRD.P..GFIH..T.S..FLK.....D............L..WPNM.VYT.......Y..QM...............GHKl.qNGs...............................yVWS.K.M..YSFK-a...........................................
M4F891_BRARP/61-152                    .....................................................PQQVHITQ.....GD.vE....GK.....AV.IVSWV..T...Q...............................................................................E................AP..GSD..............TV.L..Y.WKE.....N.SS...........................................K.K.LK.......A.Y..G..K......SK....T.Y.K.FYN......................................................................................YT.S..GHIH..H.C..TIR.....N............L..EYDT.KYY.......Y..VV...............GVG...Q-.................................TER.E.F..-----yfft........................................
R6DVD1_9FIRM/34-128                    ....................................................v-TRVSCAF.....NG.dS....QT.....SR.GFCWY..T...E...............................................................................T................Y-..TRS..............DV.Q..I.IKT.....S.DF...........................................N.G.SY.......A.N..A..T......EY....S.A.G.--Ni...................................................................................ykFR.D..LYCH..K.V..TVD.....N............L..EPGT.SYT.......Y..RV...............GDR...SL................................nLWS.G.D..GTFKT............................................
A0A1B8D8V6_9PEZI/39-130                ....................................................n-SQVRLAY.....AG..-....PN.....GM.VVSWN..T...F...............................................................................D................KV..ARP..............TV.K..Y.GTS.....P.QR...........................................L.I.YC.......A.E..S..T......VS....V.T.-.-YD......................................................................................TS.L..TYNN..H.V..PLK.....G............L..KPDT.LYY.......Y..LPep...........llKDD...S-.................................-TT.V.P..YSFRT............................................
A0A329SP97_9STRA/89-187                .....................................................PQQLHLAF.....AGeqA....GT.....GM.AISWT..T...F...............................................................................A................LD..KDP..............TV.W..L.GRT.....K.SK...........................................L.K.MM.......A.N..A..K......IE....T.K.S.YYKd....................................................................................dDY.E..LYSY..H.A..VVS.....G............L..KANT.EYF.......Y..KV...............GNA...DNk...............................hFQS.G.E..SSFTT............................................
A0A2K5WEH9_MACFA/32-125                .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A087SN34_AUXPR/76-188                .....................................................PEQVSVTY.....YG..-....PT.....SV.RFGWA..T...G...............................................................................Qaqtgyg....alegfhDS..TGS..............NV.Q..L.GLS.....P.SA...........................................Y.T.DV.......L.E..G..T......SS....H.Y.D.QIYygfs..............................................................................nalnYT.S..PKLH..S.V..VVE.....D............L..TPNT.SYF.......Y..RV...............GDL...KS................................qYWS.E.E..YNFTT............................................
A0A0L8HI16_OCTBM/36-138                ...................................................vr--TVHISF.....GN..K....TN.....QI.CILWC..S...T...............................................................................Nld............ydKN..IPP..............RV.R..Y.GFT.....K.SL...........................................L.S.QI.......S.I..G..K......TV....Q.F.N.SA-......................................................................................-K.K..RFFH..R.V..VLS.....N............L..LPEN.TYY.......Y..QI...............IRQ...NKs..............................nsYLD.P.I..ESF--tvpqspt.....................................
Q9U309_CAEEL/22-117                    ....................................................v-EQVHLSL.....SG..K....MD.....EM.VVTWL..T...Q...............................................................................Gp..............lPN..VTP..............YV.M..Y.GLS.....K.DA...........................................L.R.WT.......A.K..A..T......TT....S.W.K.DQGs....................................................................................hGY.V..RYTH..R.A..TMT.....K............M..VPGD.TYY.......Y..KV...............GSS...Q-.................................DMS.D.V..YHFH-q...........................................
A0A3E0WQF6_9GAMM/55-151                .....................................................PDRVVLTF.....AG.dP....AT.....SA.AVSWR..T...D...............................................................................T................AV..ENP..............RA.Q..I.APA.....L.DGpa......................................lhqV.E.QT.......V.A..A..A......SV....G.L.T.-ME......................................................................................NG.A..ALHH..S.V..VFE.....G............L..EPDT.VYA.......Y..RV...............SGG...N-.................................TWS.E.W..FQFRT............................................
A0A2I0N244_9CLOT/81-228                .....................................................PNRLIATF.....NG.dP....ET.....TR.GFNWF..T...Sdlapaklwvseskdmknarsfea.................................iaqpvvshyverdekgfflfqlvD................KK..TNQ..............VL.R..Y.FTD.....E.GKepgv...................................wdqsQ.-.--.......-.-..-..-......--....-.-.-.--Eiedrktq........................................................................svsidveKV.Q..EISY..K.A..TAR.....G............L..KPGT.TYY.......Y..QV...............RSD...KG.................................EKS.S.V..GRFKT............................................
A0A0E3WGT0_9BACL/607-706               .....................................................PEYVRIYV.....TE.dM....KT.....TQ.SIVWK..T...A...............................................................................P................RV..ERG..............VI.Q..Y.VEA.....S.KF...........................................T.G.FD.......Q.P..N..I......KE....Q.T.A.EPQlll...............................................................................apdrVG.E..TLFH..K.G..MLQ.....S............L..SPGT.EYI.......Y..RV...............GSP...G-.................................LWS.E.Q..HRFTT............................................
V4UUX0_9ROSI/87-174                    .....................................................PQQVHISL.....VG..-....QD.....RM.RISWI..T...E...............................................................................N................S-..SPA..............TV.K..Y.GTS.....P.GV...........................................Y.D.NS.......A.N..G..T......TS....S.Y.H.YVL......................................................................................YK.S..GEIH..D.V..VVG.....P............L..KANT.VYY.......Y..RC...............GPD...S-.................................--A.Q.E..RSFKT............................................
A0A3B4CUR1_PYGNA/28-121                .....................................................PEQVHISY.....PG..V....RG.....SM.VITWT..T...F...............................................................................N................E-..TDS..............MV.E..Y.NLW.....G.GK...........................................LfT.QT.......A.K..G..N......SA....V.F.V.DEGp....................................................................................eMR.K..MYIH..R.V..TLS.....D............L..RSGA.TYV.......Y..HC...............GSE...A-.................................GWS.D.L..FFFT-a...........................................
A0A2I4ERF6_JUGRE/57-151                .....................................................PEQVHITQ.....GD.rG....GR.....GV.IISWV..T...P...............................................................................L................MR..HPN..............FV.T..Y.WAA.....E.GKl........................................knY.K.LT.......A.P..A..K......IT....S.Y.R.YFN......................................................................................YT.S..GYIH..H.A..TIK.....R............L..EYDT.KYF.......Y..EI...............GIG...V-.................................-CA.R.L..FHFRT............................................
A0A1T5ATP6_9BACT/40-136                .....................................................PDRIMQNV.....TE.dP....AT.....QI.AVSWR..T...K...............................................................................A................HI..ATG..............YV.E..Y.VKA.....F.SE...........................................T.N.LP.......K.E..T..S......TL....Q.A.N.V-Kpv.................................................................................nfeNI.E..AHYH..Q.V..LIE.....N............L..EPAT.SYM.......I..RV...............GNE...E-.................................YRS.E.W..FTVQT............................................
A0A1J7H7L8_LUPAN/176-276               .................................................plyg----HLSS.....ID.sT....GT.....SM.RLTWV..S...G...............................................................................D................N-..QPQ..............QI.Q..Y.GDG.....K.KVts.......................................iiN.T.FS.......Q.N..D..M......CS....-.-.-.--Tialpsp..........................................................................akdfgwHD.P..GYIH..S.A..VMT.....G............L..KPSS.IFS.......Y..KY...............GRD...--.................................---.-.-..-----yiasgsvyl...................................
A0A314UKH0_PRUYE/49-136                .....................................................PQQVHISL.....VG..-....KD.....HM.RVSWV..T...D...............................................................................S................KH..GKS..............VV.E..Y.GKA.....P.GK...........................................Y.N.GK.......A.T..G..E......DT....S.Y.K.YFF......................................................................................YS.S..GKIH..H.V..TIG.....P............L..EPAT.IYY.......Y..RC...............GGS...E-.................................---.Q.E..FSFKT............................................
A0A495CX99_9MYCO/255-346               .....................................................PTRVILTP.....TE.tP....AT.....SQ.SFSWL..A...G...............................................................................D................ET.hKSG..............AV.E..I.GLA.....A.GG...........................................D.T.RV.......V.D..A..R......AV....G.-.-.AVN......................................................................................GN.A..KEHF..S.A..TVT.....D............L..APAT.AYR.......Y..RV...............GTE...G-.................................SMS.E.W..YTFTT............................................
A0A2B8B5J2_9ACTN/63-168                .....................................................PFGRHLAF.....GA.dP....GT.....QM.RVSWQ..V...P...............................................................................F................AV..RRP..............YI.R..V.GTE.....P.WE...........................................L.S.RK.......I.E..A..E......VR....E.L.R.TPAlsh................................................................................glpAV.E..QFYL..H.A..ALG.....G............L..RPGT.TYY.......Y..GV...............GHD...GF.................................---.-.-..-----dpaeagrlgtlgtfrt............................
A0A168LPI5_9BACL/528-625               ...................................................is--KVTVTF.....NG.dT....TT.....AK.GFTWY..T...P...............................................................................K................TS..TGN..............DL.Q..V.VEK.....S.SDga......................................dftK.S.TR.......F.N..G..R......SA....I.S.-.-TN......................................................................................SP.N..ERLH..K.A..EAT.....N............L..KPDT.MYY.......F..RV...............GDAw.lN-.................................SWS.D.V..GTFRT............................................
A0A0J7XZ74_9SPHN/38-134                .....................................................PDRIVLTA.....GA.dP....AR.....EM.AVSFR..T...D...............................................................................G................AQ..GDA..............QA.Q..I.AVA.....V.DGpt......................................lerE.A.RT.......I.I..G..T......TR....P.I.E.SA-......................................................................................NG.A..ANYH..Q.V..RFT.....G............L..EPGR.AYA.......Y..RV...............KGA...A-.................................GWS.E.W..LQFRT............................................
H9JFJ6_BOMMO/807-898                   .....................................................PEQIHIAF.....GE..K....TN.....DI.KITWS..T...F...............................................................................N................DT..QES..............TV.E..Y.GEG.....I.ME...........................................K.E.AT.......G.S..A..T......LF....T.D.G.GKE......................................................................................KR.S..QWIH..T.V..LLK.....D............L..KFNT.RYV.......Y..HV...............GSV...Y-.................................GWS.E.L..FSFKT............................................
A0A433Y874_9BACL/337-447               .....................................................PKSINMTF.....NG.dP....KT.....SI.ALAWY..T...D...............................................................................V................M-..TDT..............VV.Q..V.VEA.....S.KV...........................................T.G.TS.......F.P..E..D......GS...lN.Y.H.--Gnaeaietyv....................................................................kkgdretdhHT.E..FISH..K.V..IAD.....Q............L..NPGT.AYK.......F..RV...............GNG...KA................................eDWS.S.I..GSFTT............................................
A0A166GFG1_DAUCS/56-147                .....................................................PQQVHITQ.....GD.hE....GK.....AM.IVSWV..T...M...............................................................................E................EP..GSS..............TV.S..Y.WSE.....N.SK...........................................H.K.NK.......A.M..G..N......FN....T.Y.K.YYN......................................................................................YT.S..GYIH..H.C..TLR.....N............L..KFDT.KYF.......Y..EV...............GIG...Q-.................................-TP.R.T..FWF--vt..........................................
A0A0S6XU45_9FUNG/37-124                .....................................................PVQIRLSY.....QG..-....PT.....AM.VVSWN..T...F...............................................................................K................QL..EHP..............TV.Y..Y.GLE.....P.YV...........................................L.Y.DR.......A.S..S..D......NS....-.Y.T.YP-......................................................................................TA.L..TYIN..H.V..NLT.....N............L..LPDT.TYY.......Y..LP...............AHS...N-.................................-AT.K.P..LSFRT............................................
A0A1G7E6I7_9ACTN/35-154                .................................................frvn-----PYL.....QN.pT....TT.....SM.TVTWF..S...Y...............................................................................D................DA..PGE..............LV.L..D.GPG.....H.RGt........................................rlV.S.DP.......E.P..Q..P......VL....A.Y.T.ELErqqeipg.......................................................................leqgswlhED.G..NVKH..V.V..RLT.....G............L..EPGS.TYT.......Y..RV...............TQD...GA.................................---.-.-..-----tvgaelstapgrrdwehir.........................
D2W3L7_NAEGR/22-122                    .....................................................PSQVHLAL.....TR..N....SR.....EM.IVSFH..T...E...............................................................................Gyd............kdVL..GKA..............QV.M..Y.STN.....E.NF...........................................Q.D.YQ.......V.AhlG..S......VS....T.T.Y.GES......................................................................................AK.T..GYEH..H.V..LLV.....D............L..EYST.KYY.......Y..KC...............GFT...KSt...............................dIQS.E.V..YYFHT............................................
A0A2J6PR38_9HELO/35-119                ....................................................a-TQVRLAY.....HG..-....DR.....GM.SVSWN..T...N...............................................................................S................KL..DKP..............SV.A..F.GKT.....M.QL...........................................G.G.IV.......T.S..D..Q......ST....T.Y.P.---......................................................................................TS.S..TYNN..H.V..IIT.....G............L..QPNT.RYH.......Y..QP...............YCS...D-.................................---.R.I..YSFTT............................................
A0A2P5B100_PARAD/47-133                .....................................................PEQVHISL.....VG..-....ED.....KM.RISWI..T...K...............................................................................D................S-..APA..............TV.D..Y.GLS.....P.GV...........................................N.G.YS.......S.S..G..T......TS....S.Y.H.YLM......................................................................................YE.S..GSIH..D.V..VIG.....P............L..KPNT.VYY.......Y..RC...............GVS...S-.................................---.P.E..FS---lkt.........................................
V4MED8_EUTSA/58-148                    .....................................................PQQVHITQ.....GD.vE....GK.....AV.IVSWV..T...Q...............................................................................S................K-..GSN..............TV.L..Y.WKE.....N.SS...........................................K.K.LK.......A.H..G..K......TN....T.Y.K.FYN......................................................................................YT.S..RYIH..H.C..TIR.....H............L..EYDS.KYY.......Y..VV...............GVG...E-.................................-TE.R.K..F----wfft........................................
A0A1Y3MX13_PIRSE/98-198                ...............................................minagp--------.....GT.dC....SK.....EM.TIAWH..S...P...............................................................................Y................L-..-NN..............YV.E..Y.TVA.....S.DSn........................................frN.S.KR.......V.D..V..T......CS....F.I.D.SDRefin..............................................................................dklkPV.E..FYAC..K.A..YLT.....D............L..SSNT.DYI.......Y..RV...............GNE...YN.................................GNS.S.S..KKFKT............................................
V9GH45_9BACL/51-148                    ....................................................v-SKVTVTF.....HG.dT....TT.....SK.GFTWY..T...S...............................................................................Q................QV..TGS..............DL.Q..V.IEK.....T.SA...........................................A.P.DF.......M.N..A..N......SF....S.G.R.RTPs...................................................................................tnSP.T..ELVH..K.A..EAT.....K............L..KPNT.TYY.......F..RV...............GDA...SL................................nVWS.D.V..GTFQT............................................
A0A1Y2B2J4_9TREE/50-143                ...................................................pl--QQRLAY.....VN..-....SS.....AM.HVSWN..T...Y...............................................................................As..............lNA..SEA..............SV.I..Y.GTD.....P.FN...........................................L.D.LT.......A.Y..A..T......SM....T.Y.N.T--......................................................................................-S.R..TWNH..H.A..LLT.....G............L..QPKQ.DYW.......Y..RV...............AYT...NCy..............................gcSNI.P.T..YKFTT............................................
A0A1U7Z037_NICSY/52-145                ...................................................ad--AVHITQ.....GD.hA....GQ.....SV.IVSWV..T...P...............................................................................L................ES..KSK..............FE.T..Y.WKA.....G.AKh.........................................hH.K.HK.......A.H..A..K......IT....S.Y.K.YYN......................................................................................YI.S..GYIH..H.A..TIK.....R............-..QYNV.TYI.......Y..QL...............GEH...N-.................................SSR.R.L..ISFTT............................................
Q2QLL9_ORYSJ/59-150                    .....................................................PQQVHITL.....GD.qT....GT.....AM.TVSWV..T...A...............................................................................N................EL..GSN..............TV.R..Y.GSS.....P.EK...........................................L.D.RA.......A.E..G..S......HT....R.Y.D.YFN......................................................................................YT.S..GFIH..H.C..TLT.....G............L..THAT.KYY.......Y..AM...............GFD...H-.................................-TV.R.T..FSFTT............................................
A0A445K496_GLYSO/64-155                .....................................................PQQVHITQ.....GD.hV....GK.....GV.IISWI..S...P...............................................................................H................EP..GSS..............TV.I..Y.WAE.....N.SE...........................................F.K.WQ.......A.H..G..F......FL....T.Y.K.YFN......................................................................................YT.S..GYIH..H.C..TVH.....N............L..EFDT.KYY.......Y..EV...............GIG...N-.................................-TT.R.Q..FWFKT............................................
A0A0P1B5P9_PLAHL/91-188                .....................................................PQQLHLAY.....AGveA....GT.....AM.TVSWA..T...Y...............................................................................A................DV..TDC..............AV.W..I.GET.....E.DT...........................................LkR.VK.......A.P..I..V......SQ....S.Y.Y.SDK......................................................................................EY.F..MLHH..H.A..TIS.....G............L..KPRT.KYF.......Y..KV...............GSK...GDe...............................kYTS.D.I..NTFIT............................................
A0A3L6PVY2_PANMI/48-135                .....................................................PQQVHVSA.....VG..-....AK.....HM.RVSWV..T...D...............................................................................D................KR..TQS..............VV.E..Y.GRA.....S.RN...........................................Y.T.AS.......A.T..D..D......HT....S.Y.R.YFL......................................................................................YS.S..GKIH..H.V..KIG.....P............L..EPGA.VYY.......Y..RC...............GMA...GK.................................EFS.-.-..-----lrt.........................................
A0A0S9E0F3_9MICO/55-154                .....................................................PDRLVLTP.....SG.dL....SN.....SQ.AVTWR..T...S...............................................................................T................KV..TAAqa..........qaQI.R..V.ATAk..pyT.DD...........................................Y.T.VV.......A.A..S..S......TT....T.V.P.TDK......................................................................................GY.D..EAFH..T.V..KFT.....G............L..TPST.QYM.......Y..RV...............GDG...T-.................................NYS.E.W..QHFTT............................................
M4BKT0_HYAAE/50-165                    .....................psqihvafasevnvksysvirtsdsapeemrl--------.....--..-....--.....GM.TISWS..T...A...............................................................................Q................KT..RTS..............RV.R..F.GLS.....R.DD...........................................L.S.MM.......Q.Q..A..E......ERc..eQ.Y.D.FCS......................................................................................YT.S..PWFH..H.V..TIP.....Gd..........kL..EAAT.TYY.......Y..QC...............GDD...GG.................................GYS.R.V..YSFKT............................................
A0A2P4ZK50_9HYPO/34-120                .....................................................PVQQRIAV.....NG..-....PN.....SV.SIGWN..T...Y...............................................................................Q................QL..SQP..............CV.A..Y.GSS.....A.TS...........................................L.T.QQ.......A.C..S..K......NS....V.T.-.-YP......................................................................................TS.R..TWSN..S.V..TLN.....N............L..SPAT.TYY.......Y..KI...............VST...N-.................................--S.S.V..DHF--ls..........................................
W2PP21_PHYPN/100-198                   .....................................................PQQFHLAF.....AGeeA....GT.....GM.AISWT..S...F...............................................................................A................LE..ESP..............AV.W..I.GTS.....E.AKv.........................................aL.V.KD.......A.K..I..E......TK....S.Y.Y.KDE......................................................................................KY.E..LYSY..H.A..VVS.....G............L..EPYT.EYF.......Y..KV...............GSA...TEk...............................kFQS.S.V..SSFKT............................................
A0A445C3I4_ARAHY/51-141                .....................................................PQQVHISL.....AG..-....EK.....HM.RVSWI..T...D...............................................................................D................KN..SPS..............YV.E..Y.GKS.....P.GI...........................................Y.D.LV.......A.E..G..D......FT....S.Y.S.YML......................................................................................YS.S..GKIH..H.T..VIG.....P............L..EYNT.VYY.......Y..RC...............GGQ...G-.................................---.-.-..-----pefklktppa..................................
A0A3B6KQZ0_WHEAT/52-144                .....................................................PEQVHITQ.....GD.lT....GR.....AM.TISWV..T...P...............................................................................E................HP..GSN..............VV.R..Y.GLA.....A.DN...........................................L.N.LT.......A.E..G..T......VQ....R.Y.T.WGG.....................................................................................tYQ.S..PYIH..H.A..TLT.....G............L..DHAT.VYH.......Y..AV...............GFG...Y-.................................-TV.R.S..FSFKT............................................
A0A3B6KFY2_WHEAT/84-203                .....................................................PEQIALAA.....SA..D....PT.....SL.WVSWV..T...Graqvgs...................................................................hltpldP................TA..VRS..............EV.W..Y.GER.....P.ASadt.....................................vahP.H.HV.......A.R..G..S......AE....V.Y.S.QLYpyp...............................................................................gllnYT.S..GVIH..H.V..RLV.....G............L..RPST.RYY.......Y..RC...............GDS...SLk...............................gGLS.D.E..RSFVT............................................
A0A150ARJ3_9BACT/7-99                  ...................................................te--KYRLTL.....RD.nP....AT.....TI.TIGWN..Q...V...............................................................................S................G-..SNP..............VV.Y..Y.GTT.....D.YG...........................................T.N.YS.......Y.Y..S..N......SK....T.V.D.RSV.....................................................................................yYK.G..MNNQ..F.A..RLT.....G............L..KPNT.AYY.......F..VI...............RDS...Q-.................................GTS.K.R..YWFKT............................................
A0A1I3RMQ8_9SPHI/49-146                .....................................................PRRIILNV.....TE.dL....TS.....SV.AINWQ..T...A...............................................................................D................QV..KES..............FA.E..I.AIA.....D.AD...........................................P.R.FV.......D.K..A..I......RK....K.A.E.TEFvs.................................................................................lgdTV.S..SNYH..S.L..TFD.....G............L..IPNT.KYA.......Y..RV...............GQG...K-.................................HWS.E.W..FHFVT............................................
A0A061FJT8_THECC/836-939               .................................................plyg----HLSS.....ID.sT....GT.....SM.RLTWI..S...G...............................................................................D................K-..EPQ..............QV.K..Y.GNG.....K.SQ...........................................T.S.QV.......A.T..F..S......QD....D.M.C.--Ssilips.........................................................................pakdfgwHD.P..GYIH..T.A..VMT.....G............L..QPSS.TSY.......Y..KY...............GSD...AV.................................GWS.D.R..IEFRT............................................
T0R9R0_SAPDV/191-284                   .....................................................PTRVHAAY.....GA..S....PS.....TF.TIQWA..T...P...............................................................................P...............eCT..NGR..............HV.L..V.VRE.....E.AA...........................................I.D.DA.......Q.A..S..R......TF....V.A.N.SIV......................................................................................FG.A..RYEH..V.A..LAV.....Q............L..KSNT.RYA.......Y..YV...............GND...AY.................................SRS.I.L..YSFTT............................................
A0A3G3GR81_9BACT/36-133                .....................................................PDRVILGW.....QEnnA....AT.....SQ.SVNWR..T...D...............................................................................S................TI..VAA..............IG.A..I.HEA.....D.AS...........................................P.D.FV.......K.K..A..T......IV....P.A.T.TETvv..................................................................................vdGK.R..VLYH..T.V..HFT.....N............L..KPNT.KYS.......Y..RV...............GSG...E-.................................YWS.E.W..FHFKT............................................
B4NC50_DROWI/33-137                    .....................................................PEQVHLSF.....GE.iS....AS.....EI.VVTWS..T...L...............................................................................Sl..............pPN..ASS..............IV.E..Y.GLL.....R.ETgqnl...................................asvpL.S.QR.......A.E..G..Q......AI....K.F.V.DGGh....................................................................................kRA.T..QYIH..R.V..TLR.....E............L..KLNS.SYA.......Y..HC...............GSS...F-.................................GWS.V.L..FQFRT............................................
A0A1H4YWF6_9ACTN/78-183                .....................................................PFGRHLAF.....GA.dP....KS.....QM.RISWQ..V...P...............................................................................A................AV..KKP..............YI.R..I.GLR.....P.DD...........................................L.S.RR.......I.D..A..E......IR....D.L.Y.TPElqg................................................................................iraAL.E..QYYV..H.A..ALD.....S............L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................apkNRA.T.I..ASFRT............................................
G4KSE0_OSCVS/43-140                    ...................................................yt--KVSLTP.....GK..D....AT.....QL.NFAWY..S...K...............................................................................D...............eGK..ATP..............VV.H..F.GTS.....K.SA...........................................L.K.PY.......-.T..G..T......SA....A.V.D.ASLt....................................................................................gDT.A..YVYN..H.T..TVT.....G............L..KENT.AYY.......Y..TV...............EKN...G-.................................EQT.A.V..ETYKTgsfe........................................
M7Z1G0_TRIUA/47-134                    .....................................................PQQVHLSV.....VG..-....AN.....HM.RVSWI..T...D...............................................................................A................KH..GHS..............VV.E..Y.GRA.....S.GN...........................................Y.T.TS.......A.T..G..E......HT....S.Y.R.YYL......................................................................................YS.S..GKIH..H.V..TIG.....P............L..DPDA.VYY.......Y..RC...............GMV...G-.................................---.-.-..-----deftlkt.....................................
A0A3N7G463_POPTR/2-63                  .............................................syeevgys--------.....--..-....--.....--.-----..-...-...............................................................................-................--..---..............--.-..-.---.....-.--...........................................-.-.--.......-.-..-..-......-F....V.Y.N.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..EPST.LYQ.......Y..QC...............GDPy.iS-.................................AMS.D.V..FYFRT............................................
R5KYY3_9FIRM/75-172                    ...................................................ss--KIILTP.....GK..N....AK.....DL.GFAWY..S...K...............................................................................E................K-..GEP..............AV.K..V.GKK.....S.DL..........................................sD.A.KE.......F.K..G..T......AT....E.I.N.RSNq....................................................................................kNT.Y..KASN..K.V..AIE.....D...........yF..EEDT.TYY.......Y..SY...............TDD..vRN................................pNWS.E.A..KAYTT............................................
A0A1P8RTV3_9FLAO/7-87                  ..................................................ylq--------.....-K.gT....ET.....GV.TIKWR..T...D...............................................................................A................A-..DTS..............VI.E..Y.STD.....M.TF...........................................S.T.Y-.......-.-..-..-......-S....T.F.N.E--......................................................................................AT.L..KTEH..E.V..EIV.....G............L..TAGT.VYY.......Y..RL...............GTG...GSl...............................lAHN.S.A..LYFKT............................................
A0A1R3RGI6_ASPC5/33-122                .....................................................PYQQRLAI.....YG..-....PN.....EV.SVGWN..T...Y...............................................................................E................KL..NQS..............CV.H..Y.GTS.....S.DN...........................................L.D.SE.......A.C..S..T......KS....T.T.-.-YS......................................................................................TS.R..TYSN..V.V..TLT.....G............L..TPAT.TYY.......Y..KI...............ESG...N-.................................--S.S.V..EQF--lsprt.......................................
A0A0F7TXJ3_9EURO/35-122                .....................................................PMQAHLAY.....SG..-....DR.....GM.TVSWN..T...Y...............................................................................S................KL..HHP..............YV.R..Y.GQH.....P.NA...........................................L.S.QW.......A.E..S..D......VS....V.T.-.-YP......................................................................................TS.S..TSNN..H.V..KIT.....G............L..EPNT.MYY.......Y..QP...............QCG...N-.................................-ST.Q.I..YTMKT............................................
A0A287PHX0_HORVV/115-223               .................................................pvyp----RLAQ.....GK..S....WD.....EM.TVTWT..S...G...............................................................................Ys..............tKE..ATP..............FV.E..W.GIQ.....G.QI...........................................Q.I.LS.......-.P..A..G......TL....T.F.S.RDTmcgpp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNL.KYT.......Y..RI...............GHRl.fNGq...............................iVWG.R.Q..YSFK-a...........................................
L1JM98_GUITC/263-382                   .....................................................PTQVRLSM.....TS..E....PT.....EM.RVMWV..S...E...............................................................................A................CP..GKPfg..........gaVV.L..F.SEE.....S.CVseage................................evphcrY.E.HR.......V.K..P..S......FT....T.Y.T.ADDlcgapan........................................................................teraqnfLD.P..GYIY..D.A..VMT.....S............L..EPGR.RYF.......Y..RV...............GCQ...DAp...............................gGWS.A.-..-----as..........................................
A0A2R6R6S1_ACTCH/56-147                .....................................................PQQVHITQ.....GD.hV....GK.....GV.IVSWV..T...M...............................................................................D................EP..GSS..............TV.L..Y.WSE.....N.SS...........................................Y.K.NK.......A.K..G..N......FV....T.Y.K.FYN......................................................................................YT.S..GYIH..H.C..TIK.....K............L..KFNT.KYY.......Y..EV...............GIE...H-.................................-TT.R.T..FWFTT............................................
M5XBB0_PRUPE/169-276                   ................................................pvypr-----LAQ.....GK..L....WN.....EM.TVTWT..S...G...............................................................................Yd..............iTE..ATP..............FV.E..W.GSK.....G.EL...........................................V.R.SS.......A.-..G..T......L-....N.F.D.RNSlcgap...........................................................................artvgwRD.P..GFIH..T.A..FLK.....E............L..WPNT.VYT.......Y..KV...............GHR..lSNd..............................ssILS.Q.E..YQFR-a...........................................
A0A1Y1XIZ8_9FUNG/170-261               ....................................................f-ERLSVTP.....GE..D....ES.....KL.NFAWY..S...R...............................................................................S................E-..ENP..............VM.R..L.SEN.....E.DM...........................................SdY.TE.......F.T..G..T......NN....Y.I.R.KYL......................................................................................GD.K..YYSN..K.I..SIE.....G............L..KPKS.TYY.......Y..QR...............---...--.................................---.-.-..-----llndeweapikytt..............................
A0A0D9Y0R6_9ORYZ/965-1073              .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Ys..............iKE..AIP..............FV.E..W.GHK.....G.GD...........................................Q.I.VS.......-.P..A..G......TL....T.F.N.RNSmcgsp...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPDS.LYT.......Y..RL...............GHKl.lDGt...............................hIWS.K.S..YSFR-a...........................................
A0A1U8A0D2_NELNU/149-252               .....................................................PEQIHLSF.....TT..K....VD.....EM.RVMFV..T...A...............................................................................D................G-..KES..............FV.K..Y.GER.....E.HR...........................................L.D.NV.......A.V..T..E......VR....T.Y.E.RLDmcdspa..........................................................................nesigwRD.P..GFIH..D.G..VMT.....N............L..KSGI.RYY.......Y..KV...............GSD...KR.................................GWS.K.T..HSF--is..........................................
A0A1X7VAQ1_AMPQE/641-732               .....................................................PEQIHIAA.....TE..D....PT.....SV.IVTWI..T...F...............................................................................A................ST..PDS..............TV.L..W.RLH.....G.SA..........................................iK.L.QP.......V.S..G..Y......ST....N.F.N.DG-......................................................................................KV.K..RFVH..R.V..KLS.....D............L..KPST.KYD.......Y..QC...............GSS...A-.................................NWS.S.L..YTMRT............................................
E0VL88_PEDHC/34-125                    .....................................................PTQIHIAF.....GN..T....VS.....DI.VVTWV..T...T...............................................................................S................KT..KHS..............VV.E..Y.GLN.....G.L-...........................................-.I.DR.......A.E..G..N......QT....L.F.R.DGGk....................................................................................lKR.K..FYIH..R.V..LLP.....N............L..IENA.TYE.......Y..HC...............GSN...L-.................................GWS.E.L..LFFRT............................................
A0A2P6P4Z8_ROSCH/73-181                .................................................plyp----RLAL.....GK..L....WD.....EM.TVTWT..S...G...............................................................................Yn..............iDE..AVP..............VV.E..W.GLK.....G.EP...........................................Q.T.RS.......P.A..G..T......L-....T.F.S.RRDmcaap...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNS.VYS.......Y..KL...............GHR..lSNg..............................syIWS.K.A..YSFK-s...........................................
A0A0C2T9S2_AMAMU/1-87                  ....................................................m--QLRLAY.....AG..-....ST.....GM.VVSWN..T...Y...............................................................................A................QL..SQP..............KV.F..Y.GRH.....P.WL...........................................L.K.ST.......A.S..S..N......VS....V.T.-.-YP......................................................................................SS.T..TYNN..H.V..KIT.....G............L..HPNT.QYY.......Y..LP...............ENS...N-.................................-AT.T.P..YTFKT............................................
A0A2T7EJP8_9POAL/62-153                .....................................................PQQVHITL.....GD.qA....GT.....AM.TVSWV..T...V...............................................................................E................AE..GNS..............TV.L..Y.GRA.....M.GR...........................................L.D.HA.......A.E..G..T......TT....R.Y.T.FYN......................................................................................YT.S..GFIH..H.C..TLA.....G............L..DHAT.RYY.......Y..AV...............GFG...D-.................................-TV.R.T..FWFTT............................................
A0A1I1UKW4_9BACT/30-111                .................................................spyl--------.....QT.vT....PT.....GI.TIRWR..T...D...............................................................................L................P-..TDS..............RV.R..F.GAD.....L.SQ...........................................L.T.QQ.......T.T..D..P......A-....-.-.-.---......................................................................................--.A..TTEH..L.V..TLT.....D............L..QPAT.QYF.......Y..AV...............GSS...AGd...............................lMVS.S.D..QYFRT............................................
A0A0Q4GQC0_9SPHI/34-118                ................................................rgpyl------QM.....AS..-....PT.....SM.TLRWR..T...N...............................................................................V................Y-..DRS..............RV.R..Y.GES.....P.EK...........................................L.Q.YE.......T.I..D..S......TL....-.-.-.---......................................................................................--.-..VSEH..I.V..KLK.....N............L..KPMT.KYY.......Y..TI...............GNH...AD.................................---.-.-..-----ttlqgdnenyfytf..............................
D1BCR8_SANKS/243-337                   ...................................................ht--DVVMTV.....GS..D....ET.....SR.SITWY..T...N...............................................................................V................D-..SPQ..............QV.Q..L.APA.....A.AV...........................................V.D.GQ.......M.P..A..S......AT....T.V.L.ATGg...................................................................................ptSS.G..EFRR..S.A..TLA.....D............L..AAST.DYV.......Y..RV...............GSD...TD.................................GWS.A.T..YPFST............................................
A0A0E0GWH5_ORYNI/63-176                .....................................................PEQIAVAL.....SA..A....PS.....SA.WVSWV..T...G...............................................................................Dfqmgaa....vepldpTA..VAS..............VV.R..Y.GLA.....A.DS...........................................L.V.RR.......A.T..G..D......AL....V.Y.S.QLYpfd...............................................................................gllnYT.S..AIIH..H.V..RLQ.....G............L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.D.I..HAFRT............................................
V6K1W2_STRRC/74-179                    .....................................................PFGRHLAY.....GN.dP....RT.....EM.TVSWQ..V...P...............................................................................V................AV..KNP..............FI.R..I.GAH.....P.WD...........................................L.S.RK.......I.E..A..E......VR....S.L.Y.TPAgvg................................................................................asgDH.T..QYYL..H.A..QLT.....H............L..RPGR.TYY.......Y..GV...............GHE...G-.................................---.-.-..-----fdpaerhllgtlgtftt...........................
A0A0W8C569_PHYNI/61-158                .....................................................PQQLHLAY.....AGksA....GT.....AM.TVSWS..T...Y...............................................................................A................KV..DDS..............SV.W..I.GRS.....E.DT...........................................L.E.LV.......D.T.pV..T......QX....S.Y.Y.HDA......................................................................................TY.N..MFHH..H.A..MVS.....G............L..TPHT.KYY.......Y..KV...............GSK...ANm...............................sYTS.D.V..FSFVT............................................
A0A287JGF6_HORVV/9-99                  ..................................................sxx---VHIST.....VG..-....RN.....KM.RISWV..T...D...............................................................................D................RD..APS..............VV.E..Y.GES.....Q.GN...........................................Y.T.AS.......A.T..G..D......HA....T.Y.K.YFL......................................................................................YE.S..GAIH..H.A..TIG.....P............L..APST.TYH.......Y..RC...............GKA...GD.................................---.-.-..-----eftlrtppa...................................
A0A1X2IF19_9FUNG/56-161                .....................................................PQQIHISL.....AN..E....AK.....YA.KVQFA..T...T...............................................................................Q................SV..NDT..............LL.K..Y.WPK.....K.KD...........................................G.A.SY.......Q.K..P..V......IV....T.T.S.EDWtfvd..............................................................................ggnaKR.P..LYLH..N.I..QTK.....P............L..KLAT.LYE.......Y..QV...............GSI...NCdd............................kstLWS.P.V..FEFHT............................................
A0A2U1T8Y9_9CORY/49-146                ....................................................v-QNLVLGV.....GA..D....ET.....SA.NFNWS..A...P...............................................................................G................L-..QQE..............YL.Q..I.APT.....T.TF...........................................D.G.TE.......F.P..V..D......AA....T.T.I.PAErgg................................................................................ltiRE.A..RYPR..T.A..EIS.....G............L..EENT.AYV.......Y..RA...............GSE...RS.................................GWS.A.P..YTFTT............................................
C5XWK4_SORBI/144-251                   .....................................................PAQLHLAF.....TD..E....VD.....EM.RVLFV..C...G...............................................................................D................D-..GGR..............FV.R..Y.GLA.....G.RRe.........................................eE.W.EE.......V.P..A..E......AR....T.Y.E.QRHmcdypa..........................................................................ndsvgwRH.P..GFVF..D.A..VMK.....G............L..QPGT.RYF.......Y..KV...............GNG...NDs...............................gGWS.E.T..YSF--is..........................................
A0A259UF05_9FIRM/35-131                .....................................................PEHITLTW.....SE.dP....KT.....TQ.TITWQ..T...A...............................................................................A................TT..VDG..............LV.Q..Y.AEA.....M.NKql......................................lplH.A.VR.......I.A..A..D......-V....T.A.L.HTN......................................................................................TG.S..VAVH..S.A..TLT.....G............L..KPNT.RYV.......Y..QV...............GGI...S-.................................GWS.Q.P..QYFTT............................................
A0A0E0C8W0_9ORYZ/205-308               .....................................................PLHGHLSS.....VD.sK....AT.....SM.RLTWV..S...G...............................................................................D................A-..RPQ..............QV.Q..Y.GTG.....K.TA...........................................T.S.VA.......T.T..F..T......HK....D.M.C.--Siavlps.........................................................................pakdfgwHD.P..GYIH..S.A..LMT.....G............L..QPSQ.SYK.......Y..RY...............GSD...SV.................................GWS.N.T..TEFRT............................................
A0A194YKI3_SORBI/55-145                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IVSWV..T...P...............................................................................E................EP..GPS..............EV.F..Y.GKE.....K.Q-...........................................Y.D.QK.......S.E..G..T......TT....N.Y.T.FYD......................................................................................YK.S..GYIH..H.C..LVD.....G............L..EYNT.KYY.......Y..KI...............GSG...D-.................................-SA.R.E..FWFET............................................
A0A2R6QGE0_ACTCH/195-303               .................................................plyp----RLSQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Ys..............iNE..AVP..............FV.E..W.GLK.....G.GY...........................................Q.-.MQ.......S.P..A..G......TL....T.F.N.RNSmcssp...........................................................................artvgwRD.P..GFIH..T.S..FLK.....D............L..WPNL.LYT.......Y..KL...............GHRl.fNGs...............................yVWS.K.I..YSFK-s...........................................
A0A061GP98_THECC/62-153                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...A...............................................................................D................EP..GPS..............KV.Q..Y.GTS.....E.KN...........................................Y.E.FT.......A.D..G..K......MT....N.Y.T.FYK......................................................................................YN.S..GYIH..H.V..FVD.....G............L..EYDT.KYY.......Y..KI...............GTG...D-.................................-SA.R.E..FWFQT............................................
A0A287EIF1_HORVV/45-138                .....................................................PQQVHISS.....VG..-....SK.....HM.RISWV..T...D...............................................................................Dr.............rtAS..APS..............VV.E..Y.GTS.....P.GN...........................................Y.T.AS.......A.E..G..S......HT....T.Y.R.CSS.....................................................................................yYS.S..GAIH..E.V..TIG.....P............L..KPST.TYY.......Y..RC...............GKV...G-.................................---.-.-..-----dadmslrtp...................................
A0A0U1NTY1_9BACI/987-1091              ...................................................ik--NIISTP.....TS..N....PQ.....EM.SFTWE..S...S...............................................................................P...............lAK..DNT..............VI.Q..F.ARQ.....K.DYdkk.....................................gerA.F.RT.......V.N..G..S......--....-.-.-.--Ssnqvfs.........................................................................sdpditkNG.I..VRVN..H.V..TLT.....D............L..KHDT.TYV.......Y..RV...............GDG...E-.................................NWS.S.P..QEFTT............................................
A0A2T3A1I7_9PEZI/34-123                .....................................................PTQQRLAI.....HG..-....MN.....AV.SVGWN..T...Y...............................................................................E................QL..AKP..............CV.Q..Y.GTS.....A.SR...........................................L.L.KE.......A.C..S..T......SS....V.T.-.-YN......................................................................................TS.R..TWAN..T.V..VLT.....G............L..SPAT.TYY.......Y..QI...............EST...NA.................................TVQ.-.-..-----sflsprt.....................................
A0A453ELN7_AEGTS/64-177                .....................................................PEQIAVAL.....SA..A....PT.....SA.WVSWI..T...G...............................................................................Dfqmgga....vkpldpGT..VGS..............VV.R..Y.GLA.....A.DS...........................................L.A.RE.......A.T..G..E......AL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RIL.....G............L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.A.V..HAFRT............................................
A0A0L8GF81_OCTBM/45-135                .....................................................PEQIHIAY.....GE..-....DY.....SM.IITWS..T...F...............................................................................K................SG..LNT..............IV.K..Y.GTD.....S.--...........................................L.S.HV.......A.Y..G..K......AQ....R.F.I.NPDl....................................................................................yFH.T..QYIH..V.V..TVP.....N............L..QPGV.KYI.......Y..RC...............GSP...Q-.................................GWS.E.Q..FSFT-a...........................................
A0A498JX87_MALDO/76-188                .....................................................PEQISVSL.....ST..T....YD.....SV.WISWI..T...G...............................................................................Efqigdn....ikpldpNN..VSS..............IV.T..Y.GRY.....G.FP...........................................M.D.NQ.......S.T..G..Y......SL....I.Y.N.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..RPNT.LYQ.......Y..QC...............GDP...SI................................aDMS.K.I..SYFKT............................................
A0A2C9UD23_MANES/96-208                .....................................................PQQISVSL.....SS..N....YD.....SV.WISWV..T...G...............................................................................Dfqigdd....itpldpQL..VSS..............VV.Q..Y.GIS.....G.LP...........................................M.S.YQ.......A.T..G..Y......SL....V.Y.N.QLYpfe...............................................................................gaqnYT.S..GIIH..H.V..RLT.....G............L..EPGE.LYQ.......Y..QC...............GDP...SI................................pVMS.D.I..FYFRT............................................
A0A2K6QR20_RHIRO/32-125                .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......S.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A445JLN8_GLYSO/173-281               .................................................pvyp----RLAQ.....GK..T....WD.....EI.TVTWT..S...G...............................................................................Yg..............iSD..AEP..............FV.E..W.GPK.....G.GN...........................................L.V.KS.......P.A..G..T......L-....T.F.D.HNTmcgap...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPNQ.EYK.......Y..KL...............GHRl.fNGt...............................iIWS.Q.E..YQFK-a...........................................
I1RKT7_GIBZE/34-123                    .....................................................PVQQRIAF.....SG..-....PN.....SI.TVGWN..T...Y...............................................................................A................KQ..AKP..............CV.Q..Y.GTS.....Q.NA...........................................L.D.KQ.......A.C..S..D......IS....T.T.-.-YP......................................................................................TS.R..TWVN..S.V..TLS.....G............L..SPAT.TYY.......Y..KI...............VSK...NS.................................---.-.-..-----tidhflsprt..................................
A0A1B8GKV0_9PEZI/35-121                .....................................................PTQIRLAY.....AG..-....DK.....GM.AVSWN..T...N...............................................................................E................QL..TNP..............TV.Y..Y.NKH.....E.KN..........................................vL.K.SS.......A.K..S..K......IS....T.T.-.-YP......................................................................................TS.S..TYNN..H.V..VIS.....D............L..KPDT.TYY.......Y..RP...............QCA...T-.................................---.Q.T..YTFTT............................................
A0A2C9JWK9_BIOGL/49-141                .....................................................PEQIHLSL.....GS..Q....SH.....SI.VVMWS..T...K...............................................................................L................E-..EEC..............FI.E..Y.GNG.....P.EN...........................................L.K.SV.......T.A.tM..A......QL....T.V.-.DNE......................................................................................QA.A..QYLH..R.A..ELL.....D............L..KPGE.QYS.......Y..RI...............INK...GS................................nVKS.G.I..FKFR-f...........................................
A0A1I3V3H7_9FLAO/19-110                ..............................................qnlepyl--------.....QA.aT....PT.....SI.HISWK..T...T...............................................................................S................N-..LES..............KV.Q..Y.GLT.....I.ES...........................................L.S.KL.......A.I..G..D......TK....I.L.S.DVG......................................................................................YPaN..YYYH..T.T..KIE.....D............L..LPNT.KYY.......Y..KV...............ITG...S-.................................ETS.E.I..LSFRT............................................
A0A453K9Y9_AEGTS/108-196               .....................................................PQQVHIST.....VG..-....SN.....NM.RISWV..T...D...............................................................................D................RK..APS..............VV.E..Y.GKS.....R.GN...........................................Y.T.VS.......T.T..G..D......HA....T.Y.R.YFF......................................................................................YK.S..GAIH..H.V..TIG.....P............L..APST.TYH.......Y..RC...............GKA...GD.................................---.-.-..-----eftlktp.....................................
A0A484E649_BRELC/98-196                .....................................................PQQFHLAF.....AGteP....GT.....GM.AISWT..S...F...............................................................................A................EE..DAP..............GV.W..I.GTA.....P.DK...........................................L.V.LD.......V.D..G..Ai....dIV....M.Y.Y.SDK......................................................................................KY.E..LYNY..H.A..VVT.....G............L..KPYT.EYF.......Y..KV...............GSE...TEp...............................kFQS.A.V..SSFRT............................................
A0A2H5PDF4_CITUN/78-189                .....................................................PEQIALAI.....SS..-....PT.....SM.WVSWV..T...G...............................................................................Darigsn....vtpldpST..VAS..............EV.W..Y.GKQ.....S.GK...........................................Y.T.SK.......R.G..G..N......AT....V.Y.S.QLYpfk...............................................................................gllnYT.S..GIIH..H.V..KID.....G............L..DPGS.KYY.......Y..KC...............GDS...KI................................pAMS.A.E..HVFET............................................
A0A0P1AG99_PLAHL/189-295               .....................................................PKHGHLSL.....TD..D....DS.....AM.AIMFN..S...G...............................................................................S................S-..KTP..............MV.K..Y.GEN.....A.QD...........................................L.K.FH.......A.T..G..T......TT....T.Y.G.ADDlchapan........................................................................vlgqksfRD.P..GYMH..T.V..IMT.....D............L..KPGT.YYY.......Y..QY...............GHE...EE................................hAWS.H.V..RRFK-s...........................................
T1GWM5_MEGSC/169-258                   ...............................................ikdnhg--------.....-S.yS....TS.....EI.VVTWS..T...K...............................................................................D................DT..KSS..............VV.E..Y.GIE.....S.FQ...........................................L.S.EK.......G.S..S..T......HF....V.D.G.GAG......................................................................................KH.S..QFVH..R.V..VLK.....N............L..EPST.KYT.......Y..HC...............GSP...Q-.................................GWS.S.A..FWFRT............................................
A0A0B8PU02_9VIBR/64-150                ..............................................tpylqhp--------.....--..A....TD.....GM.TVMFE..P...E...............................................................................S...............lTS..TDS..............VV.Y..Y.REQ.....G.NE...........................................G.P.YQ.......S.L..V..S......HS....-.-.-.TDY......................................................................................DE.L..GLVQ..R.V..RID.....G............L..KSDT.KYD.......Y..FV...............RTE...Q-.................................GDS.K.V..YNFRT............................................
A0A1U7YY54_NELNU/50-137                .....................................................PQQVHISL.....VG..-....KD.....KM.RIMWI..T...Q...............................................................................H................A-..SPA..............TV.E..Y.DTS.....A.GT...........................................Y.G.YS.......A.T..G..S......TY....S.Y.E.YLM......................................................................................YK.S..GEIH..D.V..VIG.....P............L..EPNT.VYY.......Y..RC...............GSN...S-.................................--S.R.E..FSFKT............................................
K0JZC5_SACES/44-134                    ....................................................v-SRVILTP.....TA.tP....ND.....SQ.NFTWR..S...T...............................................................................D................A-..GGG..............TV.Q..L.RPA.....G.GD...........................................A.V.TI.......A.A..H..A......-V....D.T.S.NLA......................................................................................GV.D..YTHY..S.A..TAT.....G............L..SADT.AYE.......Y..RV...............GTG...D-.................................EWS.R.W..RAFR-s...........................................
I4DHV7_ORYSJ/173-281                   .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Ys..............iKE..AIP..............FV.E..W.GHK.....G.GN...........................................Q.M.LS.......P.-..A..G......TL....T.F.S.RNSmcgsp...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.K.S..YSFR-a...........................................
A0A2G2YIL1_CAPAN/47-135                .....................................................PQQVHISL.....AG..-....DK.....HM.RVTWV..T...N...............................................................................D................GA..SPS..............IV.E..Y.GTS.....P.EK...........................................Y.S.AT.......A.Q..G..E......ST....K.Y.S.YLL......................................................................................YS.S..GKIH..H.T..VIG.....P............L..QENT.TYF.......Y..KC...............GGE...G-.................................---.P.-..-----efqlktp.....................................
A0A0D3FKI8_9ORYZ/68-155                .....................................................PQQVHISL.....AG..-....EK.....HM.RVTFV..T...D...............................................................................D................NS..VPS..............VV.D..Y.GTE.....A.GT...........................................Y.T.ST.......S.Q..G..E......ST....S.Y.S.YLM......................................................................................YS.S..GKIH..H.V..VIG.....P............L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.P.E..FQFKT............................................
G0RHA2_HYPJQ/34-120                    .....................................................PVQQRIAV.....NG..-....PN.....SV.SIGWN..T...Y...............................................................................Q................QL..SQP..............CV.A..Y.GTS.....A.TS...........................................L.T.QQ.......A.C..S..Q......SS....V.T.-.-YQ......................................................................................TS.R..TWSN..A.V..TLS.....N............L..SPAT.TYY.......Y..KI...............VST...N-.................................--S.S.V..DHF--ls..........................................
E3JBW9_FRAIE/51-145                    ...................................................vs--PVNLEL.....VT.lT....ET.....SA.VLTWY..S...Gipgtdd...................................................................gtkrmlP................KP..ADG..............QV.S..Y.GTS.....P.SR...........................................L.T.KT.......A.H..D..K......G-....-.-.-.---......................................................................................-G.L..TPYH..Y.V..ELT.....G............L..EPGQ.TYY.......Y..RA...............ASA...G-.................................---.-.-..-----ktaaptal....................................
A0A1U8A995_NELNU/148-251               .....................................................PEQIHLAF.....TT..K....VD.....EM.RVMFV..T...A...............................................................................D................G-..KES..............FV.K..Y.GKR.....E.HR...........................................L.D.YV.......A.G..T..E......VR....T.Y.E.RLDmcdspa..........................................................................nesigwRD.P..GFIH..D.G..VMT.....N............L..KSGM.RYY.......Y..KV...............GSD...ER.................................GWS.K.T..HSF--is..........................................
PPA11_ARATH/54-130                     .....................................................PEQVHITQ.....GD.nA....GR.....AM.IISWV..M...P...............................................................................L...............nED..GSN..............VV.T..Y.WIA.....S.SDg.........................................sD.N.KN.......A.I..A..T......TS....S.Y.R.YFN......................................................................................YT.S..GYLH..H.A..TIK.....K............L..EYD-.---.......-..--...............---...--.................................---.-.-..-----ps..........................................
A0A3B6KRJ1_WHEAT/52-144                .....................................................PEQVHITQ.....GD.lT....GR.....AM.TISWV..T...P...............................................................................E................HP..GSN..............VV.R..Y.GLA.....A.DN...........................................L.N.LT.......A.E..G..T......VQ....R.Y.T.WGG.....................................................................................tYQ.S..PYIH..H.A..TLT.....G............L..DHAT.VYH.......Y..AV...............GFG...Y-.................................-TV.R.S..FSFKT............................................
D7MBM6_ARALL/51-147                    .....................................................PEQVHIIQ.....GD.yN....GR.....GM.IISWV..T...P...............................................................................L................NL.aGSN..............VV.T..Y.WKA.....V.SGdv.......................................ksE.K.KR.......A.H..A..S......TS....S.Y.R.FYD......................................................................................YT.S..GFLH..H.A..TIK.....G............L..KYDT.KYI.......Y..EV...............GTD...E-.................................-SV.R.Q..FSFTT............................................
A0A0E4A090_9BACT/31-127                .....................................................PDRLILGW.....QG.eP....AT.....SQ.SVNWR..T...D...............................................................................S................TV..TNA..............VG.A..I.AEA.....D.PS...........................................P.D.FV.......R.N..A..T......LV....P.A.T.SETiv..................................................................................mdGK.Q..VRYH..S.V..HFK.....N............L..KPGT.QYS.......Y..RV...............GDG...T-.................................YWS.E.W..FQFKT............................................
A0A1H9C927_9FLAO/125-217               ...................................................pt---ISISS.....TP.tT....SN.....SA.TINYS..L...N...............................................................................Aw..............gNT..TTS..............LV.R..Y.GLT.....S.GN...........................................L.S.SQ.......V.V..G..N......SA....S.-.-.---......................................................................................GT.T..DTPS..T.V..NIP.....S............L..LPNT.TYY.......Y..QV...............EAT...NSv..............................gtTMS.T.I..GNFTT............................................
F6W4G5_ORNAN/8-147                     .....................................................PSDVHVSR.....VG.dL....ED.....QL.SVRWS..S...P...............................................................................Palk..........dflFQ..AKY..............QI.R..Y.RVE.....D.SV...........................................E.W.KL.......-.P..Q..S......QN....P.R.-.--Eggawwfrvergsedrvg...................................................qipparlltsslpigqlvDD.V..SNQT..S.C..RLA.....G............L..KPGT.VYF.......V..QVrcnp.......fgiyGSK...KA................................gIWS.E.W..SH---pta.........................................
A0A0D2P079_GOSRA/169-277               .................................................plyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Yd..............iDE..AVP..............FV.E..W.GRK.....G.DL...........................................Q.V.RS.......-.P..A..G......TL....T.F.K.QNSmcgsp...........................................................................astvgwRD.P..GFIH..T.S..FLK.....D............L..WPNF.VYM.......Y..RI...............GHLl.yNGs...............................vVWS.K.T..YSFK-s...........................................
A0A287WJP8_HORVV/70-184                ..................................................pvf---PRLAQ.....GK..A....HD.....EM.TVTWT..S...G...............................................................................Y................DI..GEAy............pFV.E..W.GVV.....A.SGgr......................................rrgN.P.TR.......T.P..A..G......TL....T.F.S.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FMR.....Q............L..WPNK.QYF.......Y..KI...............GHE..lSDg..............................tvVWG.K.S..YTFR-a...........................................
R4KAZ7_9FIRM/35-142                    ...............................................kpyllt--------.....LN..P....SN.....EM.NVVWI..S...K...............................................................................E................S-..GEG..............FV.E..F.GLT.....E.DL...........................................G.T.-T.......V.A..A..T......QY....E.I.E.GLRtsitpegy......................................................................dpdpaknpEL.N..VFQQ..I.A..TLQ.....N............L..KPNT.IYY.......Y..QA...............TTK..vGDk...............................iEKS.K.V..YNFKT............................................
K3Z5V8_SETIT/66-157                    .....................................................PQQVHITL.....GD.qT....GT.....AM.LVSWV..T...V...............................................................................E................AE..GNS..............TV.L..Y.GRA.....A.DR...........................................L.D.LA.......A.E..G..T......TT....R.Y.T.FYN......................................................................................YT.S..GFIH..H.C..TLT.....G............L..DHGT.RYY.......Y..AM...............GFG...D-.................................-TV.R.T..FWFTT............................................
A0A319BTH6_ASPLB/70-173                ..........................................nnvnvislsyi--------.....--..-....PK.....GM.HIHYQ..T...P...............................................................................F...............gLG..QLP..............AV.R..W.GKD.....P.RN...........................................L.N.ST.......A.Q..G..Y......SH....T.Y.D.RTPscsq.............................................................................vkaitQC.S..QFFH..E.V..SID.....G............L..EPDA.TYY.......Y..QI...............PAA...NG................................tTQS.D.V..LSFKT............................................
A0A068TL08_COFCA/62-153                .....................................................PQQVHITQ.....GD.lE....GK.....AV.IVSWV..T...V...............................................................................D................ER..GSD..............TV.L..Y.WSD.....N.AT...........................................E.K.LK.......A.K..G..T......VT....K.Y.K.YFN......................................................................................YT.S..GYIH..H.A..TIK.....H............L..QHDT.KYY.......Y..EV...............GID...H-.................................-TS.R.T..FWFVT............................................
A0A453JV22_AEGTS/65-157                .....................................................PEQVHLTF.....SD..R....AD.....EM.RVMFV..C...A...............................................................................D................A-..GKR..............AV.R..Y.GLE.....K.EE...........................................E.K.GW.......T.E.mG..T.....eVR....T.Y.E.QKHmcdapa..........................................................................ndsvgwRD.P..GFVF..A.G..LMN.....G............L..EPGR.RYF.......Y..K-...............---...--.................................---.-.-..-----rqq.........................................
A0A2U1KAK7_ARTAN/54-145                .....................................................PQQVHITQ.....GD.hV....GK.....AM.IVSWV..T...M...............................................................................D................EP..GSN..............TV.Y..Y.WSQ.....N.SK...........................................K.K.MK.......A.K..G..M......VT....T.Y.S.FYN......................................................................................YT.S..GFIH..H.C..NIT.....H............L..KHDT.KYY.......Y..MV...............GIG...H-.................................-TT.R.T..FWFMT............................................
A0A1U8B5R1_NELNU/63-154                .....................................................PQQVHITQ.....GD.hE....GK.....GV.IISWV..T...Q...............................................................................D................EP..GSS..............AV.L..Y.WSE.....N.SK...........................................H.K.YL.......A.K..G..E......VV....T.Y.K.FYN......................................................................................YT.S..GYIH..H.C..TIK.....N............L..KFDT.KYY.......Y..EI...............GIG...K-.................................-TV.R.Q..FWFRT............................................
A0A2M9BU58_9MICO/55-152                .....................................................PDRIVLTP.....SG.dL....AN.....SQ.AVTWR..T...S...............................................................................T................GV..TTA..............QA.Q..I.RVA.....T.AEpy......................................mtdY.T.TV.......D.A..S..E......ST....T.V.P.TDQ......................................................................................GY.T..EMFH..S.V..EFT.....G............L..SPAT.QYQ.......Y..RV...............GDG...T-.................................NFS.E.W..QHFTT............................................
A0A074KWP3_9BACT/38-123                ..................................................gwf-----LTW.....KE.dP....TS.....SM.VVDWH..S...F...............................................................................G................E-..EGQ..............TF.K..I.RKE.....G.EA...........................................E.W.RE.......E.K..G..K......VL....E.F.P.-FT......................................................................................SP.K..RWIH..R.V..ELK.....G............L..EPDS.RYD.......I..QL...............EGQ...E-.................................---.-.-..-----aifyfrt.....................................
A0A1S3BB33_CUCME/60-151                .....................................................PQQVHITQ.....GD.sE....GK.....SV.IISWV..T...P...............................................................................D................KP..GSN..............RV.V..Y.WAE.....N.SD...........................................T.R.NH.......A.E..G..Y......FV....S.Y.K.YFN......................................................................................YT.S..GYIH..H.C..TIN.....D............L..EYDT.KYF.......Y..VI...............GFG...S-.................................-LS.R.R..FWFTT............................................
A0A0G3GWR7_9CORY/33-122                ...................................................vg--RIILGA.....GA..D....QT.....QS.TVSWR..A...K...............................................................................G................F-..SAQ..............SL.K..F.YPT.....S.DP...........................................S.N.AT.......V.V..P..A......QE....Q.D.N.--R......................................................................................AL.L..YRSF..E.A..TIT.....G............L..KPQT.SYT.......Y..LV...............GSD...QG.................................GWS.E.P..HSFTT............................................
A0A2M9D194_9CELL/239-332               ....................................................v-SDVVLGI.....GA..D....ES.....QR.NVSWY..T...G...............................................................................T................D-..VPQ..............VA.Q..V.ART.....A.DL...........................................V.D.GK.......F.P..A..A......AV....T.V.D.ATGg...................................................................................ptTS.G..EFDR..K.A..TFT.....G............L..QENT.AYS.......Y..RV...............GTP...G-.................................SWS.P.T..STFRT............................................
C5XMG6_SORBI/208-311                   .................................................plyg----HLSS.....TD.sT....AT.....SM.RLTWV..S...G...............................................................................D................R-..RPQ..............QV.Q..Y.GVG.....K.SA...........................................T.S.QV.......A.T..F..T......QN....D.M.C.SSPllpsp...........................................................................akdfgwHD.P..GYIH..T.A..VMT.....G............L..QPSQ.SYT.......Y..RY...............GSD...SV.................................GWS.S.T..NKFR-m...........................................
A0A380NLM6_9FIRM/53-149                ..................................................plh---IRQLV.....TP.dM....ST.....RR.IILWE..T...K...............................................................................E................LQ..ANS..............II.K..Y.KIK.....G.SSd.........................................dT.I.QT.......V.Y..A..V......SE....M.F.E.-DD......................................................................................KE.K..RYIY..R.V..DLR.....D............L..EPNQ.DYV.......Y..QV...............GRE...GY.................................TDD.E.W..HSLSTka..........................................
A0A1H4DZI4_ALKAM/41-137                .....................................................PDRIVLIP.....TT.tP....AS.....SQ.SIHWR..T...H...............................................................................A................DV..GVA..............KA.Q..L.ARA.....I.DGpg.......................................mhR.A.MK.......T.E..L..S......QV....T.A.V.YSD......................................................................................NG.K..AHQH..K.V..TFD.....Q............L..EPDT.LYA.......Y..RV...............QGL...G-.................................TWS.E.W..FQFKT............................................
A0A0R0AZW9_9GAMM/39-134                .....................................................PDRIVASP.....AQ.dA....AH.....GF.AVAWR..T...D...............................................................................A................TV..RAP..............QL.Q..I.VVA.....G.DSpd.......................................vgK.P.RV.......V.N..A..R......TQ....E.L.R.-SE......................................................................................NG.T..SLHH..R.A..DID.....G............L..QPDT.LYA.......Y..RV...............QGK...D-.................................TWS.A.W..NHFRT............................................
A0A177URJ3_9BASI/32-132                .....................................................PVQQRISL.....SA..-....PD.....SV.VVGWN..T...F...............................................................................Q................KL..AQP..............CV.S..F.GRT.....A.DN...........................................L.N.QT.......A.C..S..S......NS....V.T.-.-YK......................................................................................TS.R..TWAN..T.V..TLP.....G............L..NPAT.SYY.......Y..KI...............NST...NS.................................---.S.-..-----iipfksaqqagdkrpftfat........................
A0A1A6HIW6_NEOLE/4-96                  ..................................................pal---IPLSP.....GE..-....PG.....SM.TVTWT..T...W...............................................................................A................P-..ARS..............EV.Q..F.GMH....xS.GS...........................................L.P.FR.......A.H..G..T......TS....T.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.HYV.......Y..RC...............GSS...Q-.................................GWS.R.R..FRFT-a...........................................
A0A3S3R5K4_9MAGN/55-147                .....................................................PQQVHITQ.....GD.hI....GR.....SV.IVSWV..T...P...............................................................................S................EP..GTN..............II.Q..Y.GKV.....H.NK...........................................T.E.FE.......A.H..C..N......EV...vT.Y.K.FYN......................................................................................YT.S..GFIH..H.C..TIH.....N............L..QYNT.RYF.......Y..QL...............GSG...E-.................................-VT.R.Q..FHFKT............................................
A0A3L6T8K7_PANMI/149-254               .....................................................PEQVHLAF.....AD..A....VD.....EM.RVMFL..C...G...............................................................................D................G-..GKR..............VV.R..Y.GLQ.....K.DDe.........................................kG.W.KE.......V.G..T..E......VR....T.Y.E.QKHmcdgpa..........................................................................nssvawRD.P..GFVF..D.G..LMK.....G............L..EPGR.RYF.......Y..KV...............GSD...TG.................................GWS.E.T..YSF--is..........................................
A0A1Q3BZ96_CEPFO/63-154                .....................................................PQQVHITQ.....GD.hV....GK.....GV.IITWI..T...P...............................................................................D................EP..GSS..............TV.I..Y.WAE.....N.SD...........................................L.K.NY.......A.T..G..I......VL....K.Y.K.YFD......................................................................................YT.S..GYIH..H.C..TIT.....D............L..EFDT.KYY.......Y..EI...............GTG...N-.................................-AT.R.H..FRF--vt..........................................
A0A453L801_AEGTS/212-320               ..................................................pvy---PRLAL.....GK..T....WN.....KM.TVTWT..S...G...............................................................................Yg..............iSE..AHP..............FV.E..W.GMK.....G.SH...........................................P.V.HA.......A.-..A..D......TV....T.F.G.RESlcgep...........................................................................arsvgwRD.P..GFIH..T.A..FLK.....N............L..SPEK.EYY.......Y..KI...............GHRl.rNGq...............................vIWG.K.P..KSFR-a...........................................
A0A1S3AW88_CUCME/65-176                .....................................................PEQISLAI.....ST..-....PT.....SM.WVSWV..T...G...............................................................................Daqigkn....vtaldpSS..VAS..............EV.W..Y.GKK.....S.RK...........................................Y.T.SM.......R.R..G..V......ST....V.Y.S.QLYpfe...............................................................................gllnYT.S..GIVH..H.V..RID.....G............L..EPET.KYY.......Y..QC...............GDS...SI................................pALS.K.E..HMFET............................................
G7JA61_MEDTR/71-183                    .....................................................PEQISLSL.....ST..S....HD.....SV.WISWI..T...G...............................................................................Efqigen....iepldpET..VDS..............IV.Q..Y.GRF.....G.RS...........................................M.N.VQ.......A.V..G..Y......SL....V.Y.S.QLYpfe...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPNT.LYQ.......Y..QC...............GDP...SL................................pAMS.D.V..HYFRT............................................
A0A1S8TMI9_9CLOT/52-140                ..................................................hte---MSLAP.....GR..D....ET.....QL.NFAWY..S...K...............................................................................G................RD..AKP..............SL.K..F.GKK.....N.DL...........................................S.D.AR.......E.I..-..-......-S....V.T.H.ESA......................................................................................TN.G..YISN..K.A..TVT.....N............L..DEQT.NYY.......Y..SY...............QIY...G-.................................KWS.E.A..-----ipyts.......................................
A0A087STP1_AUXPR/149-255               ...................................................lt--GIHLMP.....GH..R....PV.....DM.LVQWT..T...R...............................................................................D................V-..GEP..............FV.R..F.GTA.....P.DD...........................................L.R.FA.......I.P..A..T......TE....T.Y.S.RREmcgip...........................................................................asgagwVD.P..GALH..T.A..VMA.....G............L..TPDT.RYY.......Y..VV...............GDA...QGap.............................heRTS.A.P..RSF--ls..........................................
A0A067DIL4_CITSI/86-198                .....................................................PEQISVSL.....SS..A....HD.....SV.WISWI..T...G...............................................................................Efqignn....lkpldpKS..VVS..............VV.R..Y.GTR.....R.SQ...........................................L.N.RK.......A.T..G..R......SL....V.Y.S.QLYpfl...............................................................................glqnYT.S..GIIH..H.V..RLT.....G............L..KPDT.LYH.......Y..QC...............GDP...SI................................pAMS.G.T..YCFRT............................................
A0A0D3HIB6_9ORYZ/56-143                .....................................................PEQVHISA.....VG..-....SD.....KM.RVTWI..T...G...............................................................................G................D-..APA..............TL.E..Y.GTT.....S.GQ...........................................Y.P.FS.......A.T..G..S......TN....T.Y.S.YVL......................................................................................YH.S..GNIH..D.V..VIG.....P............L..QPST.TYF.......Y..RC...............SND...T-.................................--S.R.E..LSFRT............................................
M4EDN0_BRARP/178-286                   ..................................................pvy---PRLAL.....GK..E....WD.....TM.TVTWT..S...G...............................................................................Yg..............lKI..AEP..............VV.E..W.GVK.....G.GE...........................................R.K.LS.......P.A..G..T......LT....-.F.A.RNTmcgap...........................................................................artvgwRD.P..GYIH..T.A..FLK.....E............L..WPNA.KYT.......Y..RV...............GHR..lTNd..............................afVWS.K.E..YQFK-s...........................................
A0A0L9TR24_PHAAN/53-144                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................D................EP..GPS..............HV.Q..Y.GTS.....K.SR...........................................L.R.TS.......K.E..G..T......VA....N.Y.T.FYN......................................................................................YK.S..GYIH..H.C..LVE.....G............L..KYNT.KYY.......Y..RI...............GSG...DS.................................--A.R.D..FW---fet.........................................
A0A1W4UNP3_DROFC/34-137                .....................................................PEQVHLAF.....GE.rT....DS.....EI.VVTWS..T...R...............................................................................S................LP..PDPevg........aasVV.E..F.GQL.....V.AGq........................................anL.N.QQ.......S.R..G..I......AT....K.F.V.DGGh....................................................................................kQA.S..QFIH..R.V..TLS.....D............L..KPNT.TYA.......Y..HC...............GSD...F-.................................GWS.A.I..FQFRT............................................
A0A495W1Y4_9PSEU/46-136                ....................................................v-SRLILTP.....TA.tP....AD.....SQ.SFTWR..S...T...............................................................................T................A-..GGG..............TV.Q..V.RPV.....G.GA...........................................P.V.DV.......A.-..A..T......AV....D.T.S.NLA......................................................................................GV.D..YVHY..S.A..TAT.....G............L..TADT.AYE.......Y..RV...............GGG...E-.................................RWS.R.W..RPFR-s...........................................
Q6ZI95_ORYSJ/177-288                   .................................................pvyp----RLAQ.....GK..S....YD.....EM.TVTWT..S...G...............................................................................Yd..............iSE..AYP..............FV.E..W.GMV.....V.AGa........................................aaP.T.RT.......A.A..G..T......L-....T.F.N.RGSmcgep...........................................................................artvgwRD.P..GFIH..T.A..FLR.....D............L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.K.Q..YTFR-a...........................................
A0A1S1MQ45_9GAMM/25-111                ............................................sfhvtpflq--------.....TA..S....PT.....SM.WISWE..T...S...............................................................................G................G-..DES..............VV.L..W.GTS.....T.A-...........................................L.S.MQ.......T.A..G..T......SK....K.-.-.--G......................................................................................NL.L..SRIH..E.V..QLT.....E............L..QPDT.VYY.......Y..RV...............KTG...D-.................................ALS.D.I..HSFRT............................................
R7C6Z3_9CLOT/1-91                      ....................................................m------TP.....GA..T....EK.....DL.NFCWY..S...K...............................................................................T................K-..GLA..............KV.K..L.GKK.....E.DL...........................................S.D.AK.......V.Y.dG..T......VT....D.I.N.RSNs....................................................................................vET.Y..KASN..K.V..SIK.....G...........aL..EKNT.TYY.......Y..SY...............SND...GT.................................TWS.K.A..EKYQT............................................
A0A397YVR5_BRACM/176-284               ..................................................pvy---PRLAL.....GK..E....WN.....EM.TVTWT..S...G...............................................................................Yg..............pDV..AEP..............VV.E..W.GIK.....G.GK...........................................R.K.L-.......S.P..A..R......TL....T.Y.G.RNDlcgpp...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPSS.KYT.......Y..KV...............GHR..lSNg..............................afIWS.K.E..YHFK-s...........................................
A0A2B4RMF1_STYPI/20-120                .....................................................PEQIHISS.....TG..D....PT.....EM.MITWV..T...M...............................................................................A................ES..VKS..............VV.E..Y.GER.....L.KL..........................................pL.N.KK.......A.F..G..S......AT....K.Y.K.ACGw....................................................................................kKR.I..IYMH..R.V..KLE.....E............L..TPGS.GYE......eY..NV...............KS-...--.................................---.-.-..-----yfqaslfassnfsnyre...........................
A0A445HIX3_GLYSO/217-319               .................................................plyg----HLSS.....ID.sT....GT.....SM.RLTWV..S...G...............................................................................D................K-..EPQ..............QI.Q..Y.GNG.....K.TV...........................................A.S.AV.......T.T..F..S......QD....-.-.-.--Dmcssalp.......................................................................spakdfgwHD.P..GYIH..S.A..LMT.....G............L..KPSS.TFS.......Y..RY...............GSG...WV.................................GWS.E.Q..IKFST............................................
A0A2T7DWR8_9POAL/147-252               .....................................................PAQLHLAF.....TD..E....AD.....EM.RVMFV..C...G...............................................................................D................D-..GRR..............FV.R..Y.RPA.....G.LR...........................................E.E.QW.......E.E..S..P......TV....A.T.T.YERrhmcdyp........................................................................andsvgwRH.P..GFVF..D.G..VMK.....G............L..QPGR.RYL.......Y..KV...............GSD...SG.................................GWS.E.T..YSF--is..........................................
A0A0D2U3R3_GOSRA/58-149                .....................................................PQQVHITQ.....GD.mD....GS.....GV.IISWI..T...P...............................................................................D................EP..GSN..............MV.Y..Y.WSE.....N.SN...........................................H.K.YK.......A.E..G..I......FV....R.Y.K.FFN......................................................................................YT.S..GYIH..H.C..TIN.....N............L..EYNT.KYM.......Y..EI...............GRG...DS.................................---.-.-..-----irqfwfvt....................................
A0A383VVS5_TETOB/161-263               .....................................................PLQRHLAL.....TG..D....NT.....QM.MVQWV..T...K...............................................................................N................S-..SNP..............TV.K..W.GTS.....P.GA...........................................Y.N.HS.......A.A..A..V......SS....T.Y.S.RQElcgpp...........................................................................andagfVD.P..GLFH..A.A..LVE.....G............L..TPGQ.RYY.......Y..VV...............GDE...EW.................................GFS.P.E..ASF--va..........................................
A0A162J1R6_9PEZI/70-173                ........................................nnvnvialayvpg--------.....--..-....--.....GI.NIHYQ..T...P...............................................................................F...............gLG..AAP..............AV.Q..W.GTS.....A.AA...........................................L.V.HT.......A.T..G..Q......TH....S.Y.D.RTPpcsl.............................................................................vaaitQC.S..QYYH..E.V..QLT.....G............L..QADT.TYY.......Y..RI...............PAA...NG................................tTAS.D.V..RTFTT............................................
A0A1V6TN32_9EURO/78-168                .....................................................PFQRRLAV.....YG..-....PN.....AV.SVGWN..T...Y...............................................................................E................KL..NQT..............CV.L..Y.GTS.....A.DK...........................................L.S.SR.......S.C..G..S......KA....S.S.T.-YE......................................................................................TS.R..TWSN..V.A..VLN.....N............L..TPAT.TYY.......Y..KI...............VST...N-.................................--S.T.V..DHF--msprt.......................................
Q0AVJ0_SYNWW/46-138                    .....................................................PEQIILSW.....TS.dP....LS.....SQ.TITWL..G...A...............................................................................D................D-..SLG..............QL.Q..Y.QAK.....S.SF...........................................N.G.SF.......D.S..A..Q......QV....K.A.E.ATK.....................................................................................fDS.R..YYHY..S.I..NIR.....N............L..TPDT.DYI.......Y..RL...............GKE...G-.................................CWT.E.P..YFFST............................................
J3NEE8_ORYBR/176-284                   .................................................pvyp----RLAQ.....GK..S....WN.....EM.TVTWT..S...G...............................................................................Ys..............iKE..AMP..............FV.E..W.GHK.....G.GS...........................................L.T.LS.......P.A..G..T......L-....T.F.S.RNSmcgsp...........................................................................artvgwRD.P..GYIH..T.S..FLK.....E............L..WPDT.LYT.......Y..RLvh...........rlQDG...TH.................................IWS.K.S..YSFR-a...........................................
A0A3B6B726_WHEAT/153-244               .....................................................PQQVHIST.....VG..-....RD.....KM.RISWV..T...D...............................................................................D................RS..TPS..............VV.E..Y.GES.....R.GN...........................................Y.T.AS.......A.T..G..D......HA....T.Y.K.YFF......................................................................................YE.S..GAIH..H.V..TIG.....P............L..APGT.TYH.......Y..RC...............GKA...GD.................................---.-.-..-----eltlrtppas..................................
A0A317ZPG2_9BACT/194-288               .....................................................PSQIRLIW.....VD.dP....ST.....TM.TVGWT..H...G...............................................................................G................G-..SDA..............TV.H..Y.GSR.....D.KG...........................................Q.K.PE.......A.Y..R..F......ST....S.V.D.RTIa...................................................................................ysGG.E..IVSK..F.A..RLT.....G............L..KPDT.AYY.......F..VL...............SDD...S-.................................GVS.P.R..YYFRT............................................
A0A445LE90_GLYSO/100-187               .....................................................PQQVHISL.....VG..-....KE.....KM.RVSWI..T...E...............................................................................D................KH..TES..............VV.E..Y.GTK.....A.GE...........................................Y.R.EK.......A.T..G..L......HT....S.Y.Q.YFL......................................................................................YN.S..GKIH..N.V..VIG.....P............L..QPGT.TYF.......Y..RC...............GGS...G-.................................---.P.D..FSFKT............................................
A0A2P6PPR6_ROSCH/66-156                .....................................................PEQVHITQ.....GD.qL....GK.....AV.IVSWV..T...V...............................................................................D................EP..GSS..............KV.L..Y.WSA.....N.SK...........................................K.-.KT.......A.V..G..K......FY....T.Y.K.YYN......................................................................................YS.S..PYIH..H.A..TVR.....N............L..EYNT.KYY.......Y..EV...............GIG...H-.................................-TK.R.Q..FWF--vt..........................................
A0A1X1R9G3_9MYCO/57-150                ...................................................va--GLHLQF.....GG.dA....AT.....EV.VVSWH..T...V...............................................................................D................AV..RNP..............RV.M..L.GTP.....A.SG...........................................F.G.RV.......V.A..A..E......TR....T.Y.R.DAK......................................................................................SGiE..VRVN..H.A..RLT.....G............L..MPDT.DYV.......Y..AA...............MHD...G-.................................AEP.E.T..GTVRT............................................
A0A2V5I7F7_9EURO/33-122                .....................................................PYQQRLAI.....MG..-....PT.....AV.SIGWN..T...Y...............................................................................E................KL..NSS..............CV.E..Y.GTS.....S.ND...........................................L.S.QQ.......A.C..S..T......KS....T.T.-.-YA......................................................................................TS.R..TYSN..A.V..TLT.....G............L..TPAT.TYY.......Y..RI...............VSG...N-.................................--S.T.V..ER---flsprt......................................
F7BW71_CALJA/32-125                    .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A178IM58_9BACT/242-344               .....................................................PDNILLTW.....TD.eP....DT.....TQ.TIRWR..T...N...............................................................................A................AT..TRG..............AL.A..L.AEG.....K.SSpik....................................igraQ.-.-K.......I.A..A..T......TE....E.F.V.TNDi...................................................................................anDP.V..IHLH..T.V..RLT.....G............L..KPDT.TYT.......Y..TI...............GDD...TD................................aGWI.K.P..VEFTT............................................
A0A498JUN8_MALDO/54-144                .....................................................PQQVHITQ.....GD.qE....GT.....AM.IVSWI..T...P...............................................................................D................EP..GSS..............VV.L..F.WSD.....K.HK...........................................-.T.KK.......A.E..G..K......AK....Q.Y.K.YHD......................................................................................YT.S..GYIH..H.C..TIR.....K............L..EHNT.KYY.......Y..KI...............GIG...Q-.................................-AE.R.T..FWF--vt..........................................
A0A226DQZ9_FOLCA/47-144                .....................................................PRHVHIAY.....GN.sP....TT.....KM.VVTWS..T...V...............................................................................Dwp............egGD..VTP..............FV.E..W.GTR.....L.PW...........................................Q.G.RT.......N.G..S..T......TR....F.V.D.TGD.....................................................................................lHL.A..QFIH..R.V..TLT.....D............L..QPHT.SYI.......Y..HC...............GSS...E-.................................GIS.E.L..FGFTT............................................
F4KTN8_HALH1/29-118                    ..................................................vqp----YLQF.....ST..-....QT.....GM.YVLWE..T...K...............................................................................E................P-..ATT..............LV.Q..F.GEA.....R.SN...........................................V.D.QV.......V.L..D..R......EV....R.L.-.---......................................................................................EG.Q..RLMH..E.V..LLD.....N............L..KPET.NYF.......W..QV...............TTV...TQsg.............................erIQT.P.V..YTFKT............................................
A0A195ESY8_9HYME/25-116                .....................................................PEAVHLSY.....GD..N....IH.....DI.VVTWS..T...K...............................................................................N................DT..KES..............IV.E..Y.GIG.....G.FI...........................................L.R.AE.......G.N..S..T......LF....V.D.G.GEK......................................................................................KR.K..QYIH..R.V..WLK.....N............L..TPNS.KYI.......Y..HC...............GSR...Y-.................................GWS.N.V..FYMRT............................................
A0A1J4N2H5_9ACTN/52-140                ...................................................aa--GVHLSY.....GT.nP....LR.....QM.NVTWS..T...A...............................................................................G................SV..QAP..............RL.D..L.GVT.....P.DY...........................................G.L.TL.......Q.P..E..S......VS....S.-.-.--I......................................................................................RV.D..SVYH..H.V..DLS.....D............L..RPGT.RYY.......Y..RL...............SHD...G-.................................GTP.T.R..GSFTT............................................
A0A1I4PGB1_9BACI/474-582               .....................................................PISIALSF.....YG.dP....KT.....QR.SFAWY..T...N...............................................................................H................ED..PENapen......vldsIV.E..V.VQA.....G.ESfd.......................................sdN.V.LR.......F.T..G..E......SQvldlK.I.T.NAQ......................................................................................NG.M..FASH..K.V..LAE.....D............L..EPNT.AYQ.......Y..RL...............GSE...G-.................................NWS.E.I..GEFKT............................................
A0A3B6SP24_WHEAT/86-177                .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...A...............................................................................L................EP..TRS..............EV.F..Y.GEQ.....E.KH...........................................Y.D.RK.......A.K..G..R......MT....N.Y.T.FYD......................................................................................YR.S..GYIH..H.C..LVD.....S............L..EYNT.KYY.......Y..KI...............GTG...D-.................................-SA.R.E..FWFQT............................................
W9R991_9ROSA/54-165                    .....................................................PEQIALAI.....SS..-....PT.....SM.WVSWV..T...G...............................................................................Daqigln....vtpldpKT..VAS..............EV.W..Y.GKK.....S.GK...........................................Y.T.NV.......Q.R..G..I......ST....V.Y.S.QLYpfk...............................................................................gllnYT.S..GIIH..H.V..KLD.....G............L..EPGT.KYF.......Y..KC...............GDS...SF................................qALS.K.V..HSFE-s...........................................
A0A2K5WEP7_MACFA/32-125                .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
A0A067S7A9_GALM3/38-128                .....................................................PVQVRLAY.....AG..-....PT.....GM.QISWN..T...F...............................................................................S................KL.pSAP..............TV.R..Y.GFT.....P.SF...........................................L.P.FVs....spE.N..A..E......SV....T.Y.A.---......................................................................................TS.L..TFSN..H.V..RLV.....H............L..FPNT.NYY.......Y..QP...............VHA...N-.................................-SS.V.V..YSFKT............................................
A0A2H3YLJ6_PHODC/74-186                .....................................................PEQIALAA.....SY..S....PT.....SM.WVSWV..T...G...............................................................................Daqigkn....vtpmdpST..VAS..............VV.W..Y.GEE.....S.GK...........................................Y.N.FV.......K.R..G..T......AT....V.Y.S.QLYpfe...............................................................................gllnYT.S..AIIH..H.V..RLE.....G............L..KPGK.RYY.......Y..KC...............GDS...SL................................kVLS.K.E..HTFET............................................
A0A1S3UE64_VIGRR/74-185                .....................................................PEQIALAI.....SS..-....PT.....SM.WVSWV..T...G...............................................................................Daqigln....vtpvdpAS..IGS..............EV.W..Y.GKE.....S.GK...........................................Y.T.SV.......G.K..G..D......SV....V.Y.S.QLYpfe...............................................................................glwnYT.S..GIIH..H.V..KLE.....G............L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.Q.E..RFFET............................................
A0A194RHJ9_PAPMA/33-124                .....................................................PEQVHISF.....GE..K....TN.....DI.VATWS..T...F...............................................................................N................DT..GES..............RA.Q..Y.GVG.....Q.MD...........................................Q.E.AS.......G.R..S..T......LF....V.D.G.GHE......................................................................................RR.A..QFIH..R.V..LMK.....D............L..KHDT.TYV.......Y..HV...............GSE...F-.................................GWS.E.E..FWFKT............................................
A4JNY0_BURVG/94-190                    .....................................................PEQVHLTW.....GN.dP....SS.....EV.AISWA..S...L...............................................................................A................PA..VNP..............RA.R..I.VAD.....G.EP...........................................A.-.RT.......V.H..G..V......QR....I.Y.T.DGL.....................................................................................nGE.T..VFTY..H.A..RVH.....G............L..KPNT.RYR.......Y..EL...............TAD...ND.................................---.-.-..-----snaaqpfaatfat...............................
J1K108_9RHIZ/72-218                    .....................................................PNRITSTL.....KE.pT....DT.....SR.SFRWF..T...S...............................................................................E................EA..QSP..............VV.R..I.DTH.....K.DM..........................................kN.A.QS.......F.P..A..Q......TK....I.V.N.SHFlernedgffiykviddkntvvryftd..................................agiddvkwepknevknknetvaidiiPV.K..EITY..S.A..DIQ.....G............L..NPGT.VYY.......Y..QV...............GDE...NG.................................ELS.D.V..GQFKT............................................
D7MHN1_ARALL/53-144                    .....................................................PQQVHITQ.....GD.yD....GK.....AV.IISWV..T...P...............................................................................D................EP..GSS..............KV.Y..Y.GAV.....Q.GK...........................................Y.E.FV.......A.E..G..T......YH....N.Y.T.FYK......................................................................................YK.S..GFIH..H.C..LVS.....G............L..EHDT.KYY.......Y..KI...............ESG...D-.................................-SS.R.E..FWFVT............................................
A0A1G6JIF4_9ACTN/54-152                .....................................................PDRVILTP.....TA.tP....AT.....SQ.SVTWR..T...S...............................................................................S................EV..STA..............QA.Q..I.APM.....A.PG...........................................P.D.FE.......S.A..A..L......TI....N.A.P.AVEaiq................................................................................adlGF.P..VKFH..S.V..TFA.....D............L..APDT.EYL.......Y..RV...............GDG...V-.................................NWS.A.W..YEFET............................................
A0A1H6YE31_9BACT/41-137                .....................................................PDRVILGF.....KG.nP....AF.....SQ.AVNWR..T...D...............................................................................S................TV..LEA..............VA.A..I.HEA.....D.PS...........................................P.D.FQ.......K.N..A..K......LI....K.A.K.TQQve..................................................................................idGR.L..VNYH..E.V..DFT.....D............L..KPAT.QYV.......C..RV...............GNG...T-.................................QWS.E.W..YHFKT............................................
A0A2R8MNE9_CALJA/32-125                .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..TRS..............EV.Q..F.GLQ.....P.SG..........................................pL.P.LR.......A.Q..G..T......FV....P.F.V.DGGi....................................................................................lRR.K..LYIH..R.V..TLR.....K............L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R.R..FRFR-a...........................................
M1BIV5_SOLTU/218-320                   .................................................plyg----HLSS.....ID.sT....AT.....SM.RVTWV..S...G...............................................................................D................K-..APQ..............QL.Q..Y.GEG.....K.SQ...........................................T.S.QV.......S.T..F..T......QK....D.M.C.S-Silksp...........................................................................akdfgwHD.P..GFIH..S.A..IMT.....G............L..NPST.TNS.......Y..TY...............GSD...SS.................................GWS.E.K..ITFKT............................................
A0A135LQ40_PENPA/21-108                .....................................................PFQQRLAV.....YG..-....PD.....AV.SVGWN..T...F...............................................................................A................QL..KQS..............CV.H..Y.GLS.....E.KN...........................................L.N.TK.......A.C..S..S......SS....T.T.Y.--D......................................................................................PS.R..TWSN..V.A..ILT.....G............L..TPAT.TYY.......Y..KI...............EST...N-.................................--S.T.V..GHF--lsp.........................................
A0A2G9IAZ2_9LAMI/60-149                .....................................................PQQVHISL.....AG..-....DK.....HM.RISWV..T...S...............................................................................D................KH..SPS..............VV.E..Y.GTS.....P.KN...........................................Y.C.FS.......S.R..G..E......ST....T.Y.S.YLL......................................................................................YS.S..GKIH..H.T..VIG.....P............L..EDDT.LYF.......Y..RC...............GGK...G-.................................---.P.-..-----efqlktpp....................................
A0A0F4Z5N0_TALEM/29-116                .....................................................PMQIRLAY.....AG..-....ST.....GM.VVSWN..T...Y...............................................................................S................KL..DRP..............TV.R..Y.GLT.....P.WA...........................................L.T.KT.......A.S..S..N......VS....V.T.-.-YP......................................................................................TS.T..TYNN..H.V..TIT.....G............L..EPDT.VYY.......Y..QP...............QNS...N-.................................-SS.V.P..YSFKT............................................
A0A1Q3C7H5_CEPFO/214-317               .................................................plyg----HLSS.....ID.sT....GT.....SM.RLTWV..S...G...............................................................................D................N-..QPQ..............QL.Q..Y.GDG.....I.TE...........................................T.S.VV.......N.S..F..S......QD....-.-.-.--Dmcssallp......................................................................spakdfgwHD.P..GYIH..S.A..VMT.....G............L..EPSS.SFS.......Y..RY...............GSD...LV.................................GWS.D.T..ITFKT............................................
Q9VZ57_DROME/38-131                    .....................................................PEQVHLSF.....GE..T....VL.....DI.VVTWN..T...R...............................................................................D................NT..NES..............IC.E..F.GID.....G.LH...........................................Q.R.VK.......A.T..Q..M......PT....K.F.V.DGGa....................................................................................kKA.T..QYIH..R.V..TLS.....H............L..KPNS.TYL.......Y..HC...............GSE...L-.................................GWS.A.T..YWFRT............................................
A0A072VTY2_MEDTR/194-297               .................................................plyg----HLSS.....ID.sT....AT.....SM.RLTWV..S...G...............................................................................D................K-..EPQ..............QV.Q..Y.GDG.....K.TV...........................................T.S.EV.......T.T..-..-......--....-.F.S.QDDmcssvvlp......................................................................spakdfgwHD.P..GFIH..S.A..IMK.....G............L..EPSS.TYS.......Y..RY...............GSN...SV.................................DWS.E.Q..IKFST............................................
A0A238UBZ3_9FLAO/22-113                ..................................................dky----RLTL.....RD.dP....AT.....TI.VIGWN..Q...I...............................................................................S................G-..SNP..............RV.Y..Y.GTT.....D.YG..........................................tD.Y.SR.......Y.N..F..S......MA....P.T.K.AVS......................................................................................YK.G..MNNH..F.A..RLT.....G............L..QPNT.AYY.......F..VI...............RDS...Q-.................................GTS.R.R..LWFKT............................................
A0A146FAQ4_9EURO/70-173                ..........................................nnvnvislsyi--------.....--..-....PK.....GM.HIHYQ..T...P...............................................................................F...............gLG..QLP..............AV.R..W.GKD.....P.RN...........................................L.N.ST.......A.Q..G..Y......SH....T.Y.D.RTPscsq.............................................................................vkavtQC.S..QFFH..E.V..SID.....S............L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.E.V..LSFKT............................................
A0A1S3HBI2_LINUN/1-78                  .....................................................--------.....--..-....--.....-M.VVTWV..T...L...............................................................................S................QT..NSS..............LV.E..Y.GIR.....S.LE...........................................N.A.AK.......G.S..E..T......MF....Q.D.G.GSE......................................................................................HR.K..LYIH..R.V..TVT.....G............L..KPGQ.KYM.......Y..HC...............GSQ...Y-.................................GWS.S.L..FTFT-a...........................................
L5KMS2_PTEAL/35-128                    .....................................................PEQVHLSY.....PG..E....PG.....SM.TVTWT..T...W...............................................................................V................P-..THS..............EV.Q..F.GMQ....lT.GP...........................................L.P.LR.......A.Q..G..T......VS....P.F.V.DGGl....................................................................................lRR.K..LYMH..R.V..TLR.....G............L..LPGV.QYV.......Y..RC...............GSS...R-.................................GWS.R.R..FRFR-a...........................................
A0A1J6J0Z1_NICAT/168-276               .................................................pvyp----RLAQ.....GK..A....WN.....EM.TVTWT..S...G...............................................................................Yd..............iNE..AEP..............FV.E..W.GRQ.....G.GQ...........................................Q.T.RS.......P.A..G..T......L-....T.I.D.RSSlcgap...........................................................................artvgwRD.P..GFIH..T.S..FLK.....E............L..WPNS.VYT.......Y..KL...............GHKl.fNGt...............................yIWS.Q.M..YKFK-s...........................................
A0A1R3HVI2_COCAP/58-149                .....................................................PQQVHITQ.....GD.hV....GK.....AV.IVSWV..T...E...............................................................................D................EP..GSN..............TV.L..Y.WKK.....G.SD...........................................E.K.KK.......A.E..G..K......VT....S.Y.K.YYN.......................