GenomeNet

Database: Pfam
Entry: SRX
LinkDB: SRX
Original site: SRX 
#=GF ID   SRX
#=GF AC   PF09201.10
#=GF DE   SRX, signal recognition particle receptor alpha subunit
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1nrj
#=GF GA   29.90 29.90;
#=GF TC   30.00 32.10;
#=GF NC   26.20 29.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Signal_recognition_particle_receptor
#=GF RN   [1]
#=GF RM   12654246
#=GF RT   Structural basis for the function of the beta subunit of the
#=GF RT   eukaryotic signal recognition particle receptor. 
#=GF RA   Schwartz T, Blobel G; 
#=GF RL   Cell. 2003;112:793-803.
#=GF DR   INTERPRO; IPR015284;
#=GF DR   SCOP; 1nrj; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Members of this family, which are predominantly found in
#=GF CC   eukaryotic signal recognition particle receptor alpha, consist
#=GF CC   of a central six-stranded anti-parallel beta-sheet sandwiched by
#=GF CC   helix alpha1 on one side and helices alpha2-alpha4 on the other.
#=GF CC   They interact with the small GTPase SR-beta, forming a complex
#=GF CC   that matches a class of small G protein-effector complexes,
#=GF CC   including Rap-Raf, Ras-PI3K(gamma), Ras-RalGDS, and
#=GF CC   Arl2-PDE(delta) [1]. Structurally the alpha subunit is
#=GF CC   SNARE-like.
#=GF SQ   31
#=GS A0A1G4KLZ1_9SACH/1-141  AC A0A1G4KLZ1.1
#=GS A0A0H5C069_CYBJA/1-129  AC A0A0H5C069.1
#=GS J4U2L8_SACK1/1-155      AC J4U2L8.1
#=GS A7TFS7_VANPO/1-148      AC A7TFS7.1
#=GS G8JRB0_ERECY/1-141      AC G8JRB0.1
#=GS G0VGX2_NAUCC/1-143      AC G0VGX2.1
#=GS A0A0C7N0V0_9SACH/1-142  AC A0A0C7N0V0.1
#=GS A0A1G4JDE4_9SACH/1-141  AC A0A1G4JDE4.1
#=GS A0A1G4JA70_9SACH/1-139  AC A0A1G4JA70.1
#=GS G8BTK8_TETPH/1-155      AC G8BTK8.1
#=GS G0W8F2_NAUDC/1-150      AC G0W8F2.1
#=GS C5DM67_LACTC/1-140      AC C5DM67.1
#=GS Q6FSE1_CANGA/1-148      AC Q6FSE1.1
#=GS J8PJH7_SACAR/1-155      AC J8PJH7.1
#=GS C5E0Z1_ZYGRC/1-156      AC C5E0Z1.1
#=GS H0GEC0_SACCK/1-155      AC H0GEC0.1
#=GS J7SBF4_KAZNA/1-139      AC J7SBF4.1
#=GS W6MMX7_9ASCO/1-26       AC W6MMX7.1
#=GS Q6CTR2_KLULA/1-140      AC Q6CTR2.1
#=GS I2GXE9_TETBL/1-153      AC I2GXE9.1
#=GS G8ZVC5_TORDC/1-153      AC G8ZVC5.1
#=GS SRPR_YEAST/1-155        AC P32916.2
#=GS SRPR_YEAST/1-155        DR PDB; 1NRJ A; 1-155;
#=GS A0A1X7R5A0_9SACH/1-142  AC A0A1X7R5A0.1
#=GS E7NG10_YEASO/1-155      AC E7NG10.1
#=GS S6EG03_ZYGB2/1-152      AC S6EG03.1
#=GS H2AV95_KAZAF/1-124      AC H2AV95.1
#=GS W0T7W4_KLUMD/1-140      AC W0T7W4.1
#=GS Q75F07_ASHGO/1-134      AC Q75F07.2
#=GS E7QD61_YEASZ/1-155      AC E7QD61.1
#=GS H0GT36_SACCK/1-155      AC H0GT36.1
#=GS A0A1G4MFP5_LACFM/1-140  AC A0A1G4MFP5.1
A0A1G4KLZ1_9SACH/1-141             MIDQFVVFTSHGQVLYSFSPQGKRLAELQVNKVVSHLITTPARKDELG.......HKYIILKL-------.......DHFVAACHLEKQPPIIFLTTYV.AQDLELNREAEQVLDLGTKLWASLGLNETIELNL.GKK.APKNEHNYTWVLENCDEQITKFDEYF.......
A0A0H5C069_CYBJA/1-129             MIDEFLIFNLKGEVLFKHSP--HRLAESVVNTFIDEVFVSSTASISTV.......DGVQSCNV------V.......DKYVARFDQTHNPDLIAVCFYN.KN-VP-APYAGSLVQISLTLFKQL-LGDDILQNL.---.-----ERQVGVLDGMDKQLEKFEQYY.......
J4U2L8_SACK1/1-155                 MFEQLAVFTPQGQVLYQYNCLGKRFSEVQINSFISQLITSPVTKKESVanantngFDFNLLTINNEFKNS.......NSFYALFYLNKQPELYFVVTFA.EQTLELNQETQQTLSLALKLWNSLHLSESIQKNL.KGH.NEKNEHNYIDVLQGLKEDLDKFDQYF.......
A7TFS7_VANPO/1-148                 MFDQLVIFTPTGEVLYEYNPLNKKAMLNQVNAFISHLVNMPVSKKDDI......nSKLTIINVTQEKST-.......RSFSAMFHISKQPELYFVITYA.EQSLELNNEAESTLNLVLALWDSLDLNQSILENM.KGK.SGKNEHNYCEVLQDLNETIKTFDKYF.......
G8JRB0_ERECY/1-141                 MIDQLAIFTVQGQLLCKYNALGKKFSEQQFNKFIHTLIAQSIATSN--.......SKFPTLSV-------.......DSHTFMFHETKQPFLYYVVSYSsSESLELNQEAEQVLNIAIKLWDSLGLNDAIRKNQdHAK.SKKNRHNYTWLLEGAEDKLLQFEQFF.......
G0VGX2_NAUCC/1-143                 MFDQLTIFTPQGQVLFKYNCQGKKFAELQINTFISKIITSPVTQRG--.......SKFNILNITNDSLSKs....nvRPFCSMFHVTKQPELYFVITYA.EQTIDLDKEAEKTLDLALKLWDSLDLNEEIQSNL.---.---KNKQHVDILYGMNEDLSKFDKYL.......
A0A0C7N0V0_9SACH/1-142             MIDQFVVFTPSGQVLYNFSPQGKRLAEIQVNKVVSELITNGARRDESS.......HKYTILKL-------.......DQFAGMCNISKHPPLVFLCTYA.AQELEQIREAEQILDLGINLWESLELYQVMERNT.SRQgGPKNHHNFTWVLQDCDEQMSKFDEYF.......
A0A1G4JDE4_9SACH/1-141             MIDQFVIFSAQGQVLYHFSPHGKRLGELQVNKVIAQLISSPVRREETG.......QRYGLLHL-------.......DQFTAMYHATKQPPISFLVTYA.GNDLDLNQEAEQVLNLGIKLWESLELNQKIELNL.NGK.GAKNQHNFTWILTSGESQIERFDEYF.......
A0A1G4JA70_9SACH/1-139             -MEQFVVFRPSGEVLYHFGASGRKLQEQQVNKIVSELVGSPPRKTS-N.......NGFPVINL-------.......GSFAAMYTSTMQPHVFYLVTFA.AETLELSQLANKLLQLGTDLWASLGLNEIIAQNL.SGR.NEKNEHNFTWCLNGAGELIGKFGEYF.......
G8BTK8_TETPH/1-155                 MFDQLAIFTPQGEVLYQYNPSGKKFAETQVNAFINHLMNSPISKKNDV......hSKFSLVNISPTVGDSsn..sskLNFSSMFYISKQPELYYLVTFP.EQKLDLKNEAEETLNLALSLWDSLGLNDSILQNLkNRT.ETKNWHNYIDLLYGTENDFKKFKEYF.......
G0W8F2_NAUDC/1-150                 MFEQLAIFTLQGIILYQYNCQGKKFSEHQINAFISKLITAPATRDTTTa.....gGKFTILNVTNDSTLSttn.aysRSFCSMFYKTKQPEIYFVITYA.EQTIELDKEAEKTLDLATKLWNSLEINKSIQENL.---.---NSRDHIDILDGVNDGISKFDQYF.......
C5DM67_LACTC/1-140                 MIDQFVVFTLKGQVLYHFNPQGRKLAENHINKVISHLITSPSKKEE-S.......GKYLLFKL-------.......DNFAAACFIGKQPPLVYLVTYA.AQDLELNQEAEQVLDLGFGLWDSLKLNNSVLQNL.SGK.GVKNRHNYTWILEGCDSNLNKFDEYF.......
Q6FSE1_CANGA/1-148                 MFEQLTIFTPQGEVLYYYNCYDRKFAEAQVNAVISHLLTSPISRDHGS.......SKYKLLSIPSVSKNA.......KPFTVLSHVSKQPELYFIITYP.EPSMELNNEAQEVLDVAIALWDSLPINDIIIKAA.KGT.GKKNAFNCIDISGEISEDIEKFDNYL.......
J8PJH7_SACAR/1-155                 MFDQLAVFTPQGQVLYQYNCLGKKFSEVQINTFISQLITSPVTKKESVanantggFDFNVLAVNNEFKNS.......SSFNALFYLNKQPELYFVVTFA.EQTLELNQETQQTLALALKLWNSLHLSESIQKNL.KGQ.NEKNKHNYVDVFQGLGEDLSKFDQYF.......
C5E0Z1_ZYGRC/1-156                 MLEQFVVFTSGGQVVYQFNCLGKKFAETQINRFISHLLSSPTIHNEDS......sRKYRIVEIAGNSNTSggnkaqsRGFCSMYHVSRRPELYYVVTYA.EQSLQLNQEAEETLQVGINLWESLGLSEGVLDNI.NGK.GSRNERNCIDVLTDLEEELEKFDQYL.......
H0GEC0_SACCK/1-155                 MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVanantdgFDFNLLTINSEHKNS.......PSFNALFYLNKQPELYFVVTFA.EQTLELNQETQQTLALVLKLWNSLHLSESILKNL.QGQ.NEKNKHNYVDILQGIEDDLKKFEQYF.......
J7SBF4_KAZNA/1-139                 MFEQLAIFTPQGQVLYQFNCLGKKFAESQINAFLNQLILSPVTKKDSV......gGKFNLVNV--QSGAT.......KSFCAMFYVAKQPEFYFVITFA.EQNLQLDREAEETLTLALKLWESLGIREDINENM.SKK.--------MDELHDLEESLAKFDQFL.......
W6MMX7_9ASCO/1-26                  MVDLFEIFAPSGKVVYKYEQQ---------------------------.......---------------.......----------------------.----------------------------------.---.--------------------------knfrp..
Q6CTR2_KLULA/1-140                 MIDQFAVFTPAGNLLYGYNSLNKKFSETQINRFVSEFISQPVKDVT--.......SKFPIIST-------.......SDTSYMYHETKQPHLFLVVSFAsSESIQLTAEAESVVVLATKLWESLGLNEVILDNI.SGK.GKKNVHNFRFITEGASDQISKFGSYF.......
I2GXE9_TETBL/1-153                 MFEQLAILTPQGTVLYQYNPLGKKFQEAQINAFINQLIVSPATKKDDI......tKKFSVFVVNSSVSSKk....svKNFCAMFHVNKQPEIYFVVTYA.ELSLELNRDSEELLKLAIDLWDSLELSTSVSENLnQYK.TNANEHSQVFILNDMEEDLSKYDKYL.......
G8ZVC5_TORDC/1-153                 MFEQFCIFTPQGDVIYQFNCAGKKFLESQINRFLSQYITSPAPNEETY.......KKYNLLSVSGGLSGPgv..qgpRGFSAMFHISKQPELYYVVTYA.EQSLQLNEEAAEILRLSISLWNSLNVNEEIVRNL.SGR.GSKNEHNFTDVVDGLDKDIETFDKYL.......
SRPR_YEAST/1-155                   MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVanantdgFDFNLLTINSEHKNS.......PSFNALFYLNKQPELYFVVTFA.EQTLELNQETQQTLALVLKLWNSLHLSESILKNR.QGQ.NEKNKHNYVDILQGIEDDLKKFEQYF.......
#=GR SRPR_YEAST/1-155        SS    ---EEEEE-TT-BEEEEEETTS----HHHHHHHHHHHHHS---GGGEE-SGGGTT--EEEEE--------.......---EEEEEEETTTTEEEEEEES.S--HHHHHHHHHHHHHHHHHHHHTTHHHHHHHHT.SSS.TT--TTS---TTTTTHHHHHHHHT--.......
A0A1X7R5A0_9SACH/1-142             MFDQLAIFTGAGQVLYQYNCNGRKFAESQIDAFINQLILSPVTKKDNV......nGKYSVVNVTATDKKA......sRSFSSMFYLSRQPELYFVITYP.EQSLELNKEAEATLDLALALWDSLEIDVQVTENI.---.-----KDNNDILVDLDEDLNKFDEYL.......
E7NG10_YEASO/1-155                 MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSXVTRKESVanantdgFDFNLLTINSEHKNS.......PSFNALFYLNKQPELYFVVTFA.EQTLELNQETQQTLALVLKLWNSLHLSESILKNL.QGQ.NEKNKHNYVDILQGIEDDLXKFEQYF.......
S6EG03_ZYGB2/1-152                 MLEQFAIFTPGGQVVYQFNCLGKKFAEGQINRFISHFLSSPTSYKNDT......aNKYSIVEIGACNGGKa....sgRGFCTMFHVNRRPELYYVVTYA.EQLLLLNQEAEETLKVGINLWKSLGLYEGIIDNV.SGK.GSRNEHNYTDVLADLQDEVSKFDKYL.......
H2AV95_KAZAF/1-124                 MFEQLAIFNPQGQVFYEFNCQGKKFNETQINAFVSQLIVSPATKKDSIg.....sGRHTVVNVSVPEKAN......cRPFTAMFHVSKQPELYFVITYV.EQTIQLNKEAEETLDAALGLWNSLDLKEY-----.---.--------------------------lgswddl
W0T7W4_KLUMD/1-140                 MIDQFAVFTPLGNLLYGYNSLNKKFSESQINRFVDEFISQPVKNVT--.......SKYPILST-------.......ADSSFMYYESKQPHLFFVVSFAsAESMQLTSEAESLLSVATKLWESLDLDKIILDNL.SGK.GKKNVHNFRFVTEDADEKLAKFGTYF.......
Q75F07_ASHGO/1-134                 MIDQFAIFTAQGQLLFQYASLKKRFSEQLCNKFIHELISRPPAINE--.......SKFATVSV-------.......DSHTFIFRETKATRLFYVASYAsAPSLTLNHEAEQVVDMSLQLWDSLGLDSALRAAR.---.---KEPKGSITLEAVQEELFKFEKYF.......
E7QD61_YEASZ/1-155                 MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVanantdgFDFNLLTINSEHKNS.......PSFNALFYLNKQPELYFVVTFA.EQTLELNQETQQTLALVLKLWNSLHLSESILKNL.QGQ.NEKNKHNYVDILQGIEDDLKKFEQYF.......
H0GT36_SACCK/1-155                 MFEQLAVFTPQGQVLYQYNCLGKRFSEVQINSFISQLITSPVTKKESVanantngFDFNLLTINNEFKNS.......NSFYALFYLNKQPELYFVVTFA.EQTLELNQETQQTLSLALKLWNSLHLSESIQKNL.KGH.NEKNKHNYIDVLQGLKEDLDKFDQYF.......
A0A1G4MFP5_LACFM/1-140             MIEQLVVFTPQGQVLYKFNPLRKRFAEQQINKIVCQLISTSARKEEG-.......GKFPVLEL-------.......DGFACMYHAMKQPRLYFVVTYA.ASSLELNQEAEQVLQLGTRLWESLELNDKIIHNL.NGK.GPRNKHNYTWILDDGEAELDKFDEYF.......
#=GC SS_cons                       ---EEEEE-TT-BEEEEEETTS----HHHHHHHHHHHHHS---GGGEE-SGGGTT--EEEEE--------.......---EEEEEEETTTTEEEEEEES.S--HHHHHHHHHHHHHHHHHHHHTTHHHHHHHHT.SSS.TT--TTS---TTTTTHHHHHHHHT--.......
#=GC seq_cons                      MhDQhslFTPQGQVLYpYNshGKKFuEtQINpFISpLIoSPss+c-ss.......tKasllsl..............csFsuhFalsKQPELYFVVTaA.EQoL-LNpEAEpsLsLulpLWsSLpLs-sIhcNl.pup.stKNcHNas.lLpshc-clpKF-pYF.......
//
DBGET integrated database retrieval system