GenomeNet

Database: Pfam
Entry: RecG_N
LinkDB: RecG_N
Original site: RecG_N 
#=GF ID   RecG_N
#=GF AC   PF17190.4
#=GF DE   RecG N-terminal helical domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Jackhmmer 1gm5:a:7-105
#=GF GA   22.60 22.60;
#=GF TC   37.10 37.10;
#=GF NC   22.50 22.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11595187
#=GF RT   Structural analysis of DNA replication fork reversal by RecG.
#=GF RA   Singleton MR, Scaife S, Wigley DB;
#=GF RL   Cell. 2001;107:79-89.
#=GF DR   INTERPRO; IPR028993;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This four helical bundle domain is found at the N-terminus of
#=GF CC   bacterial RecG proteins [1].
#=GF SQ   16
#=GS H2J3K2_MARPK/2-89      AC H2J3K2.1
#=GS I2F2W7_9BACT/2-89      AC I2F2W7.1
#=GS Q9WY48_THEMA/21-100    AC Q9WY48.1
#=GS Q9WY48_THEMA/21-100    DR PDB; 1GM5 A; 21-100;
#=GS A8F350_PSELT/8-95      AC A8F350.1
#=GS A0A0G2Z4E9_9BACT/2-90  AC A0A0G2Z4E9.1
#=GS C5CH96_KOSOT/2-90      AC C5CH96.1
#=GS H9UCW4_FERPD/3-88      AC H9UCW4.1
#=GS A0A101IHP4_9BACT/2-90  AC A0A101IHP4.1
#=GS B7IF88_THEAB/2-81      AC B7IF88.1
#=GS A0A1E3G4A6_9BACT/3-88  AC A0A1E3G4A6.1
#=GS A7HLT6_FERNB/3-88      AC A7HLT6.1
#=GS A0A1M7SM59_FERGO/3-88  AC A0A1M7SM59.1
#=GS F7YTD9_9THEM/5-93      AC F7YTD9.1
#=GS A0A1G6MV58_9BACT/4-90  AC A0A1G6MV58.1
#=GS A0A1B0VJT4_FERIS/3-88  AC A0A1B0VJT4.1
#=GS A6LJ12_THEM4/6-85      AC A6LJ12.1
H2J3K2_MARPK/2-89                 .NIEDFFNGLEAKLKDALKEKLKWEYLFKELYK-YSANYINIIEQEKGLKEKIGSFLGYYKPIANLSDERRIKRALNGLELIEKLKYEYL
I2F2W7_9BACT/2-89                 .LLEQFLEECERLLEAHLSGKRE-DNVLPELKRFLSLLDRSELSHFSSLGEYLSKFISYLSRIDEFPHDRKVKRLKNGLEMIAKLRNFFL
Q9WY48_THEMA/21-100               .LLEEFLNEVEKMLKNQVNTRR--------IHQLLKELDDPLLENKDLE-EKLQAFLDYVKEIPNLPEARKRYRIQKSLEMIEKLRSWFL
#=GR Q9WY48_THEMA/21-100    SS    .SHHHHHHHHHHHHTS---TTT--------HHHHHHH---GGGG-HHHH-HHHHHHHHHHTTSSSS-HHHHHHHHHHHHHHHHHHHHHHS
A8F350_PSELT/8-95                 .LVEEFLDFLEQSLLEVLHGKKGTNELVEEVQDRYELVADHVLQNSEIL-EKFKQLFEYIEPVADMQPERAIKRVKNSLGMIERFRDWYL
A0A0G2Z4E9_9BACT/2-90             .LFEEFLIACEEQLEGFLASKLPPSALFEELKRLARYIDPEEFKSFPSLKEYLTPFLHYYSVFQNLPPERQRKRAENGFKMIQKMRKLFL
C5CH96_KOSOT/2-90                 .LLEDYLDRCEKLLEKFLSGKVDTIELIQEIKRGAELLEPEELSANEGLKDYIGKFVSYYLPLASLPNERQHLRVKNGFTMINKLRGKFL
H9UCW4_FERPD/3-88                 .LIEEFLDNCYEISREISEEAL--NALIEYIEDNYERIDDPLLSDVEIQ-VKLEEFRNYIIEAKKLPTHRALKRLSHVRGMVERFKYNFL
A0A101IHP4_9BACT/2-90             .LLEDFLTSVENLFSHFDLENDSMKELVSKITDMASKIERDEFVDSPELHDYLSRFISYYSAAQSLPEPRTLRRLKNYRILIHKLAMRFL
B7IF88_THEAB/2-81                 .LIEDFLDEILNIKDH--------KALIEYVEDNFEKIDDPLKEDPEVF-KRLQEFYTYIVEMKNLPERRIQKRLSYIPGMVKRFKLMHL
A0A1E3G4A6_9BACT/3-88             .LIEEFLDNCYELARKISEENL--RALIEYVEESVDRIDDPLLSDPVVQ-KKIQDFADYITKAKDLPIERGLRRLSNVPGMVERFKNEHL
A7HLT6_FERNB/3-88                 .LIEEFLDNCYQIAKKIEETSL--NELIEYIEDNFDKIDDPLLLDNEIK-QKLSEFTEYILSSKKLPIERALKRLQQVSGMVERFKYNYL
A0A1M7SM59_FERGO/3-88             .LIEEFMDNCYELSGDITENNL--KALIEYIDDNFERIDDPLLSDFVVR-KKLEEFRDYIVSAEKLPTQRVLNRLSQVRGMVERFKYNYL
F7YTD9_9THEM/5-93                 .LVEEFLEEFETVIKKVQNKELSVKDLENFIGSKLNLIHDPLLELEPVAQERFNQMIDYAKPIASLPPERAAVRLKNLLSMVEKYRNWFL
A0A1G6MV58_9BACT/4-90             d-LESYIKEIENILRQKDKNIKSWDDIYPSFIS-LSKKNASLIKINNME-EDIKKILSYVKPLGILDTERKNKRLKGLKDAVLKLKEKYL
A0A1B0VJT4_FERIS/3-88             .LVEEFLDNCYEIARDVSEESF--NALVEYIEDNYERIDDPLLFEDEIR-SKLEDFKNYIIEAKKLSTERALKRLSQVCGMVERFKYNFL
A6LJ12_THEM4/6-85                 .LIEDFLEKVERIKDSF--------ELIEFFEENFEKIDDPLKNIPEVS-KRLQEFYDYIVKMKHLNRERIEKRMKFIPGMVKRFRDMYL
#=GC SS_cons                      .SHHHHHHHHHHHHTS---TTT--------HHHHHHH---GGGG-HHHH-HHHHHHHHHHTTSSSS-HHHHHHHHHHHHHHHHHHHHHHS
#=GC seq_cons                     .LlE-FL-psEplhcch.ppph..ptLlc.lccthccIDDsLLpssplh.c+LpcFhsYlhthppLPpERthKRLppshsMlc+h+.haL
//
DBGET integrated database retrieval system