GenomeNet

Database: Pfam
Entry: SUB1_ProdP9
LinkDB: SUB1_ProdP9
Original site: SUB1_ProdP9 
#=GF ID   SUB1_ProdP9
#=GF AC   PF18213.3
#=GF DE   SUB1 protease Prodomain ProdP9 
#=GF AU   Smart A;0000-0002-6965-5633
#=GF SE   ECOD:EUF03039
#=GF GA   25.00 25.00;
#=GF TC   25.80 53.30;
#=GF NC   24.80 23.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   24785947
#=GF RT   The malaria parasite egress protease SUB1 is a calcium-dependent
#=GF RT   redox switch subtilisin.
#=GF RA   Withers-Martinez C, Strath M, Hackett F, Haire LF, Howell SA,
#=GF RA   Walker PA, Christodoulou E, Dodson GG, Blackman MJ;
#=GF RL   Nat Commun. 2014;5:3726.
#=GF DR   INTERPRO; IPR041089;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is the bound prodomain fragment ProdP9 of the SUB1
#=GF CC   protein present in Plasmodium falciparum.  SUB1 is a serine
#=GF CC   protease that processes a subset of parasite proteins that play
#=GF CC   indispensable roles in egress and invasion. The C-terminal stalk
#=GF CC   of ProdP9 binds in the active site groove in a substrate-like
#=GF CC   manner and is truncated at the N terminus as a result of the
#=GF CC   chymotrypsin digestion step used during purification. ProdP9 is
#=GF CC   structural similar to MIC5 from Toxoplasma gondii, despite low
#=GF CC   sequence identity [1].
#=GF SQ   26
#=GS A0A0L7M2G5_PLAF4/1-37     AC A0A0L7M2G5.1
#=GS A0A1A8W494_PLAMA/120-199  AC A0A1A8W494.1
#=GS A0A384KKS5_PLAKH/122-201  AC A0A384KKS5.1
#=GS A0A024WBB7_PLAFA/143-222  AC A0A024WBB7.1
#=GS A0A1A8YZI9_9APIC/121-200  AC A0A1A8YZI9.1
#=GS W7JH37_PLAFA/139-218      AC W7JH37.1
#=GS SUB1_PLAFO/138-217        AC W7K9M0.1
#=GS A0A1A8VVU6_9APIC/121-200  AC A0A1A8VVU6.1
#=GS Q7RGL7_PLAYO/116-195      AC Q7RGL7.1
#=GS A0A1D3U8X6_9APIC/121-200  AC A0A1D3U8X6.1
#=GS A0A0L7LXW7_PLAF4/140-219  AC A0A0L7LXW7.1
#=GS A0A0L1IEY1_PLAFA/144-223  AC A0A0L1IEY1.1
#=GS A0A1Y1JGV4_PLAGO/122-201  AC A0A1Y1JGV4.1
#=GS K6UDQ1_9APIC/123-202      AC K6UDQ1.1
#=GS A0A0L0CTV0_PLAFA/151-230  AC A0A0L0CTV0.1
#=GS A0A653H707_9APIC/133-212  AC A0A653H707.1
#=GS A0A509AM03_PLABA/116-195  AC A0A509AM03.1
#=GS A0A0L7K723_PLAFX/140-219  AC A0A0L7K723.1
#=GS A0A0L1I7Y3_PLAFA/144-223  AC A0A0L1I7Y3.1
#=GS W4IU16_PLAFP/141-220      AC W4IU16.1
#=GS A0A024XCT6_PLAFC/141-220  AC A0A024XCT6.1
#=GS A0A1J1HAX9_PLARL/118-197  AC A0A1J1HAX9.1
#=GS A0A024VIT3_PLAFA/96-175   AC A0A024VIT3.1
#=GS SUB1_PLAF7/138-217        AC Q8I0V0.1
#=GS A5KB03_PLAVS/123-202      AC A5KB03.1
#=GS A0A024WUI1_PLAFA/141-220  AC A0A024WUI1.1
A0A0L7M2G5_PLAF4/1-37                -------------------------------------------MIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A1A8W494_PLAMA/120-199             LRLIVSENHSTSPSFFEESLLEEEVVSFLQSKGKLSNLKNIKSLIIDLNNDTSDEELEKYIKKLEEKGAHVESDKLVGAD
A0A384KKS5_PLAKH/122-201             LRLIVSENHATSPSFFEESLLQDEVMSFIQSKGKLSNLKNLKSIIIDLNGDMTDEELAEYINMLEKKGALIESDKLVGAD
A0A024WBB7_PLAFA/143-222             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A1A8YZI9_9APIC/121-200             LRLIVSENHSTSPSFFEESLLQEDVISFIQSKGTLSNLKNLKSVIIDLNSETTDEELESYIKMLEQKGALIESDKLVGAD
W7JH37_PLAFA/139-218                 LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
SUB1_PLAFO/138-217                   LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A1A8VVU6_9APIC/121-200             LRLIVSENHSTSPSFFEESLLQEDVISFIQSKGTLSNLKNLKSVIIDLNSETTDEELESYIKMLEQKGALIESDKLVGAD
Q7RGL7_PLAYO/116-195                 LRLIVSENHATTPSFFEESIIQEDFMSFIQSKGEIVNLKNIKSMIIELNSDMTDKELETYITLLKKKGAHVESDELVGAD
A0A1D3U8X6_9APIC/121-200             LRLIVSENHSTSPSFFEESLLQEDVISFIQSKGTLSNLKNLKSVIIDLNSETTDEELESYIKMLEQKGALIESDKLVGAD
A0A0L7LXW7_PLAF4/140-219             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A0L1IEY1_PLAFA/144-223             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A1Y1JGV4_PLAGO/122-201             LRLLVSENHKTSPSFFEESLLQEDVLSFIQSKGTLSNLKNIKSVIIELNTDTTDEELEEYIKTLENKGALIESDKLVGAD
K6UDQ1_9APIC/123-202                 LRLIVSENHATSPSFFEESLLQEDVMSFIQSKGKLANLKNLKSIIIDLNDDMTDEELAEYISMLERKGALIESDKLVGAD
A0A0L0CTV0_PLAFA/151-230             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A653H707_9APIC/133-212             LRLIVSENHATTPSFFEESLLQEDVINFIHSKGKVFHLPNMKFMLIDLNSNTNDEELELYINTLENKGAHVEPDQLVGGD
A0A509AM03_PLABA/116-195             LRLIVSENHATSPSFFEESLIQEDFMSFIQSKGEIVNLKNLKSMIIELNSDMTDKELEAYITLLKKKGAHVESDELVGAD
A0A0L7K723_PLAFX/140-219             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A0L1I7Y3_PLAFA/144-223             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
W4IU16_PLAFP/141-220                 LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A024XCT6_PLAFC/141-220             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A0A1J1HAX9_PLARL/118-197             LRLIVSENHSTTPSFFEESLLQEDVISLIESKGKLSNLPSLKSAIIDLNDDTTDKELEAYITTLEKKGALVESDKLVGAD
A0A024VIT3_PLAFA/96-175              LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
SUB1_PLAF7/138-217                   LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
A5KB03_PLAVS/123-202                 LRLIVSENHATSPSFFEESLLQEDVVSFIQSKGKLSNLKNLKSMIIDLNSDMTDEELAEYISLLERKGALIESDKLVGAD
A0A024WUI1_PLAFA/141-220             LRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
#=GC seq_cons                        LRLIVSENHATTPSFFpESLLp.DVlSFlpSKGsLSNLKNIpSMIIELp-DTTD-ELhSYIKlLEcKGALIESDKLVuAD
//
DBGET integrated database retrieval system