GenomeNet

Database: Pfam
Entry: Rota_NS35
LinkDB: Rota_NS35
Original site: Rota_NS35 
#=GF ID   Rota_NS35
#=GF AC   PF02509.15
#=GF DE   Rotavirus non-structural protein 35
#=GF AU   Mian N;0000-0003-4284-4749
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1677 (release 5.4)
#=GF GA   25.00 25.00;
#=GF TC   180.30 180.10;
#=GF NC   19.80 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8380660
#=GF RT   Nucleotide and amino acid sequence analysis of the rotavirus
#=GF RT   nonstructural RNA-binding protein NS35. 
#=GF RA   Patton JT, Salter-Cid L, Kalbach A, Mansell EA, Kattoura M; 
#=GF RL   Virology 1993;192:438-446.
#=GF DR   INTERPRO; IPR003668;
#=GF DR   SCOP; 1l9v; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Rotavirus non-structural protein 35 (NS35) is a basic protein
#=GF CC   which possesses RNA-binding activity and is essential for genome
#=GF CC   replication [1].
#=GF SQ   23
#=GS C3U1Z7_9REOV/1-111      AC C3U1Z7.1
#=GS D1GG13_9REOV/1-316      AC D1GG13.1
#=GS NSP2_ROTPC/1-311        AC Q86484.1
#=GS A2T3N6_9REOV/1-316      AC A2T3N6.1
#=GS I6VRE5_9REOV/1-316      AC I6VRE5.1
#=GS X2FR27_9REOV/1-315      AC X2FR27.1
#=GS NSP2_ROTSH/1-316        AC A2T3P0.1
#=GS NSP2_ROTSH/1-316        DR PDB; 6CYA A; 2-314;
#=GS NSP2_ROTSH/1-316        DR PDB; 6CY9 A; 2-313;
#=GS NSP2_ROTSH/1-316        DR PDB; 6AUK A; 2-314;
#=GS NSP2_ROTS1/1-316        AC P03537.1
#=GS M9PLY1_9REOV/1-301      AC M9PLY1.1
#=GS D0TZ93_9REOV/1-316      AC D0TZ93.1
#=GS E7D6J8_9REOV/1-316      AC E7D6J8.1
#=GS NSP2_ROTHC/1-311        AC Q9PY93.1
#=GS NSP2_ROTHC/1-311        DR PDB; 2GU0 B; 2-309;
#=GS NSP2_ROTHC/1-311        DR PDB; 2GU0 A; 2-309;
#=GS A0A1B4X9N8_9REOV/1-311  AC A0A1B4X9N8.1
#=GS A0A0D3Q247_9REOV/1-316  AC A0A0D3Q247.1
#=GS A0A161IM32_9REOV/1-313  AC A0A161IM32.1
#=GS G0YY24_9REOV/1-316      AC G0YY24.1
#=GS NSP2_ROTHW/1-316        AC Q03245.1
#=GS A0A0K0LBP2_9REOV/1-257  AC A0A0K0LBP2.1
#=GS NSP2_ROTBU/1-316        AC P03538.1
#=GS M4H1X8_9REOV/1-316      AC M4H1X8.1
#=GS A0MD55_9REOV/1-316      AC A0MD55.1
#=GS S5TER4_9REOV/1-316      AC S5TER4.1
#=GS NSP2_ROTHD/1-316        AC Q03240.1
C3U1Z7_9REOV/1-111                 ...----ACLCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIIFGIAPPPQFKKRYNTNDNSRGMNYETLMFNKVATPICEALNS..IKV.TQSEVANVLSRAVSVRHFKILV--------.-------------------------------------------------------------------------.------------------------------------------------------------------------------------------.------------------------------...
D1GG13_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIVYGIAPPPQFKKRYNTNDNSRGMNYETPMFNKVAILICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLKAVLIAIGQSKEIETTATAEGGEIVFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITLNEDKP.ISDICVKELVAELRWQYNRFAVITHGKGHYRVVKYSSVANHADRVFATYKNNAKSGNVTDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKQEKNPFKGLSTDRKMDEVSHVG...
#=GR D1GG13_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTPC/1-311                   ...MAELACFVSFS.L..TEDKVKWFPINKKAVKTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTTE-RYGLDYESDQYSEVANLLADVLNM..VSMpTEKFQFDIVKTVVQVRHLENLLLRIKDTDD.ILSENVKLRVKAVMIACNLVNETETTPLTESNEIVYQDSYFTITKLDYSSHKLLPLMAD---EYKITINTKTD.IPDRDQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDKKHGRQFAYDDGDMAFVHPGWKACIGQLCGGTTFEVAK.TSLY-SVKTSKT-VRTATNKIESDLISMVG...
#=GR NSP2_ROTPC/1-311        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
A2T3N6_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNS..LKV.TQANVSNVLSRVVSIRHLENLVIRKENPQD.ILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKP.ISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.RLLFQKMKPEKNPFKGLSTDRKMDEVSQVG...
#=GR A2T3N6_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
I6VRE5_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNS..LKV.TQANVSNVLSRVVSIRHLENLVISKENPQD.ILFHSKDLLLKSTLIAIGQSKEIETTVTAEGGKIVFQNAAFTMWKLTYLDHQLMPILDQNFIEYKVTLNEDKP.ISDGHVKELVAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.RLLFQKMKQEKNPFKGLSTDRKMDEVSQVG...
#=GR I6VRE5_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
X2FR27_9REOV/1-315                 ...MAELACFCYPH.P..ENDSYKFIPFNRLAIKCMLAAKVDKKDMDKFYNSIVYGVAPPPQFKKRYNTSDNSRGMNFETEMFTKVAMLVCDALNT..LKI.TSANLADTLSKVVSIRHLENLVLRRENVQD.VLHHSKELLLKSILIAIGQSQEIETTMTAEGGEIVFQNAAFTMWKLNYLNHQLMPILDQNFVEYKITVNEDKP.MHENSVKELVAELRWQYNKFAAITHGKGHYRVVKYSSISNHADRVYATFKSNAKNG-NTEFNLLDHRIIWQNWHAFTYSMKQGNTLDVCK.KLLFQKLSNAKQTFKGLSTERKFDEVSQVG...
#=GR X2FR27_9REOV/1-315      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTSH/1-316                   ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNS..LKV.TQANVSNVLSRVVSIRHLENLVIRKENPQD.ILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKP.ISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.RLLFQKMKPEKNPFKGLSTDRKMDEVSQVG...
#=GR NSP2_ROTSH/1-316        SS    ...X-BGGGTEEEE.E..ETTEEEEEE--HHHHHHHHT----GGGTTS-EEETTTEEE--GGGGGGB-BTTBSSSB-TTSHHHHHHHHHHHHHHHH..TT-.-CCCHHHHHH-B--HHHHHHHHHHHT-TTS.HHHH-HHHHHHHHHHHTT--SS---STT----EEEEE-SSEEEEE--GGG-SSS----TT--EEEEEESSSS-.--HHHHHHHHHHHHHHTTTEEEEE-SSSSEEEEEGGGHHHHHHHHHHHHHHHHHHT---------TTTS-HHHHHHHHHHHTT--HHHHH.HHHHS----S--SSTTHHHHHHHHHHH-XX...
#=GR NSP2_ROTSH/1-316        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTS1/1-316                   ...MAELACFCYPH.L..ENDSYRFIPFNSLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTSDNSRGMNYETSMFNKVAALICEALNS..IKV.TQSDVASVLSKIVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHKLMPILDQNFIEYKITLNEDKP.ISESHVKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNNKNGNMIEFNLLDQRIIWQNWYAFTSSMKQGNTLEICK.KLLFQKMKRESNPFKGLSTDRKMDEVSQIG...
#=GR NSP2_ROTS1/1-316        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
M9PLY1_9REOV/1-301                 ...----ACFCYPH.L..ENDSYRFIPFNGLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTSDNSRGMNYEAPMFNKVAVLICEALNS..IKV.TQSDVANVLSKVVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHRLMPILDQNFIEYKITVNEDKP.ISESHVKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNNKNGNALEFNLLDQRIIWQNWYAFTSSMKQGNTLEVCK.KLLFQKMKRESNPFKGR-------------vn.
#=GR M9PLY1_9REOV/1-301      pAS   ...........................................................................................................................................................................................................................................*...............................................................................................
D0TZ93_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIVYGIAPPQQFKKRYNTNDNSRGMNYETSMFNKVAMLICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLKAVLIAIGQSKEIETTATAEGGEIVFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITLNEDKP.ISDMCVKELVAELRWQYNRFAVITHGKGHYRVVKYSSVANHADRVFATYKNNVKSGNITDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKQEKNPFKGLSTDRKMDEVSHVG...
#=GR D0TZ93_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
E7D6J8_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIVYGIAPPPQFKKRYNTNDNSRGMNYETPMFNKVAILICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLKAVLIAIGQSKEIETTATAEGGEITFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITLNEDKP.LSDICVKELVAELRWQYNRFAVITHGKGHYRVVKYSSVANHADRVFATYKNNVKSGNVTDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKQEKNPFKGLSTDRKMDEVSHVG...
#=GR E7D6J8_9REOV/1-316      pAS   ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTHC/1-311                   ...MAELACFVSFS.L..TEDKVVWYPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNE-RYGLDYESDQYTELVNLLADTLNM..VSMpTEKFQFDIVKTVVQVRHLENLLCRIKDVND.ILNANVKLRVKAVMIACNLVNETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMAD---EYKITINTKTD.IPDRNQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDKKHGRQFSYDDGDMAFVHPGWKTCIGQLCGGTTFEVAK.TSLY-SIKPSKT-VRTATNKIESDLISMVG...
#=GR NSP2_ROTHC/1-311        SS    ...X-BGGGTEEEE.-..SSSB-EEEE--HHHHHHHHHS---GGGTTS-EE-SSS-EE--GGGGGGB-BTT-B-SB-TTSHHHHHHHHHHHHHHHH..HT-BGGG--GGGCC-B--HHHHHHHHHHHH-TTS.GGGT-HHHHHHHHHHHTT-S-----GGG-S---EEEE-SSEEEEEEE-TT-SSS----E---EEEEEESSSS-.--HHHHHHHHHHHHHHTTTEEEE-SSSSEEEEEEGGGHHHHHHHHHHHHCT------------TT-TTC-HHHHHHHHHHCCT--HHHHT.THHH-H----HH-HHHHHHHHHHHHH--XX...
#=GR NSP2_ROTHC/1-311        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
A0A1B4X9N8_9REOV/1-311             ...MAELACFVSFS.L..TEDKVKWFPINKKAVKTMLCAKVEKDQRSNYYDTILYGVATPPEFKNRFKTSE-KYGLDYESEQYSEVANLLAEVLNM..VSMpTEKFQFDIVKTVVQVRHLENLLLRIKDTDD.ILNENVKLRVKAVMIACNLVNETETTPLTESNSIVYQDSYFTVTKLDYSNHKLLPLMAD---EYKITINTKTD.IPDRDQTAFAAYLRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDKKHGRQFSYDDGDMAFVHPGWKACIGQLCGGTTFEVAK.TSLY-SVKTSKT-VRTATNKIESDLISMVG...
#=GR A0A1B4X9N8_9REOV/1-311  AS    ...........................................................................................................................................................................................................................................*...............................................................................................
A0A0D3Q247_9REOV/1-316             ...MAELACFCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTSDNSRGMNYETTMFNKVAALVCEALNS..VKI.TQSDLANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLRSVLIAIGQIKEIETTATAEGGEIVFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITVNEDKP.ISDVHIKELVSELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVFATFKNNAKSGNITEFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.RLLFQKMKQEKNPFKGLSTDRKMDEVSQIG...
#=GR A0A0D3Q247_9REOV/1-316  AS    ...........................................................................................................................................................................................................................................*...............................................................................................
A0A161IM32_9REOV/1-313             vql------VCYPH.L..ENDSYRFIPFNNLAIKCMLTARVDKKDLDKFYNSIIYGIAPPPQFKKRYNTSDNSRGMNFETPMFSKVAMLICEALNS..LKI.TQSDVASILSRVVSVRHLENLVLRKENHQD.VLFHSRDLLMKSVLIAIGQSKEIETTATAEGGEIVFQNVAFTMWKLTYLEHQLMPILDQNFVEYKVTLNEDKP.ISDTHVKELVAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKNNMKSGIMTDFNLLDQRIIWQNWYAFASSMKQGNTVDVCK.KLLFQKMKQEKNPFKGVSTDRKMDEYPQV-e..
#=GR A0A161IM32_9REOV/1-313  pAS   ...........................................................................................................................................................................................................................................*...............................................................................................
G0YY24_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKCMLTAKVDRKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSRGMNYETSMFNKVAVLICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHKLMPILDQNFIEYKITVNEDKP.ISESHVKELIAELRWQYNKFAVITHGKGHYRVVKYSSIANHADRVYATFKSNNKNGNVLEFNLLDQRIIWQNWYAFTSSMKQGNTLDICK.KLLFQKMKRESNPFKGLSTDRKMDEVSQIG...
#=GR G0YY24_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTHW/1-316                   ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKCMLTAKVEKKDQDKFYNSIVYGIAPPPQFKKRYNTSDNSRGMNYETIMFNKVAVLICEALNS..IKI.TQSDVANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLKSVLIAIGQSKEIETTATAEGGEIVFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITLNEDKP.ISDVCIKELVAELRWQYNRFAVITHGKGHYRVVKYSSVANHADRVFATYKNSAKSGNVIDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKQEKNPFKGLSTDRKMDEVSHVG...
#=GR NSP2_ROTHW/1-316        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
A0A0K0LBP2_9REOV/1-257             ..k-----------.-..-------------AINILLTT---KNDDDNPIDTIIYGLTPIPKYKRRFASDMSPSGINYDNELFDKISSKLAEILNFgvKKM.SIQQAMMMLTRVFSVRHLESLYYRMMDKDD.IIYENIDLQFKSVMVMLKLTKSFELTITAEGGKLLYVDKTYALWELDYRKYKLMPVKAV---EYKITLNSVTE.DADSER-KMAAYVKYHYNRFAVISHGFGHYRLVPYQQVLNHAERTFATYNAIKKMKSDHSFVRLSKTLLNTNWQDFMNAVEYGKSMSEC-.------------------------------r..
#=GR A0A0K0LBP2_9REOV/1-257  pAS   ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTBU/1-316                   ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKCMLTAKVDRKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSRGMNYETSMFNKVAVLICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHKLMPILDQNFIEYKITVNEDKP.ISESHVKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNNKNGNVLEFNLLDQRIIWQNWYAFTSSMKQGNTLDICK.KLLFQKMKRESNPFKGLSTDRKMDEVSQIG...
#=GR NSP2_ROTBU/1-316        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
M4H1X8_9REOV/1-316                 ...MAELGCFVWVEeLdgSEDTCVFRAFSRKAVDVL--TKYDFKDDDTEVVQTIYGPTPPRKHLRRFKTRTNKSGFHWDNDVYDGCCKMLATVLNT..AHL.KGEQAKKLLNSVMSVRHLEGIYKRMNDAEDrLLDDDGKTHLLSVLIMLGATKKIETTVTSEGGTIEYMNKYFTIFKLDYSNYKMAPLQ---TIEYKITFNSDSDnIPDDAFKKLGGYIKFNYNKYMPITHGKGHWRLVHYSETAQHAERIAATLKAIKAIRPDYKTMQLSEYVTARNWMEFMLAIESGMDVQKAKdQCLFKRVQFTKE-VKAHARELAISSMS---vin
#=GR M4H1X8_9REOV/1-316      pAS   ...........................................................................................................................................................................................................................................*...............................................................................................
A0MD55_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIVYGIAPPPQFKKRYNTNDNSRGMNFETSMFNKVAILICEALNS..IKV.TQSDVANVLSRVVSVRHLENLVLRKENHQD.VLFHSKELLLKAVLIAIGQSKEIETTATAEGGEIVFQNAAFTMWKLTYLDHKLMPILDQNFIEYKITLNEDKP.ISDACVKELVAELRWQYNRFAVITHGKGHYRVVKYSSVANHADRVFATYKNNAKSGNVTDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKQEKNPFKGLSTDRKMDEVSHVG...
#=GR A0MD55_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
S5TER4_9REOV/1-316                 ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSKGMNYETAMFNKVAILICEALNS..IKV.TQSDVASVLSKVVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHKLMPILDQNFIEYKITVNEDKP.ISESHVKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNNKNGNVLEFNLLDQRMIWQNWYAFTSSMKQGNTLDVCK.KLLFQKMKRESNPFKGLSTDRKMDEVSQVG...
#=GR S5TER4_9REOV/1-316      AS    ...........................................................................................................................................................................................................................................*...............................................................................................
NSP2_ROTHD/1-316                   ...MAELACFCYPH.L..ENDSYKFIPFNNLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSRGMNYETSMFNKVAALICEALNS..TKV.TQSDIASVLSRVVSVRHLENLVLRRENHQD.VLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNTAFTMWRLTYLEHKLMPILDPNFIEYKITVNEGKP.ISESHIKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATYKSNNKNGNMLEFNLLDQRIIWQNWYAFTSSMKQGNTLDTCK.KLLFQKIKRESNPFKGLSTDRKMDEVSQIG...
#=GR NSP2_ROTHD/1-316        AS    ...........................................................................................................................................................................................................................................*...............................................................................................
#=GC SS_cons                       ...X-BGGGTEEEE.E..CTTEEEEEE--HHHHHHHHCS---GGGTTS-EEETTTEEE--GGGGGGB-BTTBCSSB-TTSHHHHHHHHHHHHHHHH..CT-BGCCCHHHHCC-B--HHHHHHHHHHHC-TTS.HHHC-HHHHHHHHHHHTT-SSS---CCC-S--EEEEE-SSEEEEEEEGCC-SSS----CT--EEEEEESSSS-.--HHHHHHHHHHHHHHTTTEEEEESSSSCEEEEEGGGHHHHHHHHHHHHCCHHHHT-------TTTTTC-HHHHHHHHHHCCT--HHHHC.CHHHSH---SHHSCCCHHHHHHHHHHH-XX...
#=GC seq_cons                      ...MAELACFCYPH.L..ENDSYKFIPFNsLAIKCMLTAKVDKKDpDKFYNSIIYGIAPPPQFKKRYNTsDNSRGMNYETsMFsKVAhLICEALNS..lKV.TQS-VAsVLSRVVSVRHLENLVLR+EN+QD.VLFHSK-LLLKSVLIAIGpSKEIETTsTAEGGEIVFQNAAFTMWKLTYL-HKLMPILDQNFIEYKITlNEDKP.ISDscVKELlAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVaATaKuNsKsGssh-FNLLDQRIIWQNWYAFTSSMKQGNTLDVCK.+LLFQKMKpEKNPFKGLSTDRKMDEVSpVG...
//
DBGET integrated database retrieval system