GenomeNet

Database: Pfam
Entry: Rop
LinkDB: Rop
Original site: Rop 
#=GF ID   Rop
#=GF AC   PF01815.17
#=GF DE   Rop protein
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   PSI-BLAST
#=GF GA   21.20 21.20;
#=GF TC   25.30 36.90;
#=GF NC   20.90 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   3681971
#=GF RT   Structure of the ColE1 rop protein at 1.7 A resolution. 
#=GF RA   Banner DW, Kokkinidis M, Tsernoglou D; 
#=GF RL   J Mol Biol 1987;196:657-675.
#=GF RN   [2]
#=GF RM   6183660
#=GF RT   Control of ColE1 DNA replication: the rop gene product
#=GF RT   negatively affects transcription from the replication primer
#=GF RT   promoter. 
#=GF RA   Cesareni G, Muesing MA, Polisky B; 
#=GF RL   Proc Natl Acad Sci U S A 1982;79:6313-6317.
#=GF DR   INTERPRO; IPR000769;
#=GF DR   SCOP; 1rpo; fa;
#=GF DR   HOMSTRAD; Rop;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF SQ   34
#=GS A0A1A9Z2C0_GLOPL/129-185  AC A0A1A9Z2C0.1
#=GS A0A0H3GZS9_KLEPH/1-47     AC A0A0H3GZS9.1
#=GS A0A2A2GXH5_9GAMM/1-34     AC A0A2A2GXH5.1
#=GS W1H4V7_KLEPN/1-57         AC W1H4V7.1
#=GS D4BSG4_BIFBR/12-68        AC D4BSG4.1
#=GS C4FHH1_9BIFI/12-55        AC C4FHH1.1
#=GS C5EWV2_9FIRM/12-68        AC C5EWV2.1
#=GS A0A2S4XPU4_9ACTN/1-57     AC A0A2S4XPU4.1
#=GS A0A1Q8BQ56_9PSEU/12-68    AC A0A1Q8BQ56.1
#=GS A0A0U1QPR4_9BACL/12-68    AC A0A0U1QPR4.1
#=GS Q9S1E1_YERPE/1-57         AC Q9S1E1.1
#=GS W1H049_KLEPN/1-47         AC W1H049.1
#=GS A0A2S4XGV7_9ACTN/1-35     AC A0A2S4XGV7.1
#=GS B6WQR2_9DELT/12-68        AC B6WQR2.1
#=GS M0UCD9_MUSAM/1-47         AC M0UCD9.1
#=GS A0A378QC94_KLEPR/1-57     AC A0A378QC94.1
#=GS A0A2S4Y3Z6_9ACTN/1-57     AC A0A2S4Y3Z6.1
#=GS A6TJ66_KLEP7/1-57         AC A6TJ66.1
#=GS B9TQF3_RICCO/12-68        AC B9TQF3.1
#=GS C7HWW4_9FIRM/12-59        AC C7HWW4.1
#=GS Q2NQ08_SODGM/1-57         AC Q2NQ08.1
#=GS A0A2A2GZ16_9GAMM/1-57     AC A0A2A2GZ16.1
#=GS A0A0D4C3I8_9MICC/12-68    AC A0A0D4C3I8.1
#=GS D1Y0Y1_9BACT/1-54         AC D1Y0Y1.1
#=GS A6TJ74_KLEP7/1-57         AC A6TJ74.1
#=GS C0XQG3_CORLD/22-74        AC C0XQG3.1
#=GS A0A2A2HI70_9GAMM/1-57     AC A0A2A2HI70.1
#=GS A0A2A2H1A3_9GAMM/1-57     AC A0A2A2H1A3.1
#=GS A0A348HIL6_9GAMM/1-57     AC A0A348HIL6.1
#=GS A8ARS0_CITK8/1-57         AC A8ARS0.1
#=GS A0A377YZE3_KLEPO/1-57     AC A0A377YZE3.1
#=GS A0A328TUF1_9GAMM/1-47     AC A0A328TUF1.1
#=GS F5LN21_9BACL/1-39         AC F5LN21.1
#=GS A0A2H9U650_9GAMM/1-47     AC A0A2H9U650.1
A0A1A9Z2C0_GLOPL/129-185             MTKQEQSALKMAGFIKSQTLVLLDKLDQLELDSCADECEELHELAEELYLHLSKEL-a..
A0A0H3GZS9_KLEPH/1-47                ----------MAKFIQNQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSSRLD...
A0A2A2GXH5_9GAMM/1-34                -----------------------DKLNQLNLDDCADECVDLHYMAEELYFNLKKTLE...
W1H4V7_KLEPN/1-57                    MTKQQKTALNMAKFIQNQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSSRLD...
D4BSG4_BIFBR/12-68                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
C4FHH1_9BIFI/12-55                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDH-------------...
C5EWV2_9FIRM/12-68                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
A0A2S4XPU4_9ACTN/1-57                MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
A0A1Q8BQ56_9PSEU/12-68               VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
A0A0U1QPR4_9BACL/12-68               VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
Q9S1E1_YERPE/1-57                    MNKQQQTALNMARFIRSQSLILLEKLDALDADEQAAMCERLHELAEELQNSIQARFE...
W1H049_KLEPN/1-47                    ----------MAKFIQNQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSSRLD...
A0A2S4XGV7_9ACTN/1-35                MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQA----------------------...
B6WQR2_9DELT/12-68                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
M0UCD9_MUSAM/1-47                    ----------MARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
A0A378QC94_KLEPR/1-57                MTKQEKTALNMAKFIKDQSLLLLEKLNELDMDTPADMCERLHEDAETLWQVMRDKLG...
A0A2S4Y3Z6_9ACTN/1-57                MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
A6TJ66_KLEP7/1-57                    MTKQQKTALNMAKFIQNQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSSRLD...
B9TQF3_RICCO/12-68                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
C7HWW4_9FIRM/12-59                   VTKQEKTALNMARFIRSRTLTLLEKLNELDADEQADICESLHDHADEL---------...
Q2NQ08_SODGM/1-57                    MTKQEQSALKMAGFIKSQTLLLLEKLDQLELDSCADECEELHELAEELYLHLSKELE...
A0A2A2GZ16_9GAMM/1-57                MNKQELSALKMAGFIKSQTLIFLDKLNQLNLDDCADECEDLHDMAEALYLNLKRTLE...
A0A0D4C3I8_9MICC/12-68               VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG...
D1Y0Y1_9BACT/1-54                    MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCL----a..
A6TJ74_KLEP7/1-57                    MTKQQKTALNMAKFIQHQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSSRLD...
C0XQG3_CORLD/22-74                   VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSC-----l..
A0A2A2HI70_9GAMM/1-57                MNKQELSALNMAGFIKSQTLILLDKLNQLNLDDCADECVDLHYMAEELYFNLKKTLE...
A0A2A2H1A3_9GAMM/1-57                MTKQELSAMNMAGFIKSQTLILLDKLNQLNLDDCADECEDLHDMAEALYFNLKRTLE...
A0A348HIL6_9GAMM/1-57                MGKKEKSALNVAKFIKSQTLILLDKLNELDDDDAANACEKLHDDAEALHEVLANK--wa.
A8ARS0_CITK8/1-57                    MTKQEKTALNMAKFIKEQSLLLLDKLNELDMDTPADMCERLHEDAETLWQVMRDKLG...
A0A377YZE3_KLEPO/1-57                MTKQEKTALNMAKFIKDQSLLLLEKLNELDMDTPADMCERLHEDAETLWQVMRDKLG...
A0A328TUF1_9GAMM/1-47                ----------MAKFIQAQSLLLLEKLNELDFDAEADLCETLHEDAEQVFRALALRLD...
F5LN21_9BACL/1-39                    MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICE------------------...
A0A2H9U650_9GAMM/1-47                ----------MAGFFKSQSLVLLEVLDGLGLDEQAELCERIHDLAEEIVKTLPS---eee
#=GC seq_cons                        hTKQEKTALNMA+FI+SQTLhLLEKLNELDhD-pADlCEpLHDcA-cLapsh.s+ht...
//
DBGET integrated database retrieval system