GenomeNet

Database: Pfam
Entry: Rubi_NSP_C
LinkDB: Rubi_NSP_C
Original site: Rubi_NSP_C 
#=GF ID   Rubi_NSP_C
#=GF AC   PF12601.9
#=GF DE   Rubivirus non-structural protein
#=GF AU   Gavin OL;
#=GF SE   Prosite
#=GF GA   25.40 25.40;
#=GF TC   25.50 155.10;
#=GF NC   22.90 25.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10846076
#=GF RT   Characterization of the zinc binding activity of the rubella
#=GF RT   virus nonstructural protease. 
#=GF RA   Liu X, Yang J, Ghazi AM, Frey TK; 
#=GF RL   J Virol 2000;74:5949-5956.
#=GF DR   INTERPRO; IPR022245;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain family is found in viruses, and is approximately 70
#=GF CC   amino acids in length. The family is found in association with
#=GF CC   Pfam:PF05407. The rubella virus (RUB) nonstructural (NS) protein
#=GF CC   (NSP) ORF encodes a protease that cleaves the NSP precursor (240
#=GF CC   kDa) at a single site to produce two products.
#=GF SQ   2
#=GS E7FL32_RUBV/1275-1340  AC E7FL32.1
#=GS POLN_RUBVT/1275-1340   AC P13889.5
E7FL32_RUBV/1275-1340             VCAVGGGPRRVSDRPHLWLAVPLSRGGGTCAATDEGLAQAYYDDLEVRRLGDDAMARAALASVQRP
POLN_RUBVT/1275-1340              VCAVGGGPRRVSDRPHLWLAVPLSRGGGTCAATDEGLAQAYYDDLEVRRLGDDAMARAALASVQRP
#=GC seq_cons                     VCAVGGGPRRVSDRPHLWLAVPLSRGGGTCAATDEGLAQAYYDDLEVRRLGDDAMARAALASVQRP
//
DBGET integrated database retrieval system