GenomeNet

Database: Pfam
Entry: Spc7
LinkDB: Spc7
Original site: Spc7 
#=GF ID   Spc7
#=GF AC   PF08317.11
#=GF DE   Spc7 kinetochore protein
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Wood V;0000-0001-6330-7526
#=GF SE   manual
#=GF GA   34.20 34.20;
#=GF TC   34.20 34.50;
#=GF NC   34.10 33.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Coiled-coil
#=GF RN   [1]
#=GF RM   15371542
#=GF RT   The fission yeast kinetochore component Spc7 associates with the
#=GF RT   EB1 family member Mal3 and is required for kinetochore-spindle
#=GF RT   association. 
#=GF RA   Kerres A, Vietmeier-Decker C, Ortiz J, Karig I, Beuter C,
#=GF RA   Hegemann J, Lechner J, Fleig U; 
#=GF RL   Mol Biol Cell 2004;15:5255-5267.
#=GF DR   INTERPRO; IPR013253;
#=GF DR   SO; 0001080; coiled_coil;
#=GF CC   This domain is found in cell division proteins which are
#=GF CC   required for kinetochore-spindle association [1].
#=GF SQ   564
#=GS A0A0L0HRB8_SPIPN/623-927    AC A0A0L0HRB8.1
#=GS E6ZJN2_SPORE/795-1101       AC E6ZJN2.1
#=GS A0A0F7TL75_9EURO/980-1306   AC A0A0F7TL75.1
#=GS D3BDP6_POLPP/721-937        AC D3BDP6.1
#=GS R0I7L4_SETT2/751-1062       AC R0I7L4.1
#=GS A0A1C1XQG0_9PEZI/997-1309   AC A0A1C1XQG0.1
#=GS Q5B2K9_EMENI/984-1307       AC Q5B2K9.1
#=GS G0WFY6_NAUDC/508-824        AC G0WFY6.1
#=GS A0A090MDR7_OSTTA/642-911    AC A0A090MDR7.1
#=GS A0A1U7KZV3_9APHY/834-1158   AC A0A1U7KZV3.1
#=GS A0A094DXF8_9PEZI/1016-1330  AC A0A094DXF8.1
#=GS A0A1V2L328_CYBFA/532-831    AC A0A1V2L328.1
#=GS A0A137Q8V4_9AGAR/788-1098   AC A0A137Q8V4.1
#=GS M2U7I0_COCH5/758-1069       AC M2U7I0.1
#=GS A0A0C2TUJ2_AMAMU/783-1095   AC A0A0C2TUJ2.1
#=GS A0A1J9RM42_9PEZI/750-1073   AC A0A1J9RM42.1
#=GS N1RB31_FUSC4/963-1283       AC N1RB31.1
#=GS A0A139IQD8_9PEZI/751-1067   AC A0A139IQD8.1
#=GS A0A150VCP5_9PEZI/777-1095   AC A0A150VCP5.1
#=GS A0A0K6G5J6_9HOMO/1163-1474  AC A0A0K6G5J6.1
#=GS A0A0C9YGQ8_9HOMO/211-373    AC A0A0C9YGQ8.1
#=GS A0A194S0Y7_RHOGW/914-1240   AC A0A194S0Y7.1
#=GS M3JDA0_CANMX/487-783        AC M3JDA0.1
#=GS A0A194V2H0_9PEZI/932-1244   AC A0A194V2H0.1
#=GS A0A068SAT4_9FUNG/384-688    AC A0A068SAT4.1
#=GS A0A0C7MXN5_9SACH/387-700    AC A0A0C7MXN5.1
#=GS A0A2C5Z1T2_9HYPO/968-1281   AC A0A2C5Z1T2.1
#=GS X0CY59_FUSOX/988-1301       AC X0CY59.1
#=GS V3ZM97_LOTGI/915-1213       AC V3ZM97.1
#=GS I2GZ03_TETBL/495-806        AC I2GZ03.1
#=GS A0A100ICU5_ASPNG/997-1324   AC A0A100ICU5.1
#=GS U7Q5G6_SPOS1/1025-1347      AC U7Q5G6.1
#=GS A0A166VZ08_9PEZI/1029-1341  AC A0A166VZ08.1
#=GS A0A0L0S3J4_ALLMA/805-1103   AC A0A0L0S3J4.1
#=GS A0A094G0Q2_9PEZI/1011-1326  AC A0A094G0Q2.1
#=GS A0A1V6QCX9_9EURO/949-1275   AC A0A1V6QCX9.1
#=GS A0A0B4HIU0_9HYPO/920-1233   AC A0A0B4HIU0.1
#=GS A0A162KX25_CORDF/929-1207   AC A0A162KX25.1
#=GS A0A074YUQ3_9PEZI/1011-1324  AC A0A074YUQ3.1
#=GS S3CDX6_OPHP1/1009-1331      AC S3CDX6.1
#=GS A0A094D8Y3_9PEZI/1023-1338  AC A0A094D8Y3.1
#=GS A0A0C3BQ11_9HOMO/719-1024   AC A0A0C3BQ11.1
#=GS W9XG25_9EURO/1022-1342      AC W9XG25.1
#=GS A0A090CDX0_PODAN/1000-1313  AC A0A090CDX0.1
#=GS A0A0F4YX58_TALEM/984-1311   AC A0A0F4YX58.1
#=GS A0A1C7MQX6_GRIFR/899-1225   AC A0A1C7MQX6.1
#=GS A0A135UM61_9PEZI/1003-1313  AC A0A135UM61.1
#=GS A0A0P1BRK7_9BASI/646-959    AC A0A0P1BRK7.1
#=GS A0A093W088_TALMA/968-1290   AC A0A093W088.1
#=GS A0A0M9VP63_9BASI/485-794    AC A0A0M9VP63.1
#=GS A0A1L9PXS8_ASPVE/996-1320   AC A0A1L9PXS8.1
#=GS A0A101MBM4_9EURO/931-1256   AC A0A101MBM4.1
#=GS A1CEP5_ASPCL/982-1304       AC A1CEP5.1
#=GS A0A178EKZ6_9PLEO/754-1065   AC A0A178EKZ6.1
#=GS H0EI67_GLAL7/1138-1277      AC H0EI67.1
#=GS A0A0L0D6T0_THETB/746-1042   AC A0A0L0D6T0.1
#=GS A0A1B9GY73_9TREE/626-936    AC A0A1B9GY73.1
#=GS A0A094HQH1_9PEZI/1021-1336  AC A0A094HQH1.1
#=GS R8BMV3_TOGMI/1-217          AC R8BMV3.1
#=GS A0A1B7NZM9_9EURO/1008-1332  AC A0A1B7NZM9.1
#=GS H0EI67_GLAL7/1038-1144      AC H0EI67.1
#=GS N4UWZ2_COLOR/995-1305       AC N4UWZ2.1
#=GS A0A098VQY7_9MICR/1-157      AC A0A098VQY7.1
#=GS A0A0B4I773_9HYPO/920-1233   AC A0A0B4I773.1
#=GS Q8SUP7_ENCCU/187-480        AC Q8SUP7.1
#=GS A0A1Y2ERD0_9BASI/736-1050   AC A0A1Y2ERD0.1
#=GS A0A0L0F3L9_9EUKA/8-122      AC A0A0L0F3L9.1
#=GS A0A1E5RLK4_9ASCO/143-409    AC A0A1E5RLK4.1
#=GS E6RF50_CRYGW/472-781        AC E6RF50.1
#=GS A0A1B8C619_9PEZI/1023-1338  AC A0A1B8C619.1
#=GS D8PL34_SCHCM/671-977        AC D8PL34.1
#=GS E3RWP8_PYRTT/736-1047       AC E3RWP8.1
#=GS A0A2H3E313_ARMGA/739-1050   AC A0A2H3E313.1
#=GS A4RSC4_OSTLU/543-806        AC A4RSC4.1
#=GS A0A068S1W8_9FUNG/314-615    AC A0A068S1W8.1
#=GS A0A1Y2BZY8_9FUNG/627-778    AC A0A1Y2BZY8.1
#=GS A0A194W342_9PEZI/884-1196   AC A0A194W342.1
#=GS S6E1V2_ZYGB2/238-546        AC S6E1V2.1
#=GS A0A015ICH1_9GLOM/729-861    AC A0A015ICH1.1
#=GS N1J9H2_BLUG1/1253-1564      AC N1J9H2.1
#=GS K2S8P3_MACPH/357-678        AC K2S8P3.1
#=GS A0A1Q3EMC1_LENED/797-1107   AC A0A1Q3EMC1.1
#=GS A0A0D2D3F0_9EURO/1020-1341  AC A0A0D2D3F0.1
#=GS E4V388_ARTGP/978-1300       AC E4V388.1
#=GS A0A2H3TBM4_FUSOX/988-1301   AC A0A2H3TBM4.1
#=GS A0A093VJE6_TALMA/968-1285   AC A0A093VJE6.1
#=GS G3AUA9_SPAPN/578-883        AC G3AUA9.1
#=GS A0A1Y1UUJ1_9TREE/631-939    AC A0A1Y1UUJ1.1
#=GS A0A1E3QJV0_9ASCO/553-862    AC A0A1E3QJV0.1
#=GS A0A0F4GB92_9PEZI/762-1082   AC A0A0F4GB92.1
#=GS I2JV51_DEKBR/424-727        AC I2JV51.2
#=GS A0A0K8LRD9_9EURO/994-1317   AC A0A0K8LRD9.1
#=GS A0A177CSH0_9PLEO/720-1031   AC A0A177CSH0.1
#=GS A0A074WC67_9PEZI/659-972    AC A0A074WC67.1
#=GS A0A167K5Y7_9BASI/639-954    AC A0A167K5Y7.1
#=GS G7XEB5_ASPKW/995-1322       AC G7XEB5.1
#=GS A0A0D2DI38_9EURO/1038-1359  AC A0A0D2DI38.1
#=GS A0A0P7BI94_9HYPO/988-1301   AC A0A0P7BI94.1
#=GS SPC7_SCHPO/877-1190         AC O59757.1
#=GS A0A094IPG8_9PEZI/1044-1358  AC A0A094IPG8.1
#=GS A7EVA3_SCLS1/1041-1356      AC A7EVA3.1
#=GS A0A1F5LZC7_9EURO/959-1285   AC A0A1F5LZC7.1
#=GS A8Q201_MALGO/653-967        AC A8Q201.1
#=GS A0A2K3D2Z2_CHLRE/596-908    AC A0A2K3D2Z2.1
#=GS A0A1G4K5U9_9SACH/430-740    AC A0A1G4K5U9.1
#=GS H0GUR9_SACCK/452-763        AC H0GUR9.1
#=GS D4APN2_ARTBC/956-1272       AC D4APN2.1
#=GS I3EIQ6_NEMP3/272-562        AC I3EIQ6.1
#=GS A0A1L9VIY9_ASPGL/978-1301   AC A0A1L9VIY9.1
#=GS W2RS25_9EURO/1038-1357      AC W2RS25.1
#=GS A0A1E1L7W7_9HELO/1023-1332  AC A0A1E1L7W7.1
#=GS B6K6D0_SCHJY/780-1086       AC B6K6D0.1
#=GS E3Q433_COLGM/1024-1336      AC E3Q433.1
#=GS A0A139HU98_9PEZI/748-1064   AC A0A139HU98.1
#=GS A0A1X7R0J6_9SACH/436-751    AC A0A1X7R0J6.1
#=GS H2AS51_KAZAF/421-735        AC H2AS51.1
#=GS A0A2C5WV88_9PEZI/1057-1369  AC A0A2C5WV88.1
#=GS A0A0D2FUT2_9EURO/1105-1426  AC A0A0D2FUT2.1
#=GS G9P9L5_HYPAI/908-1221       AC G9P9L5.1
#=GS A0A1D2VB96_9ASCO/1020-1325  AC A0A1D2VB96.1
#=GS A0A0D2DJS3_9EURO/1057-1378  AC A0A0D2DJS3.1
#=GS A0A162Y2E5_DIDRA/734-808    AC A0A162Y2E5.1
#=GS A0A1V8TMQ3_9PEZI/854-1170   AC A0A1V8TMQ3.1
#=GS A0A0C3G059_9HOMO/685-1004   AC A0A0C3G059.1
#=GS L1JC32_GUITH/452-744        AC L1JC32.1
#=GS B5RSQ9_DEBHA/630-937        AC B5RSQ9.1
#=GS A0A0L1HLZ2_9PLEO/1057-1368  AC A0A0L1HLZ2.1
#=GS J3K4P4_COCIM/995-1318       AC J3K4P4.2
#=GS A0A1S9DTC4_ASPOZ/1008-1331  AC A0A1S9DTC4.1
#=GS A0A059JDI4_9EURO/978-1300   AC A0A059JDI4.1
#=GS A0A0D0DUX6_9HOMO/816-1129   AC A0A0D0DUX6.1
#=GS E3JT36_PUCGT/1005-1216      AC E3JT36.1
#=GS A0A0D7BAE5_9AGAR/1-297      AC A0A0D7BAE5.1
#=GS G1WY71_ARTOA/986-1299       AC G1WY71.1
#=GS A0A1V6QSG3_9EURO/965-1290   AC A0A1V6QSG3.1
#=GS A0A0A1TFV8_9HYPO/900-1213   AC A0A0A1TFV8.1
#=GS C4JFA5_UNCRE/852-1175       AC C4JFA5.1
#=GS W6MG30_9ASCO/379-679        AC W6MG30.1
#=GS A0A1Y2AZJ6_9TREE/556-867    AC A0A1Y2AZJ6.1
#=GS N1PZS7_DOTSN/700-1015       AC N1PZS7.1
#=GS Q2HG07_CHAGB/294-540        AC Q2HG07.1
#=GS A0A1Y1HMV0_KLENI/1194-1454  AC A0A1Y1HMV0.1
#=GS A0A1D8PQB7_CANAL/610-918    AC A0A1D8PQB7.1
#=GS G3XZH3_ASPNA/994-1321       AC G3XZH3.1
#=GS A0A1A0H902_9ASCO/636-943    AC A0A1A0H902.1
#=GS A0A0D2MHZ0_9CHLO/252-558    AC A0A0D2MHZ0.1
#=GS A0A0J0XXP2_9TREE/882-1188   AC A0A0J0XXP2.1
#=GS G0SF01_CHATD/907-1217       AC G0SF01.1
#=GS A0A1V6NR63_9EURO/956-1281   AC A0A1V6NR63.1
#=GS A0A0A2J448_PENEN/963-1289   AC A0A0A2J448.1
#=GS A0A0D2WL06_CAPO3/784-1080   AC A0A0D2WL06.1
#=GS K0KTU6_WICCF/512-817        AC K0KTU6.1
#=GS E9EBN2_METAQ/901-1214       AC E9EBN2.1
#=GS A0A1E3PST3_9ASCO/981-1291   AC A0A1E3PST3.1
#=GS A5E5H1_LODEL/668-989        AC A5E5H1.1
#=GS F8QD76_SERL3/1-295          AC F8QD76.1
#=GS A0A1B7TF80_9ASCO/227-562    AC A0A1B7TF80.1
#=GS A0A0C3NP96_PHLGI/1-309      AC A0A0C3NP96.1
#=GS M1WAV9_CLAP2/928-1241       AC M1WAV9.1
#=GS A0A151GAQ7_9HYPO/1118-1396  AC A0A151GAQ7.1
#=GS A0A0L6VFA7_9BASI/670-999    AC A0A0L6VFA7.1
#=GS A0A1B8DUD0_9PEZI/1019-1333  AC A0A1B8DUD0.1
#=GS A0A0G2HXR0_9EURO/1040-1364  AC A0A0G2HXR0.1
#=GS A0A072PU39_9EURO/1044-1365  AC A0A072PU39.1
#=GS A0A166J8Y5_9HOMO/675-988    AC A0A166J8Y5.1
#=GS A0A0C3P769_PISTI/1-59       AC A0A0C3P769.1
#=GS I2G3W3_USTH4/809-1114       AC I2G3W3.1
#=GS C5E2H5_LACTC/442-754        AC C5E2H5.1
#=GS A0A067TNQ6_GALM3/790-1101   AC A0A067TNQ6.1
#=GS A0A109FI42_9BASI/748-1085   AC A0A109FI42.1
#=GS W6QAH2_PENRF/954-1281       AC W6QAH2.1
#=GS Q0V4Y4_PHANO/665-976        AC Q0V4Y4.2
#=GS G0RMW5_HYPJQ/887-1200       AC G0RMW5.1
#=GS E4ZUU9_LEPMJ/717-1028       AC E4ZUU9.1
#=GS A0A167Z2W2_9HYPO/935-1247   AC A0A167Z2W2.1
#=GS G2Q100_MYCTT/286-532        AC G2Q100.1
#=GS A0A094BZ75_9PEZI/1048-1363  AC A0A094BZ75.1
#=GS M7NN42_PNEMU/736-1042       AC M7NN42.1
#=GS K5WMV3_PHACS/900-1221       AC K5WMV3.1
#=GS A0A1Y2FXI1_9ASCO/637-947    AC A0A1Y2FXI1.1
#=GS A0A139A6U2_GONPR/834-1136   AC A0A139A6U2.1
#=GS F2STM8_TRIRC/974-1296       AC F2STM8.1
#=GS C9SHA3_VERA1/966-1278       AC C9SHA3.1
#=GS A0A1Q8RBK8_9PEZI/1034-1346  AC A0A1Q8RBK8.1
#=GS H0GG70_SACCK/450-761        AC H0GG70.2
#=GS A0A1V8SXB9_9PEZI/850-1166   AC A0A1V8SXB9.1
#=GS G4TA55_SERID/719-1025       AC G4TA55.1
#=GS A0A1V1T7B6_9FUNG/956-1266   AC A0A1V1T7B6.1
#=GS G8ZYQ8_TORDC/272-592        AC G8ZYQ8.1
#=GS A0A229Z460_9EURO/995-1318   AC A0A229Z460.1
#=GS A0A0U1M356_TALIS/976-1297   AC A0A0U1M356.1
#=GS A0A1F7ZN74_9EURO/1011-1333  AC A0A1F7ZN74.1
#=GS A0A066WG66_9BASI/583-895    AC A0A066WG66.1
#=GS A0A0G2EVI9_9PEZI/1-305      AC A0A0G2EVI9.1
#=GS A0A1J8Q321_9HOMO/1725-2038  AC A0A1J8Q321.1
#=GS A0A066WXN1_COLSU/1024-1336  AC A0A066WXN1.1
#=GS N1Q9P3_PSEFD/751-1065       AC N1Q9P3.1
#=GS A0A1B8FVU0_9PEZI/1024-1339  AC A0A1B8FVU0.1
#=GS A0A0L1ILX7_ASPNO/1025-1347  AC A0A0L1ILX7.1
#=GS L0PA06_PNEJ8/723-1001       AC L0PA06.1
#=GS A0A165PST1_EXIGL/1-307      AC A0A165PST1.1
#=GS C4YB32_CLAL4/578-887        AC C4YB32.1
#=GS A0A177E400_ALTAL/748-1059   AC A0A177E400.1
#=GS U4LG14_PYROM/971-1230       AC U4LG14.1
#=GS X0KTS5_FUSOX/989-1302       AC X0KTS5.1
#=GS A0A0L6WWV3_9AGAR/747-1058   AC A0A0L6WWV3.1
#=GS M7WNI6_RHOT1/784-1122       AC M7WNI6.1
#=GS A0A1E5RRW2_HANUV/134-433    AC A0A1E5RRW2.1
#=GS A0A0C9M0A5_9FUNG/414-720    AC A0A0C9M0A5.1
#=GS A0A162Y2E5_DIDRA/837-999    AC A0A162Y2E5.1
#=GS G7E8S4_MIXOS/651-961        AC G7E8S4.1
#=GS A0A179GZY1_9HYPO/944-1257   AC A0A179GZY1.1
#=GS A0A2H1A7T4_CANAR/681-988    AC A0A2H1A7T4.1
#=GS A0A0W0F5T4_9AGAR/816-1126   AC A0A0W0F5T4.1
#=GS C0NYM3_AJECG/1011-1335      AC C0NYM3.1
#=GS A0A1E5RDG4_9ASCO/373-665    AC A0A1E5RDG4.1
#=GS A0A0A1NXA1_9FUNG/118-426    AC A0A0A1NXA1.1
#=GS M5EKW6_MALS4/374-684        AC M5EKW6.1
#=GS A0A0F2LSN0_SPOSC/1025-1347  AC A0A0F2LSN0.1
#=GS S0DKC7_GIBF5/986-1299       AC S0DKC7.1
#=GS A0A1R3RNN2_ASPC5/1003-1329  AC A0A1R3RNN2.1
#=GS A0A084RJ23_STACH/975-1288   AC A0A084RJ23.1
#=GS A0A176W8C1_MARPO/1171-1495  AC A0A176W8C1.1
#=GS A3IXG6_9CYAN/246-385        AC A3IXG6.1
#=GS T0JZP8_COLGC/1039-1349      AC T0JZP8.1
#=GS A0A2C6A956_9HYPO/141-454    AC A0A2C6A956.1
#=GS A0A0C9YBW4_9HOMO/1-301      AC A0A0C9YBW4.1
#=GS A0A1C7N0J4_9FUNG/1-272      AC A0A1C7N0J4.1
#=GS A0A093ZW74_9PEZI/1023-1338  AC A0A093ZW74.1
#=GS A0A0D2JTF5_9EURO/1022-1343  AC A0A0D2JTF5.1
#=GS A3LTB2_PICST/542-850        AC A3LTB2.2
#=GS A1DFJ3_NEOFI/990-1313       AC A1DFJ3.1
#=GS M7SFR3_EUTLA/773-1085       AC M7SFR3.1
#=GS N1QM58_SPHMS/728-1042       AC N1QM58.1
#=GS A0A0A2LJ13_PENIT/965-1291   AC A0A0A2LJ13.1
#=GS N4TQL5_FUSC1/963-1270       AC N4TQL5.1
#=GS J3P495_GAGT3/958-1271       AC J3P495.1
#=GS A0A1V6V5I0_9EURO/966-1292   AC A0A1V6V5I0.1
#=GS B2WAC9_PYRTR/733-1044       AC B2WAC9.1
#=GS A0A1G4J3W3_9SACH/417-726    AC A0A1G4J3W3.1
#=GS R4XA62_TAPDE/673-984        AC R4XA62.1
#=GS A0A0C9YGQ8_9HOMO/96-214     AC A0A0C9YGQ8.1
#=GS A7SR58_NEMVE/1049-1355      AC A7SR58.1
#=GS U1HQE8_ENDPU/709-1030       AC U1HQE8.1
#=GS A0A151Z514_9MYCE/806-980    AC A0A151Z514.1
#=GS J7R7N6_KAZNA/405-715        AC J7R7N6.1
#=GS A0A0F8UVK0_9EURO/999-1323   AC A0A0F8UVK0.1
#=GS A0A063BXY3_9HYPO/949-1262   AC A0A063BXY3.1
#=GS K1X8X9_MARBU/1056-1365      AC K1X8X9.1
#=GS A0A1W5D2P7_9LECA/1060-1329  AC A0A1W5D2P7.1
#=GS A0A1E3I5K9_9TREE/621-931    AC A0A1E3I5K9.1
#=GS F0XSS8_GROCL/925-1238       AC F0XSS8.1
#=GS A0A238FH77_9BASI/703-1020   AC A0A238FH77.1
#=GS A0A1E3PB12_WICAO/496-801    AC A0A1E3PB12.1
#=GS A0A2H3C1J5_9AGAR/734-1045   AC A0A2H3C1J5.1
#=GS B6HCL6_PENRW/924-1250       AC B6HCL6.1
#=GS A0A1Y2CXJ9_9FUNG/1206-1513  AC A0A1Y2CXJ9.1
#=GS A0A0D2DRC3_9EURO/1020-1341  AC A0A0D2DRC3.1
#=GS G8JPM9_ERECY/427-737        AC G8JPM9.1
#=GS A0A286UQM9_9HOMO/761-1073   AC A0A286UQM9.1
#=GS A0A163K478_ABSGL/570-870    AC A0A163K478.1
#=GS A0A1L0C059_9ASCO/536-845    AC A0A1L0C059.1
#=GS A0A1L9X3H8_ASPAC/1014-1340  AC A0A1L9X3H8.1
#=GS A0A2B7Z916_9EURO/1040-1364  AC A0A2B7Z916.1
#=GS A0A0D1Y5I1_9EURO/1077-1398  AC A0A0D1Y5I1.1
#=GS M2LKC9_BAUCO/773-1092       AC M2LKC9.1
#=GS G4N6Q2_MAGO7/934-1246       AC G4N6Q2.1
#=GS A0A0S6X8Z0_9FUNG/812-1104   AC A0A0S6X8Z0.1
#=GS A0A0G4LS29_9PEZI/1002-1314  AC A0A0G4LS29.1
#=GS A0A0N0NM00_9EURO/996-1315   AC A0A0N0NM00.1
#=GS A0A162MR83_9HYPO/917-1230   AC A0A162MR83.1
#=GS S7S548_GLOTA/22-342         AC S7S548.1
#=GS A0A066WFI4_9HOMO/1-188      AC A0A066WFI4.1
#=GS A0A178BBL0_9PLEO/727-1038   AC A0A178BBL0.1
#=GS W7LD48_GIBM7/992-1305       AC W7LD48.1
#=GS A0A093YDK9_9PEZI/1020-1335  AC A0A093YDK9.1
#=GS A0A1X2IPK0_9FUNG/611-919    AC A0A1X2IPK0.1
#=GS A0A1E4T4T2_9ASCO/537-845    AC A0A1E4T4T2.1
#=GS C1G2V2_PARBD/1026-1350      AC C1G2V2.1
#=GS A0A098VMG4_9MICR/507-616    AC A0A098VMG4.1
#=GS A0A1E4RTQ7_CYBJA/480-784    AC A0A1E4RTQ7.1
#=GS H1VB46_COLHI/515-827        AC H1VB46.1
#=GS D5GNG7_TUBMM/1188-1502      AC D5GNG7.1
#=GS C1H6H7_PARBA/1025-1349      AC C1H6H7.2
#=GS A0A1L9RL35_ASPWE/1027-1349  AC A0A1L9RL35.1
#=GS Q4WHU7_ASPFU/1009-1332      AC Q4WHU7.1
#=GS A0A231MD49_9EURO/912-1235   AC A0A231MD49.1
#=GS S9VPI6_SCHCR/772-1079       AC S9VPI6.1
#=GS V5FZ11_BYSSN/974-1299       AC V5FZ11.1
#=GS A0A0B2WKY9_9HYPO/920-1233   AC A0A0B2WKY9.1
#=GS A0A1J7I8X1_9PEZI/1004-1316  AC A0A1J7I8X1.1
#=GS F0U9T4_AJEC8/1023-1347      AC F0U9T4.1
#=GS A0A165EZH0_9BASI/1-304      AC A0A165EZH0.1
#=GS A0A0W4ZBT3_PNEJ7/648-954    AC A0A0W4ZBT3.1
#=GS A0A1X7RT27_ZYMTR/762-1082   AC A0A1X7RT27.1
#=GS G9MI84_HYPVG/825-1138       AC G9MI84.1
#=GS A0A0B7N5Z6_9FUNG/368-672    AC A0A0B7N5Z6.1
#=GS A0A165E5U7_9APHY/818-1142   AC A0A165E5U7.1
#=GS G0VEF1_NAUCC/455-769        AC G0VEF1.1
#=GS A0A1E4TZZ0_PACTA/749-1057   AC A0A1E4TZZ0.1
#=GS A0A2H3HVE7_FUSOX/988-1301   AC A0A2H3HVE7.1
#=GS A0A1J9QS85_9EURO/1036-1360  AC A0A1J9QS85.1
#=GS S3CNY7_GLAL2/1038-1351      AC S3CNY7.1
#=GS A0A099NXX8_PICKU/455-788    AC A0A099NXX8.1
#=GS A0A2D3VNH4_9PEZI/755-1073   AC A0A2D3VNH4.1
#=GS A0A1C1D140_9EURO/1107-1427  AC A0A1C1D140.1
#=GS C7YIG8_NECH7/873-1186       AC C7YIG8.1
#=GS A6RDR6_AJECN/1023-1347      AC A6RDR6.1
#=GS W9X3Z5_9EURO/1107-1428      AC W9X3Z5.1
#=GS M5BKI6_THACB/1-188          AC M5BKI6.1
#=GS A0A1V6PL49_9EURO/975-1300   AC A0A1V6PL49.1
#=GS A0A2B7XYB1_9EURO/1028-1351  AC A0A2B7XYB1.1
#=GS A0A2H2ZRW7_9HYPO/893-1206   AC A0A2H2ZRW7.1
#=GS A0A1L9UN21_9EURO/997-1324   AC A0A1L9UN21.1
#=GS A9V0C0_MONBE/907-1207       AC A9V0C0.1
#=GS A0A1B8EXG2_9PEZI/1024-1339  AC A0A1B8EXG2.1
#=GS S8EGZ5_FOMPI/1-305          AC S8EGZ5.1
#=GS A0A0B2UIJ6_9MICR/312-514    AC A0A0B2UIJ6.1
#=GS G8YRI7_PICSO/689-999        AC G8YRI7.1
#=GS A0A0F9XCU9_TRIHA/921-1234   AC A0A0F9XCU9.1
#=GS A0A067PUB3_9HOMO/959-1287   AC A0A067PUB3.1
#=GS A0A0A2VL15_BEABA/900-1213   AC A0A0A2VL15.1
#=GS W9XWQ8_9EURO/1038-1358      AC W9XWQ8.1
#=GS A0A094GX70_9PEZI/1021-1336  AC A0A094GX70.1
#=GS A0A0D1YQT7_9EURO/1052-1373  AC A0A0D1YQT7.1
#=GS A0A1V6SII0_9EURO/1003-1329  AC A0A1V6SII0.1
#=GS R9P5V9_PSEHS/788-1092       AC R9P5V9.1
#=GS A0A0J8U1N0_COCIT/995-1318   AC A0A0J8U1N0.1
#=GS A0A0C9XUD8_9HOMO/747-1060   AC A0A0C9XUD8.1
#=GS C4QW80_KOMPG/988-1290       AC C4QW80.1
#=GS A0A1L9TAZ9_9EURO/1033-1358  AC A0A1L9TAZ9.1
#=GS A0A1Y1VGG9_9FUNG/1170-1477  AC A0A1Y1VGG9.1
#=GS W6YTC4_COCCA/765-1076       AC W6YTC4.1
#=GS B6QLK0_TALMQ/969-1291       AC B6QLK0.1
#=GS A0A165I081_9PEZI/825-1141   AC A0A165I081.1
#=GS A0A1Y2GJX7_9FUNG/6-329      AC A0A1Y2GJX7.1
#=GS A0A0C3QEL0_9HOMO/853-931    AC A0A0C3QEL0.1
#=GS A0A074S5S3_9HOMO/801-1111   AC A0A074S5S3.1
#=GS A0A0D1E8A4_USTMA/798-1105   AC A0A0D1E8A4.1
#=GS U5H8B6_USTV1/706-1023       AC U5H8B6.1
#=GS A0A161WJC3_9PEZI/1031-1343  AC A0A161WJC3.1
#=GS A0A1Y2D890_9PEZI/974-1291   AC A0A1Y2D890.1
#=GS G2WTB0_VERDV/1002-1314      AC G2WTB0.1
#=GS W9XMW4_9EURO/1039-1360      AC W9XMW4.1
#=GS M2RRQ6_CERS8/875-1197       AC M2RRQ6.1
#=GS R9AET8_WALI9/1067-1378      AC R9AET8.1
#=GS V5F2T2_KALBG/805-1111       AC V5F2T2.1
#=GS A0A165RIA0_9HOMO/889-1209   AC A0A165RIA0.1
#=GS F2UCV2_SALR5/995-1287       AC F2UCV2.1
#=GS A0A1Y1Z644_9FUNG/684-987    AC A0A1Y1Z644.1
#=GS A0A1G4B5E0_9PEZI/1002-1312  AC A0A1G4B5E0.1
#=GS A0A1E4SR13_9ASCO/555-872    AC A0A1E4SR13.1
#=GS A0A182YTM6_BIOGL/281-442    AC A0A182YTM6.1
#=GS A0A1S7UMN0_ROSNE/963-1274   AC A0A1S7UMN0.1
#=GS A0A0H2SF93_9HOMO/664-975    AC A0A0H2SF93.1
#=GS Q6FS69_CANGA/271-579        AC Q6FS69.1
#=GS B8PD02_POSPM/900-1129       AC B8PD02.1
#=GS A0A1L7WTX0_9HELO/1049-1358  AC A0A1L7WTX0.1
#=GS A0A2C5Y6S1_9HYPO/937-1250   AC A0A2C5Y6S1.1
#=GS A0A067MF32_9HOMO/6-278      AC A0A067MF32.1
#=GS A0A0C3QQ81_9HOMO/1-249      AC A0A0C3QQ81.1
#=GS A0A0C3P769_PISTI/55-251     AC A0A0C3P769.1
#=GS W9IJ57_FUSOX/991-1304       AC W9IJ57.1
#=GS A0A1Y1XAE5_9FUNG/189-499    AC A0A1Y1XAE5.1
#=GS A0A164XPD0_9HOMO/576-889    AC A0A164XPD0.1
#=GS A0A0C4E3R7_MAGP6/962-1275   AC A0A0C4E3R7.1
#=GS A0A1M2VER2_TRAPU/845-1179   AC A0A1M2VER2.1
#=GS A0A1E3QCT2_LIPST/680-987    AC A0A1E3QCT2.1
#=GS A0A1J5X7T4_9MICR/225-532    AC A0A1J5X7T4.1
#=GS V2XP64_MONRO/816-1126       AC V2XP64.1
#=GS A0A1L9MZ48_ASPTU/995-1322   AC A0A1L9MZ48.1
#=GS M9MED4_PSEA3/856-1161       AC M9MED4.1
#=GS A0A167Q7L5_9PEZI/1075-1393  AC A0A167Q7L5.1
#=GS A0A1B8B1Z1_FUSPO/977-1290   AC A0A1B8B1Z1.1
#=GS A0A0L0V7G0_9BASI/909-1238   AC A0A0L0V7G0.1
#=GS A0A1S8VUU1_9FUNG/1-170      AC A0A1S8VUU1.1
#=GS A0A017SDX4_9EURO/979-1302   AC A0A017SDX4.1
#=GS A0A0M8PBR1_9EURO/916-1241   AC A0A0M8PBR1.1
#=GS I1C7V0_RHIO9/320-624        AC I1C7V0.1
#=GS M2XTZ2_GALSU/607-913        AC M2XTZ2.1
#=GS G2Y9N3_BOTF4/345-661        AC G2Y9N3.1
#=GS A0A166FSB8_9HOMO/800-1105   AC A0A166FSB8.1
#=GS A0A2H3F5P8_9HELO/1063-1372  AC A0A2H3F5P8.1
#=GS A0A1A5ZV96_9TREE/621-931    AC A0A1A5ZV96.1
#=GS W3WLP7_PESFW/999-1311       AC W3WLP7.1
#=GS K5X6I3_AGABU/793-1103       AC K5X6I3.1
#=GS J9W032_CRYNH/606-915        AC J9W032.2
#=GS A0A178ZQD0_9EURO/994-1315   AC A0A178ZQD0.1
#=GS A0A1Q2YG24_9ASCO/469-801    AC A0A1Q2YG24.1
#=GS I4Y9V7_WALMC/604-915        AC I4Y9V7.1
#=GS A0A1B9HTF3_9TREE/619-929    AC A0A1B9HTF3.1
#=GS A0A095CFF1_CRYGR/600-906    AC A0A095CFF1.1
#=GS S8AG75_DACHA/1000-1313      AC S8AG75.1
#=GS A0A0K3C8R8_RHOTO/782-1119   AC A0A0K3C8R8.1
#=GS F4PTN4_CAVFA/1005-1224      AC F4PTN4.1
#=GS H6BNJ3_EXODN/1040-1361      AC H6BNJ3.1
#=GS A0A1X0Q9M0_9MICR/173-377    AC A0A1X0Q9M0.1
#=GS A0A180GZ33_PUCT1/881-1208   AC A0A180GZ33.1
#=GS A0A225ASF9_9EURO/989-1312   AC A0A225ASF9.1
#=GS A0A0C3CWU5_HEBCY/774-1085   AC A0A0C3CWU5.1
#=GS A0A0C3NQX5_PISTI/1-301      AC A0A0C3NQX5.1
#=GS A0A086T3C9_ACRC1/951-1264   AC A0A086T3C9.1
#=GS A0A060SMZ6_PYCCI/1092-1192  AC A0A060SMZ6.1
#=GS A0A2H3FDR9_9HELO/1063-1372  AC A0A2H3FDR9.1
#=GS A0A165MEJ6_9APHY/883-1206   AC A0A165MEJ6.1
#=GS A0A084QP57_STAC4/964-1277   AC A0A084QP57.1
#=GS E2LY56_MONPE/1-104          AC E2LY56.1
#=GS Q754X4_ASHGO/438-746        AC Q754X4.1
#=GS E7KNE7_YEASL/449-760        AC E7KNE7.1
#=GS A0A0G2EQW7_9EURO/1044-1367  AC A0A0G2EQW7.1
#=GS A0A167FY55_9ASCO/492-798    AC A0A167FY55.1
#=GS L8X3M3_THACA/1259-1505      AC L8X3M3.1
#=GS A0A179FNQ0_METCM/917-1230   AC A0A179FNQ0.1
#=GS M1VIS4_CYAM1/705-1011       AC M1VIS4.1
#=GS A0A136J1V3_9PEZI/228-540    AC A0A136J1V3.1
#=GS A0A0E9NPH0_9ASCO/808-1115   AC A0A0E9NPH0.1
#=GS A0A1G4JDW3_9SACH/465-774    AC A0A1G4JDW3.1
#=GS A0A067NTX7_PLEOS/773-1081   AC A0A067NTX7.1
#=GS A0A135L887_PENPA/964-1290   AC A0A135L887.1
#=GS A0A166AWE7_9HOMO/1-296      AC A0A166AWE7.1
#=GS K1VDD9_TRIAC/882-1186       AC K1VDD9.1
#=GS A0A0J8RFL7_COCIT/132-455    AC A0A0J8RFL7.1
#=GS A0A284RB98_9AGAR/734-1045   AC A0A284RB98.1
#=GS W7HNE2_9PEZI/975-1288       AC W7HNE2.1
#=GS A0A0D2I3V8_9EURO/1066-1387  AC A0A0D2I3V8.1
#=GS A0A074WLP9_9PEZI/669-982    AC A0A074WLP9.1
#=GS J4H1T4_9APHY/865-1189       AC J4H1T4.1
#=GS A0A0S7DXD7_9EURO/1009-1298  AC A0A0S7DXD7.1
#=GS A0A0D0BJ50_9HOMO/781-1094   AC A0A0D0BJ50.1
#=GS A0A2A9P666_9HYPO/968-1281   AC A0A2A9P666.1
#=GS C5GWX4_AJEDR/1038-1362      AC C5GWX4.1
#=GS A0A2B7X0W8_9EURO/1031-1355  AC A0A2B7X0W8.1
#=GS A0A135TMB5_9PEZI/1007-1337  AC A0A135TMB5.1
#=GS A0A010S3F6_9PEZI/1008-1318  AC A0A010S3F6.1
#=GS A0A0C9YBS8_9AGAR/781-1092   AC A0A0C9YBS8.1
#=GS A0A1V8UPS9_9PEZI/854-1170   AC A0A1V8UPS9.1
#=GS B8MW87_ASPFN/203-526        AC B8MW87.1
#=GS A0A1V6XRF1_PENNA/964-1290   AC A0A1V6XRF1.1
#=GS M2SEL6_COCSN/754-1065       AC M2SEL6.1
#=GS A0A1S8VVD9_9FUNG/815-924    AC A0A1S8VVD9.1
#=GS W9CEY4_9HELO/1043-1358      AC W9CEY4.1
#=GS A0A0G4PVX5_PENCA/965-1290   AC A0A0G4PVX5.1
#=GS A0A0F8BQ91_CERFI/801-1108   AC A0A0F8BQ91.1
#=GS A0A1B9IL92_9TREE/602-912    AC A0A1B9IL92.1
#=GS G4U802_NEUT9/944-1256       AC G4U802.1
#=GS C5FFX2_ARTOC/976-1298       AC C5FFX2.1
#=GS A0A0B1PFS1_UNCNE/1070-1381  AC A0A0B1PFS1.1
#=GS S7ZNJ4_PENO1/979-1305       AC S7ZNJ4.1
#=GS A0A197KGC1_9FUNG/799-1125   AC A0A197KGC1.1
#=GS A0A1S3HL39_LINUN/484-771    AC A0A1S3HL39.1
#=GS A0A250X5U7_9CHLO/652-985    AC A0A250X5U7.1
#=GS S2JFU6_MUCC1/305-611        AC S2JFU6.1
#=GS W0TE42_KLUMD/385-694        AC W0TE42.1
#=GS A0A0C9US15_9HOMO/1-293      AC A0A0C9US15.1
#=GS A0A0G2FYH0_9PEZI/691-916    AC A0A0G2FYH0.1
#=GS C5M8M1_CANTT/704-1003       AC C5M8M1.1
#=GS F9FXI3_FUSOF/988-1301       AC F9FXI3.1
#=GS A0A093Y7L9_9PEZI/1078-1393  AC A0A093Y7L9.1
#=GS A0A0A1ML81_9FUNG/117-425    AC A0A0A1ML81.1
#=GS A0A0J6YH77_COCIT/995-1318   AC A0A0J6YH77.1
#=GS A0A2H3IQE3_9EURO/963-1286   AC A0A2H3IQE3.1
#=GS A0A194XUC1_9HELO/1048-1357  AC A0A194XUC1.1
#=GS A0A177UDN1_9BASI/360-533    AC A0A177UDN1.1
#=GS I0Z2G3_COCSC/869-1150       AC I0Z2G3.1
#=GS A0A094DA95_9PEZI/1020-1335  AC A0A094DA95.1
#=GS A0A1V6S3H2_9EURO/967-1293   AC A0A1V6S3H2.1
#=GS A0A0D1WXQ6_9EURO/1048-1369  AC A0A0D1WXQ6.1
#=GS A0A1E3BTE7_9EURO/979-1302   AC A0A1E3BTE7.1
#=GS G0T0V2_RHOT2/782-1119       AC G0T0V2.1
#=GS G7E8S5_MIXOS/651-961        AC G7E8S5.1
#=GS F2PY88_TRIEC/956-1278       AC F2PY88.1
#=GS A0A0D9N3K8_ASPFA/1008-1331  AC A0A0D9N3K8.1
#=GS M7TGG7_BOTF1/1045-1361      AC M7TGG7.1
#=GS G3JDQ8_CORMM/820-1124       AC G3JDQ8.1
#=GS A0A1G4M9G7_LACFM/481-791    AC A0A1G4M9G7.1
#=GS L8G0F9_PSED2/1021-1336      AC L8G0F9.1
#=GS G8B4Z3_CANPC/579-889        AC G8B4Z3.1
#=GS A0A0U5GRI4_9EURO/973-1051   AC A0A0U5GRI4.1
#=GS A0A1Z5T815_HORWE/814-1136   AC A0A1Z5T815.1
#=GS H6QRP7_PUCGT/768-900        AC H6QRP7.1
#=GS A8N175_COPC7/743-1054       AC A8N175.1
#=GS A0A1B8GRT0_9PEZI/1023-1338  AC A0A1B8GRT0.1
#=GS A0A0M9ETZ1_FUSLA/974-1287   AC A0A0M9ETZ1.1
#=GS E2LY56_MONPE/114-317        AC E2LY56.1
#=GS A0A177VWA5_9BASI/302-481    AC A0A177VWA5.1
#=GS A0A1V6TWA4_9EURO/961-1287   AC A0A1V6TWA4.1
#=GS F4RH85_MELLP/864-1146       AC F4RH85.1
#=GS A0A175W8I8_9PEZI/952-1265   AC A0A175W8I8.1
#=GS A0A0D9P0Y2_METAN/920-1233   AC A0A0D9P0Y2.1
#=GS Q6C895_YARLI/993-1298       AC Q6C895.1
#=GS A0A2B4SNA4_STYPI/1266-1573  AC A0A2B4SNA4.1
#=GS A0A0C9ZID4_9HOMO/39-352     AC A0A0C9ZID4.1
#=GS R1H2E4_BOTPV/170-491        AC R1H2E4.1
#=GS A0A075AYJ2_9FUNG/796-1053   AC A0A075AYJ2.1
#=GS A0A146F1W6_9EURO/978-1305   AC A0A146F1W6.1
#=GS A0A0F4ZK12_9PEZI/1059-1371  AC A0A0F4ZK12.1
#=GS A0A0D7A6F7_9AGAR/1-289      AC A0A0D7A6F7.1
#=GS R7YL22_CONA1/759-1077       AC R7YL22.1
#=GS B8MGZ6_TALSN/973-1296       AC B8MGZ6.1
#=GS L2G7U2_COLGN/1139-1449      AC L2G7U2.1
#=GS A0A0D2XAT6_FUSO4/901-1212   AC A0A0D2XAT6.1
#=GS A0A084G4G4_9PEZI/935-1243   AC A0A084G4G4.1
#=GS A0A177WP16_BATDE/552-856    AC A0A177WP16.1
#=GS A0A061HHV9_BLUGR/1253-1564  AC A0A061HHV9.1
#=GS A0A1Q5UQQ1_9EURO/974-1300   AC A0A1Q5UQQ1.1
#=GS A0A0M8MZ14_9HYPO/1-300      AC A0A0M8MZ14.1
#=GS F9XAQ6_ZYMTI/642-962        AC F9XAQ6.1
#=GS A7TEA3_VANPO/372-687        AC A7TEA3.1
#=GS C3Z3N5_BRAFL/1232-1539      AC C3Z3N5.1
#=GS A0A151WDA9_HYPMA/787-1098   AC A0A151WDA9.1
#=GS J5JZN6_BEAB2/900-1213       AC J5JZN6.1
#=GS A0A1L9SI78_9EURO/1007-1333  AC A0A1L9SI78.1
#=GS A0A0H1BLA2_9EURO/1043-1367  AC A0A0H1BLA2.1
#=GS A0A094K5P6_9PEZI/1019-1334  AC A0A094K5P6.1
#=GS C5DZX8_ZYGRC/321-627        AC C5DZX8.1
#=GS A5DJQ1_PICGU/365-674        AC A5DJQ1.2
#=GS Q2UPR4_ASPOR/1008-1331      AC Q2UPR4.1
#=GS I1RAX8_GIBZE/977-1290       AC I1RAX8.1
#=GS B8PD02_POSPM/1145-1245      AC B8PD02.1
#=GS A0A074X772_AURPU/1036-1349  AC A0A074X772.1
#=GS A0A0C3K0Z9_PISTI/718-887    AC A0A0C3K0Z9.1
#=GS A0A094BHH9_9PEZI/1023-1338  AC A0A094BHH9.1
#=GS A0A179V6E8_BLAGS/1038-1362  AC A0A179V6E8.1
#=GS A0A0C3H278_9PEZI/1017-1329  AC A0A0C3H278.1
#=GS A0A1B9GFG8_9TREE/612-922    AC A0A1B9GFG8.1
#=GS A0A1B7NIV9_9HOMO/1-301      AC A0A1B7NIV9.1
#=GS Q6CMN2_KLULA/359-668        AC Q6CMN2.1
#=GS G8BYU6_TETPH/375-689        AC G8BYU6.1
#=GS W4YQ16_STRPU/177-477        AC W4YQ16.1
#=GS A0A1U7LQ09_9ASCO/622-916    AC A0A1U7LQ09.1
#=GS A0A0D2ALJ7_9PEZI/657-977    AC A0A0D2ALJ7.1
#=GS E9EMZ7_METRA/920-1233       AC E9EMZ7.2
#=GS A0A0D2Q3C6_9AGAR/791-1099   AC A0A0D2Q3C6.1
#=GS G8YQ26_PICSO/630-940        AC G8YQ26.1
#=GS Q3ADU7_CARHZ/25-171         AC Q3ADU7.1
#=GS H8ZAX4_NEMS1/343-551        AC H8ZAX4.1
#=GS A0A2C9JB98_BIOGL/301-462    AC A0A2C9JB98.1
#=GS F7VXL3_SORMK/922-1234       AC F7VXL3.1
#=GS G2R2Z2_THITE/944-1232       AC G2R2Z2.1
#=GS W4KQB8_9HOMO/732-1046       AC W4KQB8.1
#=GS B0CP32_LACBS/763-1074       AC B0CP32.1
#=GS A0A1E3HN69_9TREE/573-882    AC A0A1E3HN69.1
#=GS Q5K7X6_CRYNJ/607-916        AC Q5K7X6.2
#=GS E1Z4S1_CHLVA/978-1259       AC E1Z4S1.1
#=GS K9FMP0_PEND2/839-1165       AC K9FMP0.1
#=GS A0A1E5LD70_9BACI/4-176      AC A0A1E5LD70.1
#=GS A0A1Y1YX26_9PLEO/62-373     AC A0A1Y1YX26.1
#=GS Q0CRL4_ASPTN/979-1302       AC Q0CRL4.1
#=GS E9DCB7_COCPS/995-1318       AC E9DCB7.1
#=GS A0A0U5GP06_9EURO/1-207      AC A0A0U5GP06.1
#=GS SP105_YEAST/450-761         AC P53148.1
#=GS A0A2B7Z4E0_9EURO/981-1304   AC A0A2B7Z4E0.1
#=GS W6ZF36_COCMI/756-1067       AC W6ZF36.1
#=GS C1N444_MICPC/1049-1310      AC C1N444.1
#=GS A0A060SMZ6_PYCCI/896-1096   AC A0A060SMZ6.1
#=GS A0A0C3D2Y8_9HOMO/700-1013   AC A0A0C3D2Y8.1
#=GS A0A0L0NBI9_9HYPO/955-1268   AC A0A0L0NBI9.1
#=GS M5BLY7_THACB/109-180        AC M5BLY7.1
#=GS Q7SFZ1_NEUCR/945-1257       AC Q7SFZ1.1
#=GS C6H8N0_AJECH/1023-1347      AC C6H8N0.1
#=GS W1QBC7_OGAPD/427-731        AC W1QBC7.1
#=GS A0A0H5C7N5_CYBJA/480-784    AC A0A0H5C7N5.1
#=GS A0A1Z5SWG2_HORWE/923-1245   AC A0A1Z5SWG2.1
#=GS M5FU62_DACPD/637-952        AC M5FU62.1
A0A0L0HRB8_SPIPN/623-927               ....................................epnava------TVKEFLQATGIYF..QD.N...................lTTS...FRR..ETNAYLRTSE.......................----QPTDIDYYRAALLWSSELDTYEFGCKELQKYIED.IREELIQI....EE.DA.....EAN..V....PPIFF.....DVV............DG..............T..S.EE...RA............L.................IQR...Q...LKATRSITRAEAKESWHVWRA..NL..L..NNLSE..DFTCNLERL....EKD.ERIIQKFADRN.ADMITEGQKYRS...QKMIELESARN...........RLAEEEQ.............SD.NDRLVALK.RREA....EQQ....ARLL..E...........L...........K.AESEQLRLLC.DQEQ...AR...ESELL.RKKDLLY.QAIENAE...NICK.....E.LM....IF..D.PE.ELS.TLR....................S.....EYKLLTSMFP.WTTVH.IA......................SNK..YILAY...DNA...I.EVAF----ik.......................................................................................
E6ZJN2_SPORE/795-1101                  ......................................qvpv----QMPLNNFLRFVGVHF..ND.D....................MSA...LRR..KPVPPTKAEQgade...............gaaaGSYGGVSMMRLVKAACGSAPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PDFVR.....EIM............GL..............Q.nE.EE...RH............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVNTKKEQLqQEILPVLRVKHA...KLKADLALAKQ...........RQAEIET.............CD.ADELKGLY.SSIE....EQH....EVLE..S...........M...........R.AKLMDVEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRIL-.--......................---..-----...---...-.--------dngfdptl.................................................................................
A0A0F7TL75_9EURO/980-1306              ..........................................EEAEPIQLQDFLNMTNVHF..ME.L....................TTT...KRR..HTTAPGSASKrlsra.............slenvAKQGVITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EV.ET.....YED..N....PPLFH.....EYM............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLHRHVKDM....KAD.DELLSKSESLL.ESTVPPLVEKHA...SLQQEATNLQQ...........LVEEMES.............CD.QDELRGAR.EQLS....SVE....EEIE..A...........R...........K.RELEQLQAEA.QEKT...NI...IEAGS.ELRDEYL.AQIQEAE...RVKE.....E.CR....GW..S.AR.DIR.ELK....................A.....SVQKIEHQTG.WSIIL.AStpe...............essaSPM..LTMSY...RGQ...L.QIKFHPG-a........................................................................................
D3BDP6_POLPP/721-937                   ........................................ss--IKKITFNEFLYLSNCRF..LD.Dp..................sSKS...KRP..SLVGMLVN-N......................tDENDGTDLRSQLVAAYCYNRQNVTFRAGYDELKGMITS.INEFNRLA....EE.KM.....NQQ..N....PPIFA.....LIQ............RS..............T..K.DD...LI............S.................KQH...L...LKKIKNSTKLSTQSTYIQWRC..EL..E..RKVSS..ELTLSKQQL....SAD.LAALAERIEQT.KNTEHQLLMEFQ...YLKNHQHQQEL...........QKQKLSE.............KI.ANKTNATD.QKL-....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------vnqlnde..................................................................................
R0I7L4_SETT2/751-1062                  .........................................p-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPAAFRDv.....................eVEEKEESLDSFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RA............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..KDLKA..GLLHTMDGF....KRD.ESTLVNQEQLL.DVVLPPLVEKKE...LLSTECKQLQQ...........RHDELNS.............CD.RGELESTR.EQLT....ATN....AELE..E...........K...........K.QLLAQLQKEL.ADKE...AR...IEAAK.NRKVECM.EEIKAAE...RVRE.....E.CR....GW..S.TS.EVS.NLK....................A.....QVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFSPS-a........................................................................................
A0A1C1XQG0_9PEZI/997-1309              ..........................................EDEDRIHLQDFLNLTSIRF..ME.L....................TTT...KRR..HTILPSARKSs....................isGDKDSLSLEQCVVAGACTVPMLELFQHCCRELKKYISE.GRKIVREI....ET.ET.....FQE..N....PPLFR.....EYI............TA..............S..P.EF...KN............L.................MDN...Q...FKNVKTNARLLSKAMWYDWRM..KL..Q..DGLRE..GLVKIAEGM....MAD.EQLLERQQKLL.ASVLPAMAKQLD...TLTREYENLDA...........VASELED.............CD.PRELESAR.ADLA....SVE....DDME..L...........K...........N.EEIAQLREQF.TASE...QM...VDQLV.DQKQRYN.ADIKEAE...RARE.....E.CR....GW..S.SA.EIS.GLK....................A.....RVDAIEKRHG.WAITG.VV......................GTS..VSVSY...RRE...I.ELVFNTT-s........................................................................................
Q5B2K9_EMENI/984-1307                  .........................................p-EFEPIHLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSISKraarl.............slegdGKSSASNFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAD..N....PPLFR.....EYM............AA..............A..P.DI...RL............L.................MDN...Q...FRNVKTHTRLLSKATWYEWRM..KL..L..EGLKE..GLDRHVEEM....KGD.DNLLSKHEAIL.KDAMPALSAKHS...SLKEEAAQLQQ...........LADELEN.............CD.QDELWNAR.GKLS....DLE....EEIA..A...........K...........R.QVLEELQTQI.QDKT...DT...IETGT.ELKAEVM.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIR.ELK....................D.....SVHRIEQRTG.WSISS.ASss..................etGLA..VTMVY...RHQ...L.QLKFYPA-s........................................................................................
G0WFY6_NAUDC/508-824                   .......................................nvt-----YSLREFLDKTDVSF..LI.Dp.................gkVKL...KDK..KITFMYMDSN.......................SSDISLPINKLYNALYVDVPVLEMNAFICKELFRKISQ.SKQSFEDL....ET.QI.....SSS.vP....PLLLK.....EYF............TS..............S..E.EM...KK............L.................MND...Q...MQLVKMYSKLEAKKAWYEWRK..LH..L..NGIKN..VLIENLALL....QEE.LERTKSSLQKL.YETRKRIEEIKD...SLKYEVKLLKEmp......pnsVASEPTL.............ED.KVKLASLK.QELI....AHK....ITLE..-...........-...........-.-SLPDLQKKN.DAIR...LE...IEEKT.NKLSKLK.EELSHLD...TEDN....tT.TA....LL..E.KG.DIT.VLS....................A.....KLKYLEKMLH.VRATR.FV......................GSL..LTLEF...DLDdglI.ELTINI--sn.......................................................................................
A0A090MDR7_OSTTA/642-911               ........................................ms--SKPIDLETFFHACEVSF..ME.A....................KNM...GRR..SSIALGGLAS.......................-APPPETQPEALRLCCLTAPLIEALEGFHTELQERMEQ.LTSETDKL....RT.TV.....EAT..Q....PPLLR.....YAS............SD..............D..P.AH...LN............E.................LRR...A...GKALKKECQLASKERFAQQKM..ET..E..QLVSE..SLNFHSEIL....VKS.SQSIANSRAIA.AEAISSANGHII...KLRAQRAASSR...........RADAAKSasatkeqvlealaIK.RAALAAAR.RALT....ASD....ERVE..Q...........M...........K.GRKLVIKGER.ERLQ...EE...LEAMR.EAQDA--.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------aadttvniksfgg............................................................................
A0A1U7KZV3_9APHY/834-1158              .........................................g-DEPTISVEQFFEMTGIKF..MD.Q....................ITA...PRR..STIHPGQLHPpnrrrsl........tasrsdeeASPDPVPLAEFLIAMAVEVPQLELYGVLAPELSAWIEE.SKKICIQA....EE.DA.....VKV..T....PALFR.....EFA............AA..............D..E.SE...KS............D.................LLH...Q...LKLIKAHNIGMAKSQWYDWKS..QW..V..GQLQN..SAAEAFSNL....ESD.AKVLEEIIGQA.QEILPGLRDEYD...QVMRELEKEEK...........DVSELEK.............SD.KDYLNELK.MTIA....EQD....TEIQ..A...........S...........Q.ANVSEAKAKL.ERLE...EK...LVEIE.TQKQENS.SAIEEAQ...RIVH.....I.QT....ES..T.SS.EVF.RLK....................A.....ELEALQDLHL.WRTTK.ID......................ASL..MQFVY...AAR...F.DVSIPC--in.......................................................................................
A0A094DXF8_9PEZI/1016-1330             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNSAAKdg..................segQMKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KR............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVMAKQQELL.DNVVPGLVQQYE...ALLQQESDLQT...........SAEEIAN.............CN.QDDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...SR...FNIAT.ERKQACL.DEIREAD...KVRE.....E.CR....GW..S.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RGD...L.ELVFDAS-s........................................................................................
A0A1V2L328_CYBFA/532-831               .........................................a-EYQPVSLAQFLNDLSIEF..FD.D....................LNI...NDD..FTVEFKSLPE.......................--SHKVSDSEYAIAKNTKIPWLELYSFSCDELQKNMQQ.LKVLFDNL....DT.EF.....ADE..N....PRLVR.....EYY............ET..............K..S.IV...QQ............K................kMGD...A...LIRMKQYSDYESEKAWSSWRE..KL..L..DELQI..RLQKNLDSV....QLD.CQDMLNALTEA.EELKRSAEEEAA...AADNEYVSLLK...........QKEIIDS.............QD.YENVSRLQ.HELL....MEL....TTLK..T...........K...........Q.DDLQSLEQKL.NNLD...KE...NAELA.ALEQEVE.EMKVQLN...RQSQ.....D.PA....MR..L.NT.ELQ.ALE....................-.....---ALQQMIG.MNIEV.AK......................---..-----...---...-.--------ykaritlkfdevsil..........................................................................
A0A137Q8V4_9AGAR/788-1098              ..........................................EEVPSVSIQQFFSMTGIRF..MD.E....................LTA...PRR..SIHPHTGNRQ......................aRNPTDIPLSEYYIAMGIDVPQLGLFTRVSKDLERWMTR.SKADFAQA....EE.EA.....AKI..T....PELFV.....EFM............RA..............D..E.EG...RA............E.................LLH...Q...LNLIRVNARGQAKSDWYDWKL..RW..V..EGLQS..TGEQAFNDL....QKD.AKSLEPLKKSA.EELAPTLEKEYN...DILKELECEQQ...........EVAEIEV.............SD.QEYLNDLK.LSIA....EQN....IEVE..A...........L...........H.AELSEHTEQL.NYLQ...GR...LEELV.IGKKEAT.EAIAKAR...HVLQ.....M.KE....NS..T.RT.EVF.RLR....................D.....ELETLEDLHR.FHITK.VD......................ERT..FEYIY...ASH...F.RVIIPCN-k........................................................................................
M2U7I0_COCH5/758-1069                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPSAFHDv.....................eVEEKEESLDRFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RA............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKS..GLLHTMDGF....KRD.ESTLINQEQLL.DVVLPPLVEKKE...LLSTECKQLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....VELE..E...........K...........K.RLLAQLQKEL.ADKE...AR...IEAAK.SRKVECI.EEIKAAE...RMRE.....E.CR....GW..S.TS.EVS.NLK....................A.....QVAALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFVPS-a........................................................................................
A0A0C2TUJ2_AMAMU/783-1095              ..........................................EEIPSISIDQFIAITGIRF..MD.E....................LTV...PQR..SSHPPRHRHTr....................qaRDESEIKLSEYFASMAIDVPQLELYTRVANDLEAWMEQ.SRSVFAQA....EE.EA.....AKI..T....PELFV.....EYS............RA..............D..E.EG...QA............E.................LLH...Q...LNIIRTNVRAQARSDWYDWKY..QW..V..QGLKV..TADKAFDAL....EED.AKTLEQISTLA.DEIIPELEREYE...RVMRELEQEKA...........EVAEIEA.............SD.QDYLNELK.SAIA....EQN....IEVE..A...........L...........K.AEVAEGDSRL.QRLQ...ER...FEEIE.AQKRGNS.TAIADAK...RVLH.....E.PK....SS..T.RA.EVF.NLK....................E.....ELEYLEDLHM.FKLIQ.ME......................ADI..FQYIY...NSQ...F.QVTIPCSN.........................................................................................
A0A1J9RM42_9PEZI/750-1073              .........................................e-PVARIKLQEFLDMTNIRF..MD.L....................TTT...KRR..HTGYPGAQNAfgrgt.............slsaaEIEGKDDLETCVVAAACTEPEYLMYQHACHELKKYISE.GKNLVRQI....EN.EV.....HEE..N....PTLFG.....EYM............SA..............P..A.DQ...RQ............V.................MDI...Q...FKNMKTNARLRTKEAWYGWRS..NL..L..HDIKA..ALAETLDSF....DQD.DAAFKEQEQII.DTALPALQDRHA...HLESECGQLQR...........RAEELNG.............PD.REELDAAR.ERII....AAE....AAIE..E...........K...........K.RKVEALQQQL.AEKE...AG...IEAAK.ERKVECA.EETKAAE...RVRE.....E.CR....GW..S.VD.EVN.ALK....................A.....RVSDLEKQHG.WLITS.ASas..................aeSKT..VTMSY...RND...L.QLFFHPA-a........................................................................................
N1RB31_FUSC4/963-1283                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE....aE.CR....GW..T.ST.EVN.SLKvtn..............tvlA.....RVDSIEKQCG.WSVTG.IS......................GTV..ISMAY...RRE...I.EIVFDIA-a........................................................................................
A0A139IQD8_9PEZI/751-1067              ..........................................ENIEPVGLQDFLSKANIRF..MD.L....................TTT...KRR..LTTAVPPSQTkg..................sqdVQAEQVDLESGVVAAACTIPELELYQHACHELKRFTKE.GKRVIGEL....EQ.ET.....RKN..Q....PPLLQ.....VYM............NA..............S..P.DR...KI............V.................LDA...A...MRDMKTNARLRSKEMWYAWRS..QL..L..EELMG..GLSKIGEGL....IQD.VEILTQSEEVL.DEALPPLVKQHE...ELQQEADTLEK...........TVKAIPE.............ED.KVQLNVAR.ETLV....DIN....NTLA..E...........K...........R.KLLADLRRKV.EEQD...SL...AEHLQ.DSKLELT.AAIQESN...RVRE.....A.CR....GV..S.IE.EVS.KLK....................E.....SVARIESESG.WTITS.ASs....................sPST..ITMTY...HSQ...I.QLFFHPR-a........................................................................................
A0A150VCP5_9PEZI/777-1095              ........................................qs--MQKLHLQTFLEQANIRF..MD.L....................TAT...KRR..LTTAPTPSKArkd................ngagEPDSDLNLGNAVVAAACTQPEHDMFQHACHELKHYISE.GKKVIKQI....EV.QT.....YRD..T....PPLIA.....AYM............AA..............S..A.YR...RG............E.................LDV...Q...MRDMKTHARFRSKEVWYAWRS..QL..L..DDLVK..ALSGIGEGM....IKD.DAVLGRTERIL.DQCLPLLLEQHK...NLQLEAARLQE...........AAASTSE.............ED.KERLDAAR.DRIV....EID....AEME..E...........K...........R.RILAEVQSEA.QELE...RA...IEKMR.DNKAECV.SAIQDAE...RLLE.....S.CR....GF..S.LN.EVN.VLK....................S.....SIKQLEDVHG.WSIIS.ATp....................sPPA..LTMTY...KSQ...L.QLFFHPN-a........................................................................................
A0A0K6G5J6_9HOMO/1163-1474             .........................................d-DMPTISASDFLKMTRISF..MD.G....................LTV...KRR..STIGLGILSRrk...................sgEKQPVASIADYVTAMTIGVPQLETYNYAAKELKEYISN.GKKAIKIL....EE.DL.....DAN..N....PYLFK.....EYL............AS..............G..E.ED...RR............A.................IEE...T...LGGHKEAMRMRSKMSWYKWRH..NF..V..SEMQA..AADRETELL....QQD.LESLQAVGTQL.TEPIPSLREQHA...KLKAQLAAERA...........AVEAAKD.............CD.PEIMGELK.VGIS....EQS....AQIE..S...........Y...........K.ADIQSSTAKL.EKLK...VK...LEEAE.TDKRALQ.DQIRVHQ...EKLD.....-.-A....LH..P.TV.EIV.NLR....................E.....EFDKLQRLHL.WHAVK.LE......................EKF..IELRY...DNH...Y.RVQLEC--va.......................................................................................
A0A0C9YGQ8_9HOMO/211-373               .......................................ldh-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....TKD.ANFLEEIIREA.PGILPSLQQEYD...QLVEELEQETA...........EITELEA.............CD.QDYLKELK.ASIA....EQG....MELD..N...........Y...........R.QEVEEAKAKL.GRIE...EK...LKEVQ.TEKNEVS.ASIEKTE...WLIN.....V.QK....NS..T.HA.EVF.RLK....................G.....ELEMLQTLHM.VHITK.VD......................AKR..FEFVY...GSN...Y.VMS-----tccvec...................................................................................
A0A194S0Y7_RHOGW/914-1240              .......................................pal----PASLDAFFTATGTSF..VN.Dvval...........vdvekSAA...NRR..KSMAAPSTDA......................rGPSGPPTYADLAVVGACKSLIHRLYTNDSHILSEQIDE.LQHMVRQQ....EE.AI.....RQG.qV....PPIFR.....TWT............TA..............S..E.EA...KN............V.................IKT...Q...LGQIKLHYLLASQLEFTSARS..TN..F..GQIVD..AMEQSFVDI....KHD.RALLAR--SEV.ATVIPDLEARHI...ALHAELEAERQ...........LDAQLSA.............MA.PEDVEFRE.SLLA....DSE....EQEE..Q...........LngnaakgipgqR.PELDRIKQHL.ISYE...DT...FDKYS.TEEARLA.DEISMLE...ELRR.....D.K-....-R..S.KA.DLV.RLR....................A.....DFDALQHLQG.WTLVR.FD......................PTE..VEMRC...GDD...F.VVRL----gfek.....................................................................................
M3JDA0_CANMX/487-783                   .........................................h-ESSPVSLSQFLADVGVQF..YD.D....................LKF...QKI..TTLEQEKPIR.......................ITTDPPTLHDYITAKP-YLTLLALYEFCNSELSRDVDA.DRKMYEEF....AK.HV.....ETN..N....PAFLE.....KYY............EL..............D..E.KD...RA............T.................ANI...K...ILFLRDYAKLKSKETWYTWRN..RL..V..ESLIE..QLDKELSAL....NND.KSNLVKNKEKL.DVLYERSTKYLQ...ELSKKYDELKN...........GK-----.............VS.PTEIENLK.LFVS....TGG....QDMR..K...........I...........A.KELNEKEEEL.KRIS...EK...VQENQ.SKRRTLQ.SELR---...---T.....K.PK....PI..D.EN.NIE.SVY....................Q.....HYKTMDNLSD.VTFSE.Q-......................DNK..ITFLL...DNA...L.HCDLDFN-q........................................................................................
A0A194V2H0_9PEZI/932-1244              .........................................d-DEDRMHLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIVPSARKDs....................lsSSKKDISLEKCVTAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FLE..N....PPLFR.....EYI............SA..............S..P.EF...KL............L.................MDN...Q...FKNVKTHARLQSKAMWYEWRM..KL..Q..EGLRE..GLFKTAEGM....SAD.GRLLDQQQKLL.SSVLPALLKQVE...ALDRECENLEA...........VATELKD.............CD.PEELESAR.ADLV....AVD....ADME..A...........K...........A.REIAQLREQL.QETE...EN...VGQLV.EQKQQYS.ADIKEAE...KIRE.....E.CR....GW..S.ST.EIS.ALR....................S.....KVDAIEKQHG.WAITG.IA......................GTS..VSMTY...RKE...I.ELVFDMA-s........................................................................................
A0A068SAT4_9FUNG/384-688               .......................................par---ESYSLREFLKKADIPW..KE.L....................GKM...KEI..EHTQLDHPLT.......................---RTVSTHEKAATVA-SLQELEAYKNYTSSLQELVQD.NQDGLREQ....ER.KV.....NAS..H....PRIIS.....QYT............HA..............D..N.EE...KT............R.................IQK...E...LQKWMKMGKAKANETLLEWKL..AE..T..EEMLQ..TWDTFMAQA....DED.LRQLSDYDRFL.SSKKPILRLDAT...RLQHQLEEAKQ...........REAE---.............YNtPETIA-TI.SDIE....NHR....LSLE..Q...........H...........Q.KDIQSLKAEQ.AQLE...GY...VLTLD.QRKSELD.SEISLLT...QRLE.....S.LR....RHsfT.GR.DLI.DAK....................E.....KYEACGKIGG.WEIIN.WT......................DEE..TELTL...DND...I.NIVIDHS-k........................................................................................
A0A0C7MXN5_9SACH/387-700               .........................................s-EVESLSLGAFLDTVGIKA..HR.D....................I--...EKS..TTVNKLGFGK......................vSENGHGVAVDVYRALYANMPILEIYAFCCKELLRRVQR.SKLLFEEL....EQ.QI.....GTS.aS....SSLFK.....KYL............DS..............Q..G.AT...RD............K.................MNG...R...ITLLREYSRLQAVKVWFGWRL..GH..L..KGIKN..VLQENLFTL....REE.LDVLSTRITHV.SDIKNRIFEIKQ...NIVREIRVCKEss.......kfKKNNCGSp..........tvPD.RIKIESLK.AELK....DGL....KDLE..-...........-...........-.-KISEMSKRA.EALR...IQ...VKTTK.QKVIEAQ.KEIALLN...SRIK.....T.SS....KF..T.KY.EVP.KLR....................V.....IFEMMQRLSG.VLLRQ.YE......................GSV..LKIEL...QGS..pF.VLNFDVT-k........................................................................................
A0A2C5Z1T2_9HYPO/968-1281              .........................................v-EEEKIHLQDFLNMISIRF..ME.L....................NTT...KRR..HTTAPGSGRDgd...................ssEERDGLTLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....ES.ET.....LEE..N....PPLFR.....EYM............TA..............G..A.DV...KA............L.................MDH...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLRE..GLVGIAEGM....DAD.DKALKEQQDMV.ASVLPGIVTRYE...SLQEESSSLRE...........AARELAD.............CD.PAELASAR.EQLM....SLD....ADVA..T...........K...........K.QQIAELRKQL.QDST...AE...VQELG.SRKMECV.QAIEACE...ETRE.....K.YR....GW..T.SR.EVK.ALR....................A.....RVDAMEKKHG.WAISG.LS......................GSS..LSMTY...RRE...I.ELLIDV--cs.......................................................................................
X0CY59_FUSOX/988-1301                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEERNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
V3ZM97_LOTGI/915-1213                  ..................................pnepwtyd---------MFCEKMSIYT..VD.K....................GST...RRA..SIVLKEK---.......................--VDMESFQEVLEARLTMVPQCQLLDSTIKTIEEQQSK.ETDIVDRY....KE.EV.....DTN..E....PDLFK.....TVR............EG..............L..E.T-...-S............D.................IRK...E...VLRMTRACKQLAKQQWKNLKI..QT..T..KIYHE..QIKKESVEL....ENG.VKVILDHAADI.TQQCLHLDKACT...DIDEAIERLQNt........tqAVEENNS.............QN.KQDLDQLQ.SALE....EKN....KYLK..D...........M...........E.IAVVEREKEL.QEIE...AK...SIKL-.-------.ENTRHQQ...PDIT.....I.DV....SS..K.ES.ELK.ELK....................K.....KLEYFKLIHE.WSV--.--......................---..-----...---...-.--------dfdsitenggtflflnktislnvhyk...............................................................
I2GZ03_TETBL/495-806                   ........................................pt----QISLTQFFRDIECNL.dID.S....................FNI...KSL..SNTRIKFPVD......................sNNNKNIRLKNCLINLYLNIPMIEINSLICNELTSKINQ.SKKEFEFL....NE.QI.....SKQ..NidnlPNLLK.....SFY............NC..............N..NvED...KK............K.................LIK...D...LSLTKDIASLNAHNDWLVWHT..NN..L..INVNE..NLNENISIL....KER.LKELDKDLQTA.NDIKLDVMNLKD...QIMTKMNSLKN...........KLGT---.............--.NTTLPNVS.YNSE....LIE....RKIEliR...........L...........K.NKFK----EQ.KIKV...ND...LSVLK.YEKNKLL.IKLSEQN...RLLS.....Q.MN....SK..A.NN.NNN.NSM....................E.....KFLALQNLTQ.IKLIS.FV......................DYF..ITIKF...IEK...I.--------ildepielilkl.............................................................................
A0A100ICU5_ASPNG/997-1324              .........................................p-QFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLDRHAQEM....KAD.GDILSKHEALL.TGVVPGLEEKHS...ALEKEATTLQQ...........LADEMEN.............CD.QDELRSTR.EKLS....TVE....AEIE..E...........K...........R.RRLQEMQEEL.KTKT...DT...IESGT.ALKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..ITMSY...RNQ...L.QLTFHPA-s........................................................................................
U7Q5G6_SPOS1/1025-1347                 .........................................d-DAERIHLQDFLKLANIHF..ME.L....................ETT...KRR..ATEGPGALNKdsgnsh..........srlstdeDGKPKDPEIESLVTTVCKVPLLEMYQHACRELKNYIEE.GRSIMREI....ET.ET.....YED..N....PPIFR.....EYT............TA..............T..P.EM...RA............Q.................MDN...Q...FKNIKIFARLQSKKQWYEWRT..KL..H..EGLQE..GMLKVLRDL....QKD.KDVLKERRDKV.DAVYPALLAEYE...ALERERVQLET...........FAAQLGG.............DN.QEALIAAR.VQKS....RLA....ETIE..E...........H...........K.GATARLETEM.KESR...AR...VAAMK.TEREQYL.KELEEAK...RIQE.....E.RR....SW..S.HQ.EIS.SLK....................T.....QVDALEKKSG.WAVTG.AQ......................GTT..LSMAY...RRE...I.ELVFDVA-a........................................................................................
A0A166VZ08_9PEZI/1029-1341             ........................................qa--EDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKDg....................lsGGKEDMSLEHCVIAGACTVPMLELYQHSCRELKKYISE.GRSIVREI....ES.DT.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............V.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....AVD.DKVLLQQQKLL.SSVLPDIVSRFT...ALQQEHENLQA...........VAEELAD.............CD.PEELEAAR.SDLA....NIE....NDIE..E...........K...........T.RRVAELRQQL.EEAE...QG...VEELT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IG.EIS.TLK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..ISMTY...RRE...I.ELVFDMA-s........................................................................................
A0A0L0S3J4_ALLMA/805-1103              .................................dlpltrria-------------------..--.-....................---...---..----------.......................--------TDIYPALVVHLPELDVHHTMCADLVDRIHE.IDESNAAQ....LA.EA.....EGT..V....PAFVR.....RYR............EAve..........mgD..D.EE...RM............E.................LAE...K...ARMTATGARRFALHAYNQAWA..GQ..V..QGLVA..TYQASREAL....VHD.NAVLDEHVRTL.SEAKSVLQDAIE...EDIEARRKLRA...........EHETHMA.............RL.NGEVRAAR.EELE....SIR....ARRL..D...........V...........E.RRCQHIREES.RALE...TQ...VHTQQ.IRAQNLQ.RRIVEVD...REAQ.....Q.YT....FF..T.ID.DWK.RVR....................D.....ECDLITNLTG.WTVDV.VApvadvrepvpvadlleraagnrGTR..LVFTY...RST...L.RVEYDVK-g........................................................................................
A0A094G0Q2_9PEZI/1011-1326             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATAQdgs.................edqLRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLDKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........AAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FNIAT.ERKQTCL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RGD...L.ELVFDAS-s........................................................................................
A0A1V6QCX9_9EURO/949-1275              .........................................p-ETEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPSSATKkltra.............sgdnlPRPRSVTFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFR.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHVEEM....KAD.DDMLTQREELL.NSNVPPLLEKHA...ALEKEATNLQE...........LVDEVEN.............CD.QDELRSTR.SKLS....EVD....IEIA..A...........K...........K.RQLEELQAEV.QEKT...TI...IEAGS.ELRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIERQTG.WSIVS.VTtps...............eeqtGPV..LKMAY...REQ...L.QLEFSPG-a........................................................................................
A0A0B4HIU0_9HYPO/920-1233              .........................................a-DNERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..LTVAPKSLHDgs...................sgDGEDDMSLERCVIAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....ED.ET.....YEI..N....PPLFR.....EYM............CA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLISISEGM....DAD.EQMLKEREELL.AAVLPGALERHE...QLEEESENLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLE....ADIE..A...........K...........K.RLIGELRGQL.ESST...SK...AEELA.AEKQSLM.TSIQQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................S.....HVDALEEEHG.WAVTG.LS......................GTS..LSMAY...KRE...I.EVVFDVA-s........................................................................................
A0A162KX25_CORDF/929-1207              .........................................n-DSEKIDLQDFLNMISIRF..ME.L....................QTT...KRR..HTTAPGTLQGgt...................tvTGEDDMSLERCVVASACTVPMLELYQHSCRELKKYIAE.GRRMVKEI....EA.DT.....FED..N....PPLFQ.....EYI............TA..............A..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRT..KL..Q..EGLRE..GLVKISSDM....VGD.YKALQEQMDML.ESVLPQLAKTFE...GLEEERENLEQ...........AAQEIAD.............CD.PEELDSTR.QELI....SLN....ADIE..A...........K...........K.ELVAELRLQF.QAAE...AS...SESLS.TKKASCL.ADIAHSE...KVRE.....S.CR....GW..S.SS.EVN.SIK....................G.....EV--------.-----.--......................---..-----...---...-.--------.........................................................................................
A0A074YUQ3_9PEZI/1011-1324             .......................................ppa---RKVELNAFLDLAGIKF..MD.L....................TAS...KRR..HTVAPTPSEPqg...................tdGEDQTIDLESAVVAGACTMPMLDLFQHACRELKRYISE.GKSFLKTL....EA.EV.....YDD..P....PPFFQ.....AYM............GA..............T..P.DR...KA............Q.................LDV...N...IRDAKTNARMRSKEIWYDWRS..KL..L..DGLAE..GLNRIKDGL....DAD.AGFLDQKQQAL.DAVLPDLLQQYE...SLLKEAEQLEQ...........VAAATSE.............EE.KEELRASR.ARLL....EVD....EQIE..E...........R...........K.RMLASLQRDI.DEQD...NL...AEAYE.EGKAESL.AAIQEAE...RVKE.....S.CR....GF..T.VD.EVQ.SLK....................E.....SVAQLEKKTG.WTVTA.AA......................DTN..LTMTY...ANT...L.QLFFNTT-s........................................................................................
S3CDX6_OPHP1/1009-1331                 .........................................d-DAERIHLQDFLKLANINF..ME.L....................DTT...KRR..ATEGPGAFNKsngnrg..........srlstdeDGKPKDPEIESLVTKVCKVPLLEMYQHACRELKNYIEE.GRSIMREI....ES.ET.....YED..N....PPIFR.....EYT............AA..............T..P.EM...RT............Q.................MDN...Q...FKNIKIFARLQSKKQWYEWRA..KL..H..QGLHE..GMAKTLWDL....EKD.KEVLHKRREEV.DTVYPALLAEYE...ALARDCTQLEK...........FAEQLGG.............DD.QESFIAAR.VKKG....RLT....ESIS..K...........H...........K.SETARLEDEM.KTSK...AR...VAAMK.TEREQYL.KELEEAK...KIRE.....E.RR....SW..S.HQ.EIS.SLK....................T.....QVDALEKKSG.WAVTG.AQ......................GTT..LSLAY...RRE...I.ELVFDVA-a........................................................................................
A0A094D8Y3_9PEZI/1023-1338             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATGQdgs.................edqLTKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLARQQELL.EGVVPELVQKYE...ALLQQEEDLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........R.ALVQQLRGQM.DDNE...AR...FQIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KVDALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0C3BQ11_9HOMO/719-1024              .......................................lpg------SVDELLRAVGGEF..MD.N....................VAV...RRR..STMALRAKEE.......................YPDSPIVPADYAIAVAVDYPLLAYHDYVVNHLTAQIDE.LDIKQSET....DQ.FV.....KTN..P....PAIFI.....DYA............EG..............G..P.EQ...LP............D.................LKA...T...LETVRAMVRLRTKIQWYQWRF..KD..I..SNLLR..EVGERENDA....LQD.LSKTQQSIAGL.TPALDILEVQHA...EIMAELERERA...........AVEEIEK.............CD.PKELAEVK.SSIA....DNA....TQLS..M...........L...........E.EEMADIQKET.DGSE...KR...IRDYQ.AEQKALE.QKIESAN...QMVL.....S.T-....-M..P.GR.NIRaETK....................R.....EIDLIERLSR.WKATR.LT......................PSR..VELEY...AQH...I.LVSIPCNN.........................................................................................
W9XG25_9EURO/1022-1342                 ........................................ge---DKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQSVQAAg....................sqTNMDGSDTADNFVAAATTLPLLELYQHATRELKSYISA.GRKIIRSI....EA.ET.....LAD..Q....PPLFR.....EYV............DA..............R..P.DV...KI............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKN..GLEGIDQGM....RAD.LQLLQQQQLIL.DSVLPRLNQERI...ELEYQKASLQQ...........SLEELDS.............VH.HESLTNCR.RELQ....NAD....EYCL..Q...........R...........S.TLLDSLREQM.REKE...EA...LLAAA.ELKTEMK.DQIAEAD...RVRE.....E.NK....GW..P.VA.DVL.SLR....................S.....KVDAIEKQTG.WRLMT.AEeevd.............qptdyGPA..LTMMY...KDH...L.RLFFYPQ-a........................................................................................
A0A090CDX0_PODAN/1000-1313             .........................................d-DGDRIHLQDFLNLTSIRF..ME.L....................TTT...KRR..HTVAPGETRLsl...................taDGKEDLSLEKCVVAGACTVPTLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............TA..............T..P.EF...KV............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLVKIAEGM....DDD.EKLLARQQELL.SSVLPDMIKRAE...ELEKEHENLET...........VAQEMAD.............CD.PAELEEAR.AELI....SLD....EGLE..E...........K...........Q.RKIAELKAQL.EDSN...SG...IEALT.AQKQQCL.GDIREAD...KIRE.....E.CR....GW..S.SE.EIS.KLK....................A.....RTDKIEKTTG.WALAN.IS......................GTK..ISLTY...KRQ...I.ELVLDIA-s........................................................................................
A0A0F4YX58_TALEM/984-1311              .........................................p-EWEPIHLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGNDQKasgha.............dagdnPGKGAVSLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAD..N....PPLFR.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....KAD.DAALSKQENIL.NSVVPGLVEKHS...ALESEATKLQE...........IVDEMQN.............CD.QDELRAAR.ERLA....KVE....AEIA..A...........K...........K.KQLQEMQEDL.QDKI...DT...IEAGA.ELRSEFM.GQIREAE...RIKE.....E.CR....GW..S.VK.EVN.ALK....................A.....SVQALEAQSG.WSIIS.AAdskp..............essaGPL..VTMRY...RDE...L.QVAFHPK-d........................................................................................
A0A1C7MQX6_GRIFR/899-1225              .........................................d-EGPPISIEQFFAMTGVRF..MD.El..................tTPK...PRR..STVLPGQLRPrprrrss........vepgsataGEEEPIPLSEFAIAMAVDVPRLELYSAVAKDLTGWIEE.SKKICLQA....EE.EA.....QKV..T....PSLFR.....EFA............AS..............D..E.SE...QA............I.................LLH...Q...LKLIKANNMGTAKSQWYDWKL..QW..V..EQLYS..TAAHGFSNL....ESD.ARTLALINQDA.QNILPALREEYA...QVLALLEQEQA...........DIDEIEH.............SD.HDYLNELK.TTIA....EQS....TELE..T...........F...........R.TDVSGEKAKL.ERLK...EK...LAEIE.AQKEEAS.AAIAQDQ...HIIH.....I.QK....ES..T.SS.EIF.KLK....................D.....ELEALQELHL.WRATK.IT......................ADL..VQFVY...DSR...Y.QVSIPCT-y........................................................................................
A0A135UM61_9PEZI/1003-1313             ........................................dp--EERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKD......................fGGEEDLSLENCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....TAD.DKVLQQQQKLL.SSVLPAIVSRFD...VLEQEHKNLRA...........VAEELAD.............CD.PEELETAR.FDLT....ALD....NDVQ..D...........K...........T.RRVEELRQQL.EEAE...QD...VEQLA.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..VSMTY...RRE...I.ELVFDMA-s........................................................................................
A0A0P1BRK7_9BASI/646-959               .......................................eph---RKVSMSEFFAQLGITF..HD.S....................VPS...ASR..RQVEPEEQKS.......................ESDAQPEIMRYASVAAGAVPMLESLVSACNDLEAHVAK.GRAELERK....ES.AF.....TRN..P....PPFVA.....EML............SE..............N..N.SE...RK............D.................AEA...Q...CRLQKAAARALTLEKYYGWRL..DN..Q..FGAENvqHLQSIYARL....AVD.SEVVHRENTQMaSHTLPTLRERRA...ALQEELDREEQ...........RRELIAQ.............AD.PTELRGYH.DSIT....EQG....VQLE..S...........M...........R.ARNAELEGEL.SRLE...SR...LQEFA.TKREATE.EAISAAK...AKYE.....Q.IK....GF..T.TS.EAA.RLL....................R.....EVKNLEALHL.WSFKG.QE.....................eDGR..VYMCH...DDA...V.DVTLL---lna......................................................................................
A0A093W088_TALMA/968-1290              .........................................s-EWEPIQLQEFLNLTNIHF..ME.L....................TTT...KRR..HTTVAGNDRTadis...............gsrtVETGSVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EE.ET.....LAE..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QAD.DSLLSQQEAIL.QSVVPELVEKRS...LLDSEASRMQE...........IVDEMEN.............ID.PDELRMAR.ERLA....KAD....AEVE..R...........K...........K.RQLEQMQEDL.QNKN...DT...IEAGT.ELKTEFL.EQIREAE...RVRE.....E.CR....GW..S.IK.EVN.SLK....................D.....SVQMLEVQTG.WSIVS.AMtq.................eltGPG..MTLRY...KDE...L.EVKFYPK-l........................................................................................
A0A0M9VP63_9BASI/485-794               ......................................etsf----HMHLADFLGVIGLKF..HE.D....................MTA...SRT..KADRPLEPTP.......................---ATTPVEHAKMAGA-AVPMLQALRSACADLKQHVED.GRKRLKTM....EE.NF.....YVR..P....PAFVQ.....EWG............QL..............D.dE.DM...RR............S.................MKG...Q...LNVHKQAARAAAMHDYYGWRT..DMefD..EEMTA..LLQKHRDLL....QAD.RATLEAKEAQLtKTLLPALRARYA...DLHARVQEAWK...........RQEAIRQ.............CD.PEELKQLH.ASID....EQD....QVLQ..T...........M...........R.AKQHDLQDQL.SRVQ...AR...VEETA.AKREQTE.EMIRAAR...AVTD.....Q.IQ....GC..T.PG.EAV.RLE....................R.....HVRHLETLMQ.WSLTN.KT......................STL..LQLTF...ART...W.QVTIEL--ds.......................................................................................
A0A1L9PXS8_ASPVE/996-1320              .........................................p-EFESIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSISKrtarl.............slegnGKSSASNFDECVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ED.ET.....YAD..N....PPLFR.....EYM............TA..............A..P.DI...RS............L.................MDN...Q...FRNVKTHTRLLSKATWYEWRM..KL..L..EGLKE..GLDRHLEEM....KGD.DKLLSKHEALL.SDSVPALSAKHS...SLGQEATHLQQ...........LADELEN.............CD.QDELWAAR.GKLT....DVE....EEIE..S...........K...........K.KLLQELQTEV.QDKT...AT...IETGA.ELKAEFS.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIR.ELK....................D.....SVHRIEQQTG.WSISS.ASste................seaGPV..VTMSY...QDQ...L.QLKFYP--g........................................................................................
A0A101MBM4_9EURO/931-1256              ..........................................QEIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........R.RELETLQEEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.DLK....................G.....SVQRIQQQTG.WSIVS.ASsps................daeGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
A1CEP5_ASPCL/982-1304                  .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPSSASKrai.................rlsIDSKPASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..DGLKE..GLDRHMGDM....KAD.EELLTRYEALL.NDAVPSLAEKHA...SLQEEATNLQQ...........LADEMEN.............CN.QDELLNAR.EKLS....SLE....DEIE..L...........K...........R.QQLQELQAQL.QDKT...DV...IEAGA.ELKTEFL.AQIQEAE...KVKE.....E.CH....GW..S.AK.EIS.ELK....................E.....SVQKIEHQTG.WSILS.ATsse...............elpaGPQ..ITMSY...RNQ...L.RLVFHPA-t........................................................................................
A0A178EKZ6_9PLEO/754-1065              .........................................s-EVERISLQEFLDMTKIRF..MD.L....................STT...KRR..HTAAPSAFHDv.....................dVEEKEESLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PMLFS.....EYL............TA..............P..P.DQ...RA............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..GDLKS..GLLHTLDGF....KRD.ESNLANQDQLL.DTVLPSLIEKHE...RLSAERKQLQQ...........RHDELNS.............CD.REELEEAR.EKIV....ATD....AQLE..Q...........R...........R.RLLEQLQQEH.ADKE...AR...IEAIK.ERKIECI.AETKAAE...RVRE.....E.CR....GW..S.TT.EVN.DLK....................A.....KVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFQPS-a........................................................................................
H0EI67_GLAL7/1138-1277                 .........................................h-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------LVRQAE...GLEREEADLNA...........AAEDLAS.............CD.PEVLSTAR.QELV....SVD....SEIE..A...........K...........K.RMIQDLQSQL.EAKD...RE...ITSGN.ERRQICI.EEIREAE...KVRE.....E.CR....GW..T.SG.EIS.SLK....................A.....KVDTIEQEHG.WTITG.VS......................GST..TSMTY...LKD...I.ELVFDAA-s........................................................................................
A0A0L0D6T0_THETB/746-1042              ........................................pe---PTLSMDEFLVRTSVQL..FT.Q....................FST...RRP..TLLPPPPMPT.......................--DDPIALELL--SVFVLGPETSIFSFGCTQLEQLTAS.LHERANAL....AA.SL.....SSD..N....APIMK.....ALA............LA..............Q..P.GS...AE............Es...............aLVD...R...VVDLKALAKGRAKVKWYAWLA..KL..N..GKLAA..GYSRSSQLL....EGD.LAILARAAG-V.CETSRDLASLYD...SKINTLTNLHK...........-------.............--.ASELAALR.TELA....AAT....SANS..Q...........A...........A.AGVAHLEATK.GLAE...DG...LRGLA.LKRNALK.RAAARAA...ASAA.....G.CE....-T..S.YE.AVE.ALS....................E.....TLAIVRGLSD.WSLKA.FK.....................aDAS..IALTF...GSE...F.SVALQL--qp.......................................................................................
A0A1B9GY73_9TREE/626-936               .........................................w-EQQPMSIAAFLEMAGVPF..ME.Hl..................pGAN...RRR..SSVGRGLLGRs....................yaAGDRDFALQEYAEAQVNQ-YFVNMYTWATNQLTDYIRK.GSAELNDV....EA.RC.....EEH..Q....PPVIS.....EYL............SA..............S..D.ED...KQ............L.................FEM...T...FKSFKTNTHLRAKERWYTWKK..QL..I..DTIEP..DVKKMLKGM....RED.NERLTDLNDQL.SDLIPDLKAKQA...ALQAELAKERE...........VVAKIAA.............CD.QSELLGYK.EGIA....EQS....TQIA..M...........F...........T.AELEESSAKL.SALT...TK...LNELN.ATKQECV.TAISHAK...S---.....Q.CD....QF..T.RS.DAI.RLQ....................E.....ELDSMHHLHL.WRPTQ.IH......................SDR..LSLEF...DHE...I.LLTFDCE-s........................................................................................
A0A094HQH1_9PEZI/1021-1336             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAIAQdgs.................egqLGKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.AETLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRNQM.EDNE...TR...FKAAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
R8BMV3_TOGMI/1-217                     ..........................................-------------------..--.-....................---...---..----------.......................--------------------MLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....LEE..N....PPLFR.....EYI............SA..............S..P.EF...KI............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLRE..GLLKIAEGM....EMD.EKLIEKQQKLL.SSVAPALVKRFE...ALEREHEHLES...........FASELAD.............CD.PEELQSAR.AELE....SAD....KDIE..A...........K...........M.LKIAELRNQL.QDTE...VN...ISKLT.EQKEHCQ.VEIKEAE...KVRE.....E.CR....GW..S.SN.EIS.SLK....................G.....----------.-----.--......................---..-----...---...-.--------qp.......................................................................................
A0A1B7NZM9_9EURO/1008-1332             .........................................p-QVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTKEEKraas...............kigdDTAKVASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAE..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.EAVLSRKEELL.DLVVPPLVEKHT...KLETEAQNLQQ...........AVDELES.............CD.KEELRQAR.ERLA....AID....ADIV..A...........K...........R.KSLEQSQVEL.ENKN...NI...IKAGM.ALKEEIL.AQIREAE...RITE.....E.CR....GW..S.VK.EVK.TLK....................A.....SVRALERQTG.WSILS.ASlkp...............sskyGPA..LRMRY...RDE...L.QVDFYPG-a........................................................................................
H0EI67_GLAL7/1038-1144                 .........................................f-EDERIQLQDFLNMTNIHF..ME.L....................TAT...KRR..HTLAPKSDIDsr...................epRDVADVSLEDCIAAGAATIPMLELFQHACHELKSYISE.GRKTVREI....ES.ET.....FEE..N....PPLFH.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------lvrqae...................................................................................
N4UWZ2_COLOR/995-1305                  .........................................e-AEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFRD......................fGAKEDISLERCVVAGACTVPMLELFQHSCRELKKYISE.GRRIVREI....ES.ET.....FED..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRISEGM....ADD.EKAIAQQQQLL.ASVLPSLVTRHA...ELEEEHKDLRA...........VADELAD.............AD.PEELEAAR.TDLV....ALD....KDVK..E...........K...........T.RRIADLRQQL.EDAE...LG...VEQLT.RERQQCH.EDIKEAE...KIRE.....E.CR....GW..S.TS.EIS.ALK....................D.....RVDTLEKEHG.WAVTG.VA......................GTQ..VSMTY...RRE...I.EIVFDVA-s........................................................................................
A0A098VQY7_9MICR/1-157                 ........................................mq-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...-------SRTLVQSQWYSWRY..SL..L..LPLVD..ILKTIGQKL....SSD.FQAWEHSFAQL.STISSSLNVQKA...SLLNQISLLEE...........RFTCLSQ.............FD.WEKYGQLL.EAIA....QTD....ALIG..E...........R...........E.RELEVLRDHH.CCVQ...ME...LTSVQ.RKKELLV.QKIDVFS...KELD.....E.LS....EI..S.KL.D--.---....................-.....----------.-----.--......................---..-----...---...-.--------adlakskc.................................................................................
A0A0B4I773_9HYPO/920-1233              .........................................a-DNERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..LTVAPKSLHDgs...................sgDGEDDMSLERCVIAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....ED.ET.....YEI..N....PPLFR.....EYM............CA..............M..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLISISEGM....DAD.EQMLKEREELL.AAVLPGALERHE...QLEEESENLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLE....ADIE..A...........K...........K.KLIGELRGQL.ESST...SK...AEELA.AEKQSLM.TSIQQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................S.....HVDALEEEHG.WAVTG.LS......................GTS..LSMAY...KRE...I.EVVFDVA-s........................................................................................
Q8SUP7_ENCCU/187-480                   .......................................arr---EAVNVSEMLVSKGIRF..LD.Sl..................vVSN...TRR..DTMSKSRN--.......................--EVHPRQEKFYANFV--EPRTRFFLDFSSELEDRMSR.QEKVNADL....ER.EF.....V--..-....-----.....--V............SG..............T..V.LE...KA............D.................ASS...Q...LKALKTECRMRAKIEWYELRK..EK..E..VEFNR..EVTDRKNKL....ALE.YNLLAGGLKEV.SEKVEDMKSRNE...KMEEQIRRIKS...........RVGADGE.............GK.HQKISELR.TLMS....EQE....EMIE..S...........I...........G.KELKGLSEEK.MKRQ...VE...RRVLC.EAMEKTE.AEIKELE...KALK.....I.-Q....SV..T.EA.QLK.EVR....................Q.....EFRTLCAVFN.MELVR.AD......................GSE..VRFKL...---...-.--------lgydiriglda..............................................................................
A0A1Y2ERD0_9BASI/736-1050              .....................................apapi-----LSLDEFFDATGTGF..MK.Dvlgm............tgveLGS...KRR..RSMAPSASGR.......................TPSGPPSFADLAVAGGCKSLFHQLYQSDHLRLQEEITN.VMTQLAQC....ED.AL.....QFE..Q....PKVFT.....EWA............TA..............T..E.AH...RA............I.................MQG...Q...FRMIKAHYYLVGRIEWNECRA..QN..H..QAIIE..VMEDNLEGL....RAD.NAVVAE--TDF.ATVLPNLEARRA...ALLAELHAERQ...........RDVELSA.............CD.QEELAGMH.AAIA....EQA....EELE..K...........L...........E.QGCFEVESRL.EGLE...KQ...EMEHR.EKVEKSK.AECDALR...TRLE.....E.GR....CF..S.KA.EVF.RLQ....................A.....EYDALQHLNG.WQLTQ.FS......................KSS..VSLRH...LDE...F.DVTLT---lg.......................................................................................
A0A0L0F3L9_9EUKA/8-122                 ...............................kietladrlrv-------------------..--.-....................---...---..----------.......................--------------ACTLEPKLTLLEQNCSMLDRMTKD.TRKKIEAQ....EN.KL.....NIH..N....PDIFQ.....ALR............DA..............S..T.AD...RA............S.................MRQ...I...LGEVKQVSRLQARNMWASWRL..QA..E..TRVAA..M--------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------lgekarvvgaems............................................................................
A0A1E5RLK4_9ASCO/143-409               .............lpeffdkdnngylvpvdfyrrnsniklfi-------------------..--.-....................---...---..--------NQ.......................SDLDSISQETVYNSLYTKTPLLEIDRFIINELNSKLEM.SYTNFQKIlndyNNvEN.....IDK..L....PYLLK.....KFE............SG..............K..H.QD...MM............N.................TDKfvkL...LNIIKDNCDLESEKVWLNWRI..QQ..L..DGICL..VLRDNLKMV....EEQ.QXELNFFRNKL.EMISFELNKLRK...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------lsilkkdkxmsvnksneksihekyenekwalkrsilikkygvdignlddmkdstkkqnlxqtlkxclxktqxnnkdftsfeqkxkklxf
E6RF50_CRYGW/472-781                   ..........................................EQLQDISLAAFLEIAGVQF..ME.Gl..................pGLN...RKR..SSVAKEILGHs.....................yANERDFALHEYTEAQVNSI-FLNMYTWASNKLFQDIKT.GNEELAAV....SA.RC.....DID..S....PPVIQ.....EYL............AA..............S..D.ED...KQ............L.................FEM...T...FKSFKTNTHLKAKEMWYDWMW..QL..L..ETIKP..DVETVLMGM....KED.KRRLTAFEEQA.AVLLPQLRARKT...VVETKLVKERK...........AVAEIES.............CD.QAELAAYK.EAIA....EQS....AQIT..N...........F...........S.TEVADLKDEL.AALT...GK...LEELN.AKKHEYE.TAIAHAK...G---.....Q.CD....QF..T.RS.DAI.RLQ....................E.....ESISLQHLHL.WRPNK.IL......................PER..IELSY...DEE...I.LLSINCAN.........................................................................................
A0A1B8C619_9PEZI/1023-1338             ........................................dv--EERIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATAQdgs.................edqLRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.ADTLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...AR...FKVAT.ERKQACL.DEIRGAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEKKYG.WTITG.IS......................GTT..LSLSL...RSE...L.ELVFDAS-s........................................................................................
D8PL34_SCHCM/671-977                   ..........................................EEVPQVSIQEFFEITGIKF..ID.E....................MIA...PRR..SIAPRQARP-.......................--ADSIPLSEYLVALAVDLPQLDLYGRVADDLARSNTK.YKENFEEM....ER.EA.....ALD..T....PELFQ.....EYM............LA..............E..P.ED...QE............G.................FRH...Y...LTLIKANARMQAKSAWYSWKS..TW..V..EELTG..IAQSELEAM....EAD.TKTIAELNAQL.ETALPELERQHA...EVTAQLEKERT...........EIAEVEA.............CN.QDWLNELK.GTIA....DQS....TEIR..S...........F...........E.TELAQVRSGK.QHVQ...AR...IDEYE.AEKQEHM.AAIANAN...RMLD.....V.RE....RR..T.HS.EVR.RLQ....................A.....ELDALEDLHQ.FRMRT.IR......................PDL..FEYEF...LEK...Y.LVSLPCR-a........................................................................................
E3RWP8_PYRTT/736-1047                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPASFHDv.....................eVEEKEESLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LED..N....PLLFS.....EYL............TA..............P..P.DQ...RK............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..HDLKA..GLLHTMDGF....KRD.EATLVNQEQLL.DVVLPPLIEKKE...HLSIECKQLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....AELQ..M...........K...........K.QVLLRLQQEL.ADKE...QR...IQAAK.DRKVECV.EEIKAAE...RLRE.....N.CR....GW..S.TS.EVS.NLK....................A.....KVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFVPS-a........................................................................................
A0A2H3E313_ARMGA/739-1050              .........................................d-EGPPISIQQFFEMTNIKF..MD.D....................LTA...PRR..SMHPSQLPSRq.....................pRNPADIRQAEYTIAVAIDIPQLLLYSRVSSDLQAWMQQ.SKSVFDEA....EE.EA.....AKM..T....PELFI.....EFS............RA..............D..E.EG...QA............E.................LLH...Q...LNLIRTNTRAQAKSDWYEWKL..QW..I..EGLRV..TAEQALSEL....ETD.AKTLADLRAHA.DDIVPVLQQEYD...SIMRELQQEQA...........EVAEIEQ.............CD.QEYLNELK.TSIA....EQN....LEVD..A...........L...........K.NEVSEGNEQL.KWLG...ER...LEEIE.LQRRQAN.TAISEAN...RILH.....M.QT....HS..T.EA.EVF.RLR....................S.....ELEALEDMHM.LHVTK.VD......................SQL..FEYVY...ASQ...F.RVSIPCV-n........................................................................................
A4RSC4_OSTLU/543-806                   ........................................mh--SKPIDLETFFYACEISF..ME.A....................KNL...GRR..SSIAMGALAT.......................-APPPETQPEALKLCCLTAPLIEALEGFHEQLQERMTT.LTSETDKL....RS.TV.....EAT..Q....PPLLR.....YAA............SD..............D..P.AH...VN............E.................LRR...A...GKALKKECQLAAKERFAQQRL..ET..E..ELVRE..SLNFHSDIL....AKS.AQSIANSRAIA.AEAISSANGHII...KLRAQRAASSK...........RADAAKS.............-A.SATKEQVL.EALA....IKR....AAIA..A...........A...........R.RALTTSDENL.VRMK...SR...KTTIK.SERERLQ.EELDAMR...EAQD.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------aaadatvs.................................................................................
A0A068S1W8_9FUNG/314-615               ........................................gv---QSMDLRAFLRHVGVLF..DP.L...................dPLE...DMV..RTTEPQSIQG.......................---PVSPTRQGITAAT-SMKELEAYKEYSDRLKELVQT.GNT--ERM....GK.DT.....ATT..Y....NAIVA.....EYF............DG..............D..K.DT...RY............L.................MQK...S...LKDMWDLTRSEAHCTLLEWKE..SI..Y..RQLLE..ETEELLQQV....SDD.ERQLTQYETFL.QSKTSYVQSHNT...TLREQLADARK...........RQGNHTY.............TE.PNP--FLI.DDIH....DKE....MLLQ..E...........T...........T.AFKEQVTKEE.EDIK...QE...LEALE.TKMAQLN.TDIANAM...DKPE.....L.KK....HA..T.RH.DLE.EAK....................S.....DLEKRCRVCG.WKLLD.YS......................DEM..ITIAF...TRD...I.SMKMKR--qq.......................................................................................
A0A1Y2BZY8_9FUNG/627-778               .........................................p-EPPKMSLDDFLQATEIGF..IE.L....................STT...MRR..ETSAFNASYG.......................--SGPITELDYSKAACLYLPELKYLEFACKSLTEYVEE.GRDSMKEC....ED.NV.....DKS..M....PPLFD.....VFI............KA..............D..E.EE...KD............I.................MIG...Q...LRALKSIARSNTKESWYRWRE..DM..L..RPFHN..NILHNTESL....K--.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------kv.......................................................................................
A0A194W342_9PEZI/884-1196              .........................................d-DEERMHLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIVPSARKDs....................lsSGKEDISLEKCVTAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FLE..N....PPLFR.....EYI............SA..............S..P.EF...KL............L.................MDN...Q...FKNVKTHARLQSKAMWYEWRM..KL..Q..EGLRE..GLFKTAEGM....SAD.GKLLDQQQKLL.SSVLPALLKQVE...ALDREYENLEA...........VATELKD.............CD.PEELESAR.TDLV....AVD....ADME..A...........K...........A.REIAQLREQL.QETE...ES...VGQLV.EQKQQYS.ADIREAE...KIRE.....E.CR....GW..S.ST.EIS.ALR....................S.....KVDAIEKQHG.WAITG.IA......................GTS..VSMTY...RKE...I.ELVFDMA-s........................................................................................
S6E1V2_ZYGB2/238-546                   ........................................ap--QERYSLRQFLDDAGVTF..LI.D....................TTW...VET..QDPVVFPLRT.......................LSAPQFRTDQVYTPLYVDMPVLEMSAFVCRELLRRIEQ.SRRQFDDL....EQ.QV.....SSS.pP....PLLLK.....EYF............TS..............G..P.EM...RQ............L.................MNQ...Q...LQLVKSFAKLEAKKAWYDWRI..QH..L..KGLQN..VLTENLALL....QDE.QTKLDADLQRA.RRINTRTAELLQ...SLRREVELVKGlp......sqvYKKESRL.............SD.KLRLEQLK.QELG....AHK....IALN..-...........-...........-.-DAQQLQRQR.QTIL...SE...INSKT.RECAQLK.TRIS--S...QLSH.....R.KA....DA..S.EY.DMV.KLR....................K.....KLDMLGVISG.VHFRE.LR......................GSL..LSIE-...---...-.--------ctgfpvltidls.............................................................................
A0A015ICH1_9GLOM/729-861               ..............................etintgdlnike-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-YQKSDF.............AD.TEEMKFMK.AMIE....EQN....QQIE..F...........F...........E.AELEGINKET.QSLR...EM...RDYLI.KEKAEIE.QKIRDAK...RLVE.....G.TQ....CY..T.EK.DLN.EVQ....................E.....QYRILIDKHK.WFPKK.LS......................EEL..VHLVY...DET...V.QVKIDTR-d........................................................................................
N1J9H2_BLUG1/1253-1564                 .........................................l-KYNQIQLQDFLEMTRIRF..ME.L....................TTT...KRR..HTTAPKSTSIk.....................qDIEKQDSLEDCIVAGATQIPMLELFQHACHELKRYISD.GRKTVREI....EK.ET.....WEE..N....PPLFQ.....EYL............SA..............T..P.DL...KL............L.................MDN...Q...LKNVRTHARLLAKGQWYDWRM..TL..L..NTLEG..GLAKTIQDM....TID.ENTLDRQQLLL.APIVPNLTQTVR...NLEQEESQINA...........AYRELAN.............CD.QDKLSEAR.HRLV....TID....TENK..A...........K...........I.LLISELQNEL.RAKE...KE...IELSI.ARKKAWK.EEINEHE...KIKE.....E.LR....GW..T.CT.EVN.AIK....................N.....RVCKMEEEYG.WTITR.VS......................GTL..ISMIF...RRE...L.ELTFDAS-s........................................................................................
K2S8P3_MACPH/357-678                   ..........................................EQVEQIQLQDFLEMTKIRF..MD.L....................TTT...KRR..HTGYPGAQNAfgrna.............smsaaEIEGKDDLETCVVAAACTEPEYLMYQHACHELKRYIAE.GKNLVHQI....EE.EV.....YEE..N....PALFR.....DYM............SA..............P..P.DQ...RQ............I.................MDN...Q...FKNMKTNARLRTKEAWYGWRS..NL..L..HDIKA..GLTKTADSF....NED.DAALKKQEEIL.DSALPALSEHRT...KLEQESKQLQR...........RAEELNG.............PD.KEELDAAR.ERIV....ATE....TAIE..E...........K...........K.RMIEALQKEL.AEKE...AN...IEAAK.ERKVECL.EEIKAAE...RVRE.....E.CR....GW..S.VD.EVK.ALK....................A.....RVSALEDKHG.WLITS.ASs....................dPET..ITMSY...RND...L.QLFFHPG-a........................................................................................
A0A1Q3EMC1_LENED/797-1107              ..........................................DEIPPISIEQFLEMTGIRF..MD.L....................-SA...PRR..STYASQIPSRq.....................pRNPSEIPLAEYAVAMAIDIPQLVLYSRVARDLEGWIEQ.SKVEFRQA....EE.EA.....AKV..T....PLLFA.....EYL............RT..............D..E.EG...QK............D.................LTR...Q...LKLIRTNVRLEAKSDWYGWKL..QW..L..DSLKY..GTQAALTNL....QND.AKALENLKAKT.DEIVPDLEREYN...EIVRELQAEQQ...........EVAEIEQ.............CD.QDYLNELK.NSIA....EQN....VEVE..S...........L...........R.AEVKEANDQL.QWLE...ER...LENVV.LQKQEAT.SAIAEAN...RRLH.....I.QT....NS..T.GV.EVI.RLQ....................N.....ELQALEDLHM.FHISK.VQ......................PDL..FEFTY...ASA...Y.HITIPCR-d........................................................................................
A0A0D2D3F0_9EURO/1020-1341             .........................................s-EEDKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPALgs...................qaSMDGSDTVDDFVAAAT-TLPLLELYQHATRELKSYISA.GRKIIRSI....EA.ET.....LAD..Q....PPLFR.....EYV............DA..............R..P.DV...KI............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKN..GLEGIDQGI....QAD.LRLLRQQQQTL.DSVLPRLNQERT...GLEGRRASLQQ...........SLEELDS.............IH.HESLTNCR.RELQ....SAD....EYCL..Q...........R...........S.ALLDSLREQM.REKE...EA...LLAAA.ELKTEMK.DQIAEAD...RVRE.....E.NK....GW..P.VA.DVL.NLR....................S.....RVDAIEKQTG.WRLVT.AEeevd.............eptefGPA..LTMMY...KDD...L.RLFFYPQ-a........................................................................................
E4V388_ARTGP/978-1300                  .........................................t-QVEAMKLSDFLEMTNIHF..ME.L....................TTT...KRR..HTIAPGSPDKrgi.................etlQSAKEFGLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............T..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHVDEM....KQD.DAFLSRKEHIL.AKVVPGLIEKHT...KLEIDSQNLQK...........VMDDLEN.............CD.QEELRDAR.KKLL....AVE....SELS..A...........C...........K.DKYNHARGRL.EEKS...DL...LEKAQ.ARKEELL.QQIREAE...SIKE.....E.CR....GW..D.GK.EVR.VLH....................D.....SVRSLEKQTG.WAILS.AKpsv...............daveGTS..LVMRY...SGE...L.QLNCNPS-h........................................................................................
A0A2H3TBM4_FUSOX/988-1301              .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..T.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPVIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A093VJE6_TALMA/968-1285              .........................................s-EWEPIQLQEFLNLTNIHF..ME.L....................TTT...KRR..HTTVAGNDRTadis...............gsrtVETGSVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EE.ET.....LAE..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QAD.DSLLSQQEAIL.QSVVPELVEKRS...LLDSEASRMQE...........IVDEMEN.............ID.PDELRMAR.ERLA....KAD....AEVE..R...........K...........K.RQLEQMQEDL.QNKN...DT...IEAGT.ELKTEFL.EQIREAE...RVRE.....E.CR....GW..S.IK.EVN.SLK....................D.....SVQMLEVQTG.WSIVS.AMtq.................eltGPG..MTLRY...KDE...L.ECS-----.........................................................................................
G3AUA9_SPAPN/578-883                   ..........................................EDYEPIKLSQFLQDIGIQF..YD.D....................REL...DLN..SFPRFSNP--.......................-DQSNITMTDYISSIP-KLPVLQLYEFSNSELNKNLMD.TRNLFNAF....NT.HI.....EMN..N....PTMFR.....QYY............KS..............D..E.QA...QA............Q.................MNQ...R...FARVREYMRQSSHKKWYEWRY..NM..I..SALLD..KSRERYSEL....VND.RQCLISDIDQL.QKLRLKFHGYLQ...QLRRRLTDLKQ...........VTSQIGK.............IP.AGELEKLS.IELK....SHK....LKMA..E...........L...........G.NKIVDRTGEL.ERIN...VK...LADIG.NKRTELV.SELSQAQ...QVVQ.....K.TK....LN..D.KS.EVI.ARH....................L.....TFKFLQQITK.LQFVN.ED......................NGV..WEFIY...YQD...I.KCRFDIKN.........................................................................................
A0A1Y1UUJ1_9TREE/631-939               .........................................d-QPPAVSLSAFLEMAGIQF..ND.Elpg.............idmrRNS...MRR..SLAASS----.......................TLDRDYTLNEFAEARI-HEAFYNAYNWACSKLRTDISA.RHEELLDR....ER.EC.....AED..A....PTVIK.....EYL............AA..............S..D.ED...KA............L.................FES...T...FKDFKLNTLLKAQLAWYEWKT..GL..M..TALKP..HMQEYLDGQ....KED.QGRLVEMEEQA.TTLLPQLQDRVK...ALEAELAREKT...........TIAEIAE.............CD.PGELQDLH.MAMD....EQA....EQLK..D...........F...........Q.KEYDDAKTKL.DGLA...TK...LGELN.SKKKDCE.TAISIA-...--AS.....K.CD....HY..T.KS.DVL.RLK....................D.....EYASLQHLHL.WQVEL.AS......................PTS..LVLAF...DDE...V.RVDLTCT-d........................................................................................
A0A1E3QJV0_9ASCO/553-862               .........................................d-SYQPVSLSQFMDAIEIKF..YD.Dl.................liS-D...KSK..RRSFVQKP--.......................-QDSNVVLGDYLHAKQ-KLPRLELYDFSSRELRKNITE.GQHLFLQL....ET.ET.....VEE..N....PPLIK.....EYF............QS..............T..Q.LV...RS............N.................MNL...Q...FQLIKDYARYQAKSVWYGWRS..QL..V..EGVLI..ALNENFEQL....SED.KKVLQQQNVEA.QTLLAAVREKMV...GLTAQLQALKS...........AKQHYET.............LH.TENLRSFK.QELV....GIN....REYA..E...........K...........R.DNLMALQCRL.EETN...GS...MRQVL.AQIESAN.RSIAENQ...RIVN.....S.TK....KF..D.AQ.ELL.SLP....................S.....RFSLLQSITS.FRFVA.LDk....................hRPI..VHFQF...DRA...V.NVQIDFS-d........................................................................................
A0A0F4GB92_9PEZI/762-1082              .........................................q-QLEKIGLQDFLNQANIRF..MD.L....................TTT...KRR..MTTAPTPSKArras..............nsqgiSDNEQATLENAVVAAACTTPELELYQHACHELKRYTKE.GKQMIAEL....EA.ST.....LRE..Q....PPLIQ.....AYV............HA..............T..P.ER...KI............A.................LDV...Q...MRDMKTFARLQSKELWYEWRS..QL..L..DELMV..GLQNIGEGL....IKD.DEILGRSEQIV.DQVLPALVEEHE...GLQKEANRLEA...........DVNAVSD.............EE.KEELQVAR.GRLT....DVD....ADIA..E...........K...........K.RLLETLQNQV.QEQD...EL...AEKLH.RGNAEFT.AATHEAN...RVRE.....A.CR....GV..S.LH.EIT.ELK....................A.....SVKDLEESFG.WSVIS.ASs....................sPAT..VTMTY...KSD...L.ELHFHPQ-a........................................................................................
I2JV51_DEKBR/424-727                   .........................................y-NYQNVELSEFLNEVGVQF..FD.F...................iGPT...ERA..RSXDFDTSRK.......................-----ASLIEYVKSTN-SIPEFRYFEHLITQYRSSIKN.IRGIVSDF....EK.SV.....GEN..N....PTSIR.....EYY............EQ..............T..D.LL...RQ............D.................LKL...N...YQALASFARQKAKKENLAYLM..GL..L..KQLKS..SYLDSDALL....DVQ.LEKVLDIRKGI.LLSQQKLIERKA...KLRNELAELVR...........KRKNINS.............ED.LVKCRNLR.ATII....EVL....SKQK..G...........I...........K.KEIDSLHEKT.SAEE...KE...VELAE.RNVALLE.EKNGNAN...DRLQ.....S.IR....VP..S.ND.ELS.ALQ....................V.....QLSVLQKSSG.VEIVS.IN......................ADS..XKIHV...---...-.--------qglvsidlsfs..............................................................................
A0A0K8LRD9_9EURO/994-1317              .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASKrtar...............lsaeSKAATASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLMSKATWYEWRM..KL..L..EGLKE..GLYRHVDEM....KTD.GNLLTKYETLL.DGVVPSLVDKQF...ALQEEAANLQQ...........LADEMES.............CD.QDELRNAR.EKLS....SLE....DEIE..L...........K...........K.KQLQELQDQV.KEKT...SS...LESGA.ELKAEFL.AQIQEAE...RVKE.....E.CH....GW..S.AK.EIS.ELK....................E.....SVRKIEHQTG.WSIVS.ATssg................spaGPL..LTMSY...REQ...L.QLVFHPA-t........................................................................................
A0A177CSH0_9PLEO/720-1031              .........................................d-DAERISLQDFLDLTRIRF..ME.V....................SAT...KRR..HTAAPASFHDk.....................eVEEQEQSLDQYVVAGACIVPEYECYSHACHELKQFISS.GRDYVRTL....EE.NV.....EEE..N....PLLFS.....EYL............TA..............P..P.DQ...RA............I.................MDN...Q...FKNLKTNARLETRGEWYTWRT..NL..L..RDLKS..MLLPTLDEF....KLD.ESVIRNQELLL.EKILPPLQQTQE...RLSKECGQLQQ...........RHDELNN.............CN.REELEQVR.ERLV....AVD....TELE..E...........K...........R.QLVARMQQEL.EEKE...AR...IEAVK.ERKVEYV.AEIKAAE...RVRE.....E.CR....GW..S.TT.EVS.ELH....................A.....KVCALEQKHG.WSITS.AS......................GST..ITMTY...KND...L.ELYFQPS-a........................................................................................
A0A074WC67_9PEZI/659-972               .......................................ppa---RKVQLNEFLDLAGIKF..MD.L....................TAS...KRR..HTVAPTPSETyg...................vdGEDQNIDLEGAVVAGACTMPMLDLFQHACRELKKYISE.GKSFLKNM....EV.EV.....YDE..P....PPFFQ.....AYM............DA..............T..P.EH...KS............Q.................LDV...N...MRDAKTNARMRSKEIWYGWRS..QL..L..DGLSD..GLDRTRTGL....DAD.AEVLGQKQQSL.DSVLPDMLQHYE...DLLNEAEQLEQ...........AAAATSE.............EE.KEELRASR.ARLV....EVD....EQIE..E...........R...........K.RMLAGLQRDV.DEQD...NL...AEAYE.EGKMESL.AAIQEAE...RVKE.....S.CR....GF..T.ID.EVQ.SLK....................A.....SVAQLERQTG.WAIAT.AS......................GSN..LTMTY...KNT...L.QLYFNTT-s........................................................................................
A0A167K5Y7_9BASI/639-954               .......................................plr----QLSINDFLEMTGVTF..MD.G....................LAV...KRR..STVGPGVLGSvrd................egldGRTANRPLAEYVSAAAVGIPQLEMYIWACQELKKNITT.SQETVHTF....DD.QV.....ERS..N....PLLFR.....EYM............IA..............N..E.EE...RP............L.................MEG...Q...LKIMKAHARLCAKEKWYQWRQ..GL..V..QDLQN..TVTEHLMKL....QSD.YEFIQKTQAEL.GASLPELRARHA...GLAEEVALERS...........NIQELEG.............DN.PEQVKELR.EGIA....EQN....TQIE..S...........F...........R.SELAEVATKA.ERLN...NK...IADIE.EQRKQQM.SITSKAE...QHCT.....M.LL....RC..S.RS.EVF.RLK....................E.....DFESLQRMHL.WTPEK.VK......................AAE..TILVY...DSR...I.QVTLRPE-q........................................................................................
G7XEB5_ASPKW/995-1322                  .........................................p-QFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLDRHVQEM....KAD.GDTLSKHEALL.TGVVPGLEEKHS...ALEKEATTLQQ...........LADEMEN.............CD.QDELRSTR.EKLS....SVE....AEIE..A...........K...........K.RRLQEMQEEL.KTKT...DT...IESGT.ALKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..ITMSY...RNQ...L.QLTFHPA-s........................................................................................
A0A0D2DI38_9EURO/1038-1359             .........................................a-EQEKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPGVe....................spEGIQIPSMQMNFVAAVTTLPLLELYQHATRELKSYIST.GRKIIRSI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KV............V.................MDN...Q...FRNGKANARLQSKEGWYQWRG..QL..V..DGLKT..GLEGIKQGM....TAD.LEVLHQQQELL.ATVVPRLLQEQS...ELRDQTNSLRQ...........SLEELDS.............AD.HEILVSCR.DQLR....RAD....EYHL..Q...........R...........S.AHLEDLQQQM.REKD...DA...LVSAA.DYRVELQ.SQIAESE...RVRE.....E.NR....VF..P.VT.DVL.AIK....................A.....KVETLQNQTA.WCLLT.AEeevd.............epnefGPA..LVIRY...KGE...L.QLFFYPQ-a........................................................................................
A0A0P7BI94_9HYPO/988-1301              .........................................a-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIVPGTLQGgf...................saEGEDDLSLERCVVAGACTVPTLELYQHSCRELKKYISE.GRRMVKEI....ET.DT.....FEE..N....PTLFR.....EYM............AA..............T..P.EV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLRIEEGM....EAD.DMYLEEQKSLL.DSVMPALQARFK...SAVEESSNLEE...........VAQELAD.............CD.PSDLEAAR.EDLS....SLE....ADIE..H...........K...........K.RLITQLREQF.KASE...AD...VETLT.TQKQQYL.EDIKESE...RVRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RADAIEKKHG.WAVTG.IS......................GTI..LSMAY...KRE...I.EIVFDIA-s........................................................................................
SPC7_SCHPO/877-1190                    .........................................p-NVEPISLSDFLKMTGIEF..LD.N...................lTIA...KRR..ETLLPNAEEN.......................---KKCSIQELLESFYIQFPLLELYKFSCQQLQDYIAE.GKDFVTKI....EE.ET.....LKE..N....PLLFY.....EYR............KA..............S..S.DM...RV............L.................MDS...Q...FLMMKTFARLQAKGDWYEWRE..GL..M..QGIKH..ELNLNLTGM....QRS.LTHLMDVANVI.HPYAQEIQERYN...GSITTVQTLKK...........QKEFANQ.............YD.STLLAQAQ.EKLE....KLK....VEVE..R...........R...........R.RLLSEKEERR.KELA...IK...IEQVT.NSCSDLE.LRTNAEQ...DFYA.....K.NQ....DF..E.FD.EIK.RYE....................E.....QLLNLKNELG.WTIVS.LT......................AGG..IKLAT...NNT...-.--------alspysaevtveilr..........................................................................
A0A094IPG8_9PEZI/1044-1358             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNSAAKdg..................segQMKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KR............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVMAKQQELL.DNVVPGLVQQYE...ALLQQESDLQT...........SAEEIAN.............CN.QDDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...SR...FNIAT.ERKQACL.DEIREAD...KVRE.....E.CR....GW..S.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RGD...L.ELVFDAS-s........................................................................................
A7EVA3_SCLS1/1041-1356                 ........................................gd---ERIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKRASDgpl................rnrlSDQTKVSLEDCVAAGAATIPMLELFQHACHELKKYISD.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............P..A.DM...KL............V.................MDN...Q...LKNVKTHSRLLSKGMWYEWRS..TL..L..ETVKD..ELVRSAEGM....ISD.EEILDKQQALL.ESVLPQMIKKSQ...QLQHEEANLRT...........AAEEIAS.............CD.PEELSEAR.QQLI....SVE....ADVD..A...........K...........R.HMIEELKKQL.QARE...AE...IEAGT.AKKEMCL.KEIREAE...KIRE.....E.CR....GW..S.SS.EIS.TLK....................A.....KVDAIEKKHG.WTITG.VS......................GTT..TSMTY...RKE...I.ELVFDAS-a........................................................................................
A0A1F5LZC7_9EURO/959-1285              .........................................p-EMEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPSSATKkltra.............tgenmPKPRSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFR.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHVEEM....KAD.DDLLTQREELL.SSNVPPLVEKHA...ALEEEATNLQE...........LVDEMEN.............CD.QDELRSTR.GKLS....EVD....IEIA..A...........K...........K.RQLEELQAEV.QEKT...AI...IQAGS.EMREEFL.AQIQEAE...RVKE.....A.CR....GW..S.AR.EIN.ELK....................A.....SVQRIERQTG.WSIVS.ATtps...............hdqsGPV..LKMAY...RDH...L.QLEFSPG-a........................................................................................
A8Q201_MALGO/653-967                   ......................................etsf----HMQLADFLSVIGLKF..HE.D....................MTA...SRT..HAERPREAAAag..................gtmHPTTALQYAKMAGA---AAPMLQALRNACQELKQHVED.GRVRLHAM....EQ.DF.....YAR..P....PAFVQ.....EWG............QL..............E.dD.DM...RR............S.................MKG...Q...LNVHKQAARAAAMHDYYGWRT..DM..QydDDMVL..ALVQHRDAL....RAD.QERVLGKRATLeDELLPTLRERHA...ELKQRVDEARA...........RQEAIRQ.............CD.PEELKQLH.ASID....EQD....HVLQ..T...........M...........R.AKQRDVADQL.ARVR...SR...VDESY.AKREQTE.ELIRAAR...VVSD.....Q.IH....GC..T.PG.EAV.RLG....................R.....RIRQLETLLQ.WSLTN.KT......................STL..LQLVF...ART...L.NVAIEL--d........................................................................................
A0A2K3D2Z2_CHLRE/596-908               ........................................qa--APQITCQEFLSFIDVSF..ND.K....................V--...-CR..TSYLPQSDPP.......................----PKTVAEVYEAAVVTAPQVTAYQAMMVEVSSRLAN.MQSRVQQL....EA.EL.....SGS..N....PELFA.....AVQ............TV..............P..A.AQ...LE............T.................IKE...Q...FISLKKLCRIRTVKAIKQTHL..NS..L..DELLS..QLSNSKANL....QTE.LAAMTAGVERL.NKCTQDKTALAA...AIAHRCAEDDA...........QHE--AA.............LQ.RRKVMEAHlQRLE....ALR....AQNA..Q...........R...........R.QRLEEERAER.QAIE...QNrvpKETLE.QERSMLE.ARISALS...-VRS.....S.SSamtpGR..E.GE.LVK.QVA....................A.....KREEVEALLG.LHAMR.I-......................---..-----...---...-.--------dlssmdsngsfnfifrgscrvtctaa...............................................................
A0A1G4K5U9_9SACH/430-740               .........................................n-EPNSIALSTFLNAVGMTF..PS.Q....................EDN..fERF..TKLAFNVESG.......................--EIKWPAVEIYNILYADMPILEISAFCCKELLLRVEK.SRRLFQEV....EE.QV.....SRN.pS....PALFK.....KYF............DS..............T..Q.AS...RE............T.................MNN...Q...IILIRDYSKLQALRVWFEWRS..MH..L..NGIKS..VLKENLMVL....RIE.LETISARIDKI.NTINKKVLEVKQ...KIIRELHLSKE...........QLK-APS.............IN.PAIPERLR.IEIL....KAE....LKVE..I...........Q...........NlKENSQIVQRV.ARVQ...AE...IDEIQ.HKIAQTQ.KHISLLS...SKVR.....K.TS....AF..A.KH.EIP.KLE....................A.....TFRMMQSISG.VSLKQ.YA......................GAR..LNIEL...SDS..nI.ALSLDVK-e........................................................................................
H0GUR9_SACCK/452-763                   ........................................pt---QDYTLREFIDEVGVGF..LD.T...................kLID...DLD..KKVNFPLNSL.......................NLMEIQRIDNVLSAYYIDIPILEVEAFRCKELWRSINE.SKNKFKDF....ET.QI.....DRS.hP....PLLLQ.....EYF............SS..............S..E.KM...KQ............L.................MKD...Q...LQLVKGYSKLEAAMEWYEWRK..KQ..L..NGLEL..ILAENLSVL....KGD.YERLNEEIEKI.NIIRGKTQKLNE...SIREEIRSLKN...........LPSDSYKp..........tlMN.RIKIEAFK.QELM....KHS....ISLS..-...........-...........-.-STNDLTQEM.RSIK...ST...IAKKS.NDLLALR.SEIVAVD...KKMD.....R.RQ....LF..T.RF.DMP.KLR....................D.....NLKVLESLTG.ICFLK.LS......................RST..LSVEF...HQFd.gL.RVEINL--tt.......................................................................................
D4APN2_ARTBC/956-1272                  ........................................tp--VEPIKLSDFLEMTNIHF..ME.L....................TTT...KRR..HTIAPGSPEKcgt.................eslQGAKEFGLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............T..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHLDEM....KQD.DAILSRKENIL.ANVVPGLVERHD...KLKIDSQNLQK...........VIDEIES.............CD.QEELRDAR.KKLL....AVE....TELS..G...........Y...........K.DKYTQAQSRL.ETKS...DL...LEKAQ.ARKEELL.QEIREAE...SIKE.....E.CR....GW..D.GK.EVR.VLQ....................E.....------KQTG.WTIIS.AKpsm...............dvvkGTT..LSMRY...GGE...L.QLDCNPS-h........................................................................................
I3EIQ6_NEMP3/272-562                   .......................................kke---ETKKIREILAETGIRF..LD.N...................lSLG...NRR..ETLSKIRNKV.......................---EPADVIYYKEFMQ---RRIDTQNALSSKLSAEIEK.AREETEVI....ER.EV.....DC-..-....-----.....--T............GL..............S..S.ID...RN............T.................LLS...K...LRQMKSDARKEGKSHWHRKRL..GV..E..REFLE..ETERIYAGF....EKE.KAELAEKIEKM.KEEIQKT--NLI...DLEKKERSMKE...........ILLKIGT.............LT.QEEVNEFV.AEVE....QNK....KDEV..A...........L...........K.DCLETKSAEL.ACIK...QK...NEEIS.QLIENEK.AEIQNLQ...ESLL.....-.VE....EV..Q.KD.DLE.QIK....................V.....AVQRMEVILG.VKILE.IS......................HSR..LLFSV...C--...-.--------divitiiyd................................................................................
A0A1L9VIY9_ASPGL/978-1301              .........................................q-KLEPIPLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTVPGSASRrssv..............rrsveGASKPATFEDGVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFR.....EYM............AA..............P..S.DI...RS............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHADDM....KAD.DEVLTKHEAVL.NGVVPALVEKHS...SLEQEATSLQQ...........LADEMEN.............CD.QDELRSAR.ENLA....TIE....DEIA..S...........K...........K.QELQELQTEV.QEKT...DT...VEAGT.ELKAQFM.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIN.ELK....................Q.....SVSNIEQQTG.WSIIS.ADas.................ssgDPS..LTMSY...RNR...L.QFSFYPR-a........................................................................................
W2RS25_9EURO/1038-1357                 ..........................................DEQERISLQDFLNMTNIHF..IE.L....................STT...KRR..HTQAPVPQRP......................sQEQADKSTEAKFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....ES.ET.....LHE..Q....PALFN.....EYV............DA..............R..P.DV...KA............V.................MDN...Q...FRNGKTNARLQSKEGWYTWRA..QL..V..DGLYN..GLEGIKRGM....QKD.AVQLTQQQQAL.NGVVPALGEQRE...VLNKELASLHQ...........TLTELDS.............VD.TEALDEAR.QQLR....AAD....QENV..R...........K...........S.TLLETLRQQM.GEKE...EA...LESAE.ELKAEMN.AQVDEAD...RVRQ.....E.YR....GW..P.VV.DVL.ALK....................D.....RVDAIEKTTG.WRLLA.AEedte.............epndfGVA..LTMSF...KDE...L.RLFFYPS-v........................................................................................
A0A1E1L7W7_9HELO/1023-1332             ........................................dd----RIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPSSSMKp.....................lEEEKDIALEDCVAAGAATIPMLELFQHACQELKRYISE.GRKTVREI....ET.ET.....FEE..N....PPLFR.....EYI............SA..............T..P.EM...KV............V.................MDN...Q...LKNVKTHARLLSKGLWYDWRM..TL..L..RTLKE..GLFKSAEGM....IED.EEILDHQQELL.EAVLPELTRRAE...QLQRDEADLRS...........AAEEIAN.............CD.QDELSDAR.QQLI....AVD....ADVE..A...........K...........K.QLIADLRRQL.EGKE...SE...IEAGN.ERKQTYL.EEIREAE...KVRK.....E.CR....GW..T.SS.EIS.VLK....................D.....KVDAIEKKHG.WTITG.VS......................GTT..TSMTY...RKE...I.ELVFDAS-s........................................................................................
B6K6D0_SCHJY/780-1086                  .........................................p-ELAPLSLEEFLQMTGISF..LD.D....................L-V...HLK..PPASPTLKEE.......................-PPAPLSLADRLKQFLVQFPCSELYKFGCQELNNYIVE.GQNVVNKL....SN.ET.....NAQ..N....PLLMF.....EYR............QS..............N..A.SV...KQ............T.................MES...Q...FRLLKSYSRLRAKSVWYEWRM..SL..L..QGIER..ELRSNMTLL....QKS.EASLLHAKSIV.HPYVFEVSERHS...KLLNSVSQLKR...........QKELASQ.............YD.NEAAVAAE.NKLA....ELV....RKIE..L...........K...........R.TTLLEQEKSL.KKLK...AA...AEAIT.EKSSQLR.VTISNTE...KFCE.....T.HS....SL..S.RD.ELS.EYK....................R.....QLELWKSRLG.WDITG.IT......................TNG..FTLRL...L--...-.--------sdspfsqlsv...............................................................................
E3Q433_COLGM/1024-1336                 ........................................qs--GERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPEMFKDg....................llGGKDDLSMERCVVAGACTVPMLELYQHSCRELKKYISE.GRSIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............T..P.DF...KN............I.................LDN...Q...FKNSKTHARLESKAMWYEWRT..KL..Q..EGLRE..GLVRIAEGM....AAD.DKVLDQQQKLL.SSVLPAIVTRFT...ALQQEHENLQA...........VAEELAD.............CD.PEELDAAR.SDLA....NIE....SDVE..E...........K...........T.RRVAELRQEL.EEAE...QD...VEELK.QEKQQCH.EDIKEAE...RIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GNT..ISMTY...RKE...I.ELVFDLA-s........................................................................................
A0A139HU98_9PEZI/748-1064              ..........................................ENLEPVGLQDFLSKANIRF..MD.L....................TTT...KRR..LTTAVPPSQAkg..................sqdVQAEQIDLESGVVAAVCTIPELELYQHACHELRRFTKE.GKRVIGEL....EQ.ET.....RKN..Q....PPLLQ.....VYM............NA..............S..P.DK...KM............V.................LDA...A...MRDMKTNARLRSKEMWYAWRS..QL..L..EELMG..GLSKIGEGL....IQD.VEILTQSEEVL.DEVLPPLVKQHE...GLQQEADTLEK...........TVNAIPE.............GD.KEQLNEAR.ENLV....HVN....STLA..E...........K...........R.KLLDDLRRKV.EEQD...SL...AEHLQ.DSKLELT.AAIQESN...RVRE.....A.CR....GV..S.IE.EVS.KLK....................E.....SVARIESESG.WTITS.ASs....................sPST..LTMTY...RSQ...I.QLFFHPR-a........................................................................................
A0A1X7R0J6_9SACH/436-751               ........................................nk--ISDYSLKEFIKDTDVGF..LT.Di..................nILR...QDV..KSIAFPLITQ.......................TEDSIFKAQSLYNALYNDIPMVQMNTFIIKELLSISSQ.SSKSFENL....DK.QI.....MDSsnP....PLLLL.....DYF............NS..............D..D.KT...KE............K.................MKE...Q...LQLIKYFAKLHAKKSFNEWYL..SQ..L..KNLKS..VLIENETFL....EQE.YQKIKSSLEDI.KLIHVNVGNIKK...LLKAELQAIETss......ktdQ---IGEy..........slSQ.KIRLTWLK.QELQ....KNK....LSIE..-...........-...........-.-QYPKLCEQE.KTLA...NL...IIENQ.TKLKNLK.AQITSKT...DGII.....D.GK....EI..E.-P.QLN.ESQ....................N.....MLYALENLTG.IKVAS.FK......................NST..LSLKF...Q--...-.--------dipngmitvnlda............................................................................
H2AS51_KAZAF/421-735                   ........................................tt---EKYSLRQFIDEIGAEY..NP.D....................TNT...SNAlpSYIELSGLEP.......................SETDFFHTGKLVLALYDEIPVLQMNSFISKELFRMNEQ.SKQYLEDF....EK.QL.....SSSnsQ....PFLLK.....KYF............TS..............A..G.DD...KK............S.................LIQ...Q...LQVIMLFSKLKAKKLWFNWQL..SQ..L..SNLKN..VLEENLTLL....ITD.YKKVQDLCEVA.LKIRIRTENIRD...LVQKEITLLKEsp......dssNIQELSL.............EN.KIQLQRFK.IELK....KHQ....LTAA..-...........-...........-.-NLPELLKQK.STLN...NQ...IQQIS.KDIKKVL.INQQ-LI...KQEG.....N.VS....IA..E.GS.KIG.VLT....................S.....EMDLLQNLLG.IETLK.FE......................KSL..MTVRF...SHFr.dV.EIVIN---lek......................................................................................
A0A2C5WV88_9PEZI/1057-1369             .......................................egg---DRIHLHDFLNMTSIRF..ME.L....................NTT...KRR..HTIAPTKMDGs....................vmDFKADMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFR.....EYM............SA..............T..P.EF...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGIKE..GLLRIREGM....DDD.QALVEKQEGLV.ASVLPAAVEKQE...TLTKEKDNIEA...........FVKEISA.............CD.PQELQTAR.DDLA....NTT....DRIA..A...........K...........R.KEIENLKHEL.EETE...AD...IASSI.EYKKECQ.EAIVEAE...RIRE.....E.CR....GW..S.SV.EIN.ALK....................A.....RVERLEKKHG.WAVCA.IT......................GTQ..ITMTY...LGD...I.ELVFDAA-a........................................................................................
A0A0D2FUT2_9EURO/1105-1426             .........................................s-QEEKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAHSMPTRp....................sqEGMGGSSTEASFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....EA.ET.....LAE..Q....PALFR.....EYV............DA..............R..P.DV...RV............I.................MDN...Q...FRNGKAHARLQSKEGWYQWRA..QL..V..DGLKA..GLQGIDEGM....KTD.LELLQQQQQML.HDVLPLLHQERA...DLEGQKSSLEQ...........SLKELDS.............VD.HEVLNDCR.RQLQ....NAD....EYFL..Q...........R...........S.ALLDSLQEQM.KEKE...DA...LQAAD.ELKTEMK.EQIAEAD...RVRE.....E.HK....GW..P.VA.DVL.ALK....................S.....RVEVIEKQTG.WRLVS.AEeevd.............eptdlGAA..LVMTY...KDE...L.RLFFYPQ-a........................................................................................
G9P9L5_HYPAI/908-1221                  ........................................ve--EGQMHLQDFLDLTSIRF..ME.L....................TTT...KRR..HTIAPRTSQSgi...................lpDGEDDRSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....FED..N....PPLFQ.....EYI............SA..............S..P.EV...KA............L.................MDN...Q...FKNVRTHSRHLSKAMWYEWRM..KL..Q..EGLKE..GLVSISSGM....DDD.VKIIEEQEALL.KSVMPSLVGRYD...SLLEESNNLEE...........AARELAD.............CD.PAELQATR.EELV....SLD....DDIA..Q...........K...........K.KLIAKLRQEF.DASE...AD...VEELT.GRKAQCL.VEIQESE...KIRE.....E.CR....GW..T.ST.EVN.NLK....................A.....RVEALEQEHG.WAVTG.IS......................GPT..LSMTY...KRE...I.ELVVDTT-s........................................................................................
A0A1D2VB96_9ASCO/1020-1325             .........................................e-SYKPVSIDTFLDTIGIKF..FD.N....................LSI...TSK..NIILEGDFKN.......................---KEPSLLDYSEALE-KLPMIELYQFGCKELKKYIRE.GCIDYKNL....SE.EV.....LED..N....PQVIK.....EFF............MS..............N..S.SI...KE............K.................LQE...Q...FQLAKNYSNTQAKGVWYEWKS..QL..I..EGLLK..LLEEHLEVL....VED.ESFLIERLQQV.KKINLDLSDRAK...ELNKELNLLLF...........KNKIIED.............ND.KDENFLLR.NELI....EIT....DKIL..S...........N...........Q.KNIESGENKI.RAIR...NE...IDEKR.IVIQDLE.EEIREKE...EILL.....K.QK....SV..E.TE.EIF.LKK....................K.....RIGELVEKHG.FKIDK.IDe....................rNKE..ISISI...LSE...-.--------ilreena..................................................................................
A0A0D2DJS3_9EURO/1057-1378             .........................................a-EQEKISLQDFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPARe....................sqEGAAAPSTEVNFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KV............I.................MDN...Q...FRNGKANARLQSKEGWYQWRG..QL..V..DGLNT..GLQGIKQGM....AAD.LDVLQQQQRVL.EDVVPQVLQEQS...ELEIQANSLRQ...........SLEEFDS.............ID.REALENYR.QQLR....NVD....EQFL..Q...........R...........S.AHLEDLQQQM.KEKD...DA...LSAAA.DYKTELQ.DQIAESE...RVRE.....E.TR....GL..P.VS.DVL.ALK....................S.....RVESIEKKTG.WHLLT.AEeevd.............epnefGPG..LVMVY...KDE...L.RLFFHPQ-a........................................................................................
A0A162Y2E5_DIDRA/734-808               .........................................s-EIERISLSEFLSLTKIAF..MD.V....................SAS...KRR..ATVAPAAFHDm.....................dVDETPETLDRYVVAGACTLPEYELYSHACHEMKS----.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------e........................................................................................
A0A1V8TMQ3_9PEZI/854-1170              .......................................qpk---QQVHLQEFLDAAGIRF..MD.L....................TTT...KRR..MTVMPTPSKNrk..................stdVLEPEVTLAAAVVAAACTEPEKELFSHACHELKRYIHE.GKGAIKEL....EA.ET.....FRE..T....PPLLQ.....AYM............SA..............V..S.SR...KA............V.................IDA...Q...LRDIKTHARLRSKEMWYGWRG..QL..L..EELMH..VLHGIAEGL....LRD.DEVLLEKEEII.AEVLPGMLEQRD...GLEVKAARLQE...........AANAVSP.............EE.KEELDAAR.ERLV....EID....EELE..A...........K...........R.LLLRSLEEES.QTLA...DT...EETLI.DARTEYT.AAIASAD...KVRD.....S.CR....SI..S.VD.EIA.ALR....................D.....NITALEQTHH.WSITS.ASs....................hPTT..LTMTY...AST...L.QLFFHPT-a........................................................................................
A0A0C3G059_9HOMO/685-1004              ..........................................EDGPHISIEQFFNMTGIRF..MD.E....................ITA...PRR..STIHPSALRPrrhss.............pssmsPADSDIPLAEYVTAMSIDVPQLELYTYVSKDLEAWIER.SKGIFWEA....EA.EA.....EKI..T....PELFR.....EFV............AA..............G..E.DG...QA............E.................LLH...Q...LKLIKANTHGNAKSEWYDWKL..QW..V..GQLFG..KAEKGFADL....TED.AKALEVITKQA.QALVPSLREEYD...QIMRELEQEKV...........LVAEIEN.............SD.QKYLSELK.NTIS....EQN....AELE..A...........F...........C.ADVAEGNAKL.ECLE...EK...LQELD.SQKREAT.AAIEKAQ...RLLH.....I.QK....NS..T.RA.EVF.RLK....................D.....ELETLENLHL.WHAAK.VH......................PDF..LEFIY...ASM...Y.RVSIPC--vk.......................................................................................
L1JC32_GUITH/452-744                   ......................................kdsg-----ITLDSFLDEIGIRF..LT.N....................AKA..sKRK..SSVCPP-LRLv....................pgEMTEVDKLNEVLVSET-ELGQL---RNNSSRLRSMYEK.LKEDMVEL....EE.AI.....NRH..N....PECFA.....LPF............GE..............D..Q.EV...TM............N.................FQK...Q...MKLLKKFCRAKAESRWMEWRE..SA..Q..QQVED..ALQRVKDAV....LED.GAMIDQKMVEL.AEERVRVLQEKS...SIATE--GLRA...........-------.............--.--QLTSMA.EAEA....EQS....FVVG..A...........F...........R.KQVEDLESQR.QQLE...ET...IESIK.EEAAKVS.VNPN--D...SMLV.....E.LE....GI..G.EE.DVA.RLS....................L.....EHAATQGLVP.WRLLR.TS......................TGG..LTLQL...EG-...-.--------gwtlnvqlgk...............................................................................
B5RSQ9_DEBHA/630-937                   .........................................q-NYTPVSLNDFLKDISIRF..YD.Dle................igIKS...VDR..ISISLPKINN.......................--EESYKFDEFVTAMN-KMPLLELYDFSCKELTKNIKD.GTVLFDQF....NQ.FT.....MEN..N....PRLFK.....QYY............SS..............S..P.NE...KL............S.................MKS...E...FQLIKDYTRLQAKEVWYGWRT..QL..I..KNLII..QLDEKHYTL....VQA.RSLLLENLTLL.NGIHEQLKDKFD...NLSNQLNQLLQ...........IESNCND.............LD.SSDLFSLR.NELS....VTC....KQFK..E...........N...........Q.QNQTIQNKEL.NKLN...SV...ISDNK.ALINAFT.DEINDVE...KSLN.....R.NK....KY..E.LS.EIE.LLK....................L.....KFNFLQSFTN.LNYKY.ME......................GTK..LIF--...---...-.--------nfigvevamef..............................................................................
A0A0L1HLZ2_9PLEO/1057-1368             .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPAAFHDv.....................eVEEKEESLDRFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RI............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKA..GLLHTMDGF....KRD.ESTLVNQEQLL.DVVLPPLVEKKE...HLSTECKRLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....AELE..E...........K...........K.QLFAQLQNDL.TEKE...TR...IEAAK.TRKIECV.EEIKAAE...RVRE.....E.CR....GW..S.TT.EVS.SLK....................A.....QVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFVPS-a........................................................................................
J3K4P4_COCIM/995-1318                  .........................................t-EFKPLQLSEFLKMTNIHF..ME.L....................NTT...KRR..HTIAPDAEKRrit................evdgQVTENISLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLDHHVEEM....NRD.SEALSKKEKLL.DDVVPELVNKHA...RLQVDAHNLEK...........AVEEMKN.............CD.QEELKQAR.ERLR....MID....LEIA..Q...........R...........K.EDLNKAQSDL.EKTS...NI...VKKGT.EQKAKLL.KDIQEAE...SILE.....E.CR....GW..S.VN.EVD.SLK....................A.....VVRNLEKSSG.WTIIS.VSsgs...............gtkyGPA..LSMRY...SNE...L.RLDFHPA-a........................................................................................
A0A1S9DTC4_ASPOZ/1008-1331             .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSAAKrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLNRHVEEM....RGD.DELLSKHETLL.SGVVPALVEKHT...SLEEQATSLQQ...........LADEIEN.............CD.QDELRDAR.GKLS....SIE....EEIA..S...........K...........Q.KLLEELQAEA.QEKA...NI...IEAGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKIERQTG.WSIIS.ATsps...............sssaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
A0A059JDI4_9EURO/978-1300              ........................................tp--VEPIKLSDFLEMTNIHF..ME.L....................TTT...KRR..HTIAPGSPEKcgt.................eslKGAKEFGLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............T..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHVDEM....KQD.DAILSRKENIL.ANVVPGLIERHD...KLEIDSQNLQK...........VIDEIEN.............CD.QEELRDAR.KKLL....AVE....TELS..G...........Y...........K.DKCTQTQSRL.EAKS...DL...LERAQ.ARREELL.QEIREAE...GIKE.....E.CR....GW..D.GK.EVR.VLQ....................D.....SVHSLENQTG.WTIIS.AKpsm...............dvvkGTT..LSMRY...SGE...L.QLDCNPS-d........................................................................................
A0A0D0DUX6_9HOMO/816-1129              .........................................d-DGPQISVEQFFEMTGIRF..MD.E....................IAA...PRR..STIHPSALRPsr...................raSTEGEIPLAEYVIAMAVDVPQLELYTHVSRDLQAWIER.IKEIYKEA....EE.EA.....LKM..T....PQLFQ.....EFV............TA..............D..E.NG...QA............E.................LLH...Q...LKLIKVHNHAQAKSEWYDWKT..QW..V..EQLYQ..KADEGFENM....EAD.ARLLEGIIRQT.QDMIPALQREYD...QLMDELAKEKA...........EVAELEG.............CD.QDYLNELK.ATIA....EQG....VELD..T...........F...........R.ADVEEATAKL.DRLH...EK...LEEVE.MQKKEAT.VAIENAE...RGIH.....L.QK....NS..T.RA.EVF.QLK....................D.....ELEALENLHM.WKATK.IS......................PDL..FEFTF...ASS...Y.SVSIPC--ik.......................................................................................
E3JT36_PUCGT/1005-1216                 ................................ssqkhvedle-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............Q.................IMN...Q...LRLKKNWVEMSAKKDCHLFDI..EM..W..KTYQA..HLHDRTAKL....SHD.LEMMRKMDSIV.KPATESLRERKQ...SLIEEIRRRKQ...........KLAEIES.............CD.QNLLKALK.EEAK....DLA....AVTE..A...........N...........R.RELAESEFER.NLWL...GK...FAELD.EEKNEHL.QRIEQLK...RDPE.....Q.TQ....QC..T.VQ.ELT.RLK....................N.....EFKMLQSMLG.WEVVR.FE......................DEL..MEFIF...YST...I.GVKLHL--ap.......................................................................................
A0A0D7BAE5_9AGAR/1-297                 .........................................m------------QMTGIQF..MD.N....................LRA...PRK..SVRSTKMSQI.......................RPLENISLSEQAMAVLLELPQLMLYSRVGHELQEWITQ.NSEVYSKM....EE.EA.....LEA..T....PELFI.....EYA............RA..............E..E.DE...QA............D.................LRQ...S...LDIFRSNVRLQSRGAWYDWKH..QW..L..TGIHA..TAQESRQEY....EAD.VHLAESLRKQA.EADTAALEADYE...ALSRQLEKEEA...........EVAELEG.............CN.MEYLEELK.SSLA....DQN....GVIA..S...........L...........E.AEVSQTEGNA.AHLK...EH...LTQIQ.TEMKSNL.DALTKAM...GLLH.....V.SK....DK..-.-L.ERS.RRE....................T.....QPQSLQKIHM.CVVTS.YK......................PAL..FEYEY...ASQ...Y.RVRIPCS-d........................................................................................
G1WY71_ARTOA/986-1299                  .........................................a-DVPNMPMKEFLSMIGISF..LD.Gi..................tSTK...HRR..QTGAILGLGV......................eMNDEEVSIGDQINGQLTIRPFLELYEHLQRELKRSNKE.GKEMFKQI....EK.MV.....LEE..N....PRLFR.....EYL............LA..............P..P.DV...RA............V.................MDL...Q...FKNIKSSSRLEARGDWYTWRQ..GL..Q..ETIKS..KALENLESL....KVD.EGGLKKWREVV.DKLGPGLEEKKN...ELEEKLEVLKI...........RKEEIEG.............CD.PKELEEKR.EALK....NAK....KRLE..E...........K...........K.KELERLNGVS.EELE...GE...VRGRE.ERRETCL.SAIESAE...RVAE.....A.NK....GY..T.EE.EVV.GSI....................D.....RVRQLEEKTG.WMVKK.AE......................SPC.fLEMVY...KKA...L.AVRFNAQ-r........................................................................................
A0A1V6QSG3_9EURO/965-1290              ..........................................EEIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KGD.DDLLSEREDLL.NRNVPLLVEKHA...SLEQEATSLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........R.RELEKLQKEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.DLK....................G.....SVQRIQQQTG.WSIIS.ASsps................daeGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
A0A0A1TFV8_9HYPO/900-1213              ........................................re--PDQIHLQDFLDMTSIRF..ME.L....................NTT...KRR..HTTAPTESMNgr...................raSDSDDMSLERCVVASACTVPKLELYQHSCRELKKYISE.GRRMVKEI....EA.DT.....FED..N....PPLFK.....EYL............SA..............T..P.DV...RA............L.................MDN...Q...FKNVRTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLVTINNDM....EQD.YRTLKQQEHLL.ASALPDLEAQFD...QLDSQRQDLQS...........AAQEIAD.............CD.PETLSSTR.DELV....SLK....EQID..Q...........K...........T.RLLEELRSEY.QTSE...SY...VDELS.SKKSDIL.ADIAQSE...KTRE.....D.CR....GW..S.SS.EVR.ALQ....................D.....RVDGLEKDYG.WAVTG.IS......................GAN..ISLSY...KRE...I.ELVLDIS-s........................................................................................
C4JFA5_UNCRE/852-1175                  .........................................v-EAKPLQLSEFLEMTNIHF..ME.L....................TTT...KRR..HTLAPDTDKKhiv................ddndEGSKDINLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLNRHVEEM....NQD.AEVLSKKEILL.DNIVPELIEKQA...RLQIDAHNLQK...........AVEEMEN.............CD.QEQLKQAR.EKLK....TME....LEIT..Q...........R...........K.RDLHEAQSNL.EKSS...DI...IEKGT.KQRMQLL.KEIQEAD...HILE.....E.RR....GW..S.VK.EVY.NLK....................A.....AAQDLERSSG.WTIIS.VNptp...............dskdGAT..LSMRY...GDE...L.KLDFHPE-a........................................................................................
W6MG30_9ASCO/379-679                   .........................................a-DYEPTETFEFFKEVGIDF..RE.N....................I-S...PFE..PRFKPEHR--.......................---DAPQEDDFAKAIP-RMPELLLVMYELLQMINTIQD.RKSLLVEE....EA.RL.....TKH..N....TKLMR.....DYR............LS..............D..R.QT...QK............Q.................LRS...M...FLNTRDVKKHNAGLEFYQFKN..IN..L..ESIEK..DLGDYNDTI....TLR.AEDAALQSSKL.ADDNERIRIKIH...EMKSRVANLKA...........-----AK.............MT.PVEFADLK.HGLA....NRT....EELI..S...........L...........Q.AKAAELNLQK.QALE...SS...SKTTE.SLV----.EQICLEN...EA-I.....A.HR....IL..Q.NQ.DVK.ASK....................I.....RYALVEHLSN.LRLTK.AD......................KKT..-----...---...-.--------pdsrvvsvqglgfetqvemtslqsl................................................................
A0A1Y2AZJ6_9TREE/556-867               ..........................................EQAPTIRLADFLEMAGVQF..ME.Al..................pGLN...KRR..SSIGKGLLGQst...................ygSNDREFGLHEYAEAQV-QSVFLNMYTWASNKMRADIQQ.SQNDLSAT....EA.IC.....DQV..N....PRVIK.....EYL............SA..............S..D.ED...KQ............L.................FEM...T...FKAFKTNTQLMVREEWYDWKT..KL..V..ERVQP..DVKEHLEGM....RQD.AARLQDMAGQA.AQLLPELRARKE...MLEKELAKERE...........MIKEIEA.............CD.QEELKELR.GAIA....EQS....GQIG..I...........F...........K.AELSDSTTKL.NDLE...SK...LAEVN.GKADEHR.GKIGEA-...--RS.....K.CD....QY..T.RS.DVI.RLQ....................E.....EYDSLAHLHL.WRPTA.VK......................SDV..LELEF...DDE...I.KLSFECR-d........................................................................................
N1PZS7_DOTSN/700-1015                  .........................................a-QAETVGLDDFLTKAGIRF..MD.L....................TTT...KRR..LTVAPTPSKArg...................saHDDEDVNLENATIAAACTIPELELYQHACHELKRYTKE.GKQMIAEL....ET.AV.....QKE..Q....PPLMK.....AYM............HA..............A..P.NR...KL............D.................LDA...H...MREMKTNARLRSKEMWYAWRS..QL..K..DELVG..GLQSIGEGM....IKD.DELLARSEEII.EQALPTLAAKRS...ELQAEADRLEE...........RANAVPE.............EE.KEELNSTR.EELT....GVN....ADLR..E...........R...........Q.QMLDALQKQV.EEEQ...AS...VEHLQ.DSRDEFV.AAIQEAN...RVRE.....A.CR....VV..S.TK.EIT.TLK....................D.....SVKHIEDTFG.WCIIS.ASc....................sPST..ITMTY...RSQ...L.QLFFHPK-a........................................................................................
Q2HG07_CHAGB/294-540                   ........................................sp-------------------..--.-....................---...---..----------.......................---------------------------SCRELKKYISE.GRRIVHEI....ET.ET.....FEE..N....PPLFR.....EYM............TA..............S..P.EF...KV............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLKTAEGM....DDD.DRLLSKQQELI.SSILPDMVKRFE...ALELEHGDLEA...........VAQELAD.............CD.PQDLEDAR.SELA....SVD....KSIE..E...........K...........T.RKLAELRQEL.DESV...QS...VEALT.QQKQQYL.EEIKEAD...KIRE.....E.CR....GW..S.SE.EIR.KHK....................A.....QTDAIEKQHG.WAISS.IA......................GTT..LTMRY...KRE...I.ELVFDLA-t........................................................................................
A0A1Y1HMV0_KLENI/1194-1454             ........................................ag----RISFAEFLYKVEIRF..FD.N....................---...RNR..ASMFGQQTPT......................aDLAPPEGLADCLKVVCFNQPQTTILDFGCGELRESIAA.KKASVAHF....EA.KL.....QDM..C....PAIFH.....AVQ............TA..............A..G.PE...RA............A.................LLK...K...LKDLKQRCRLEARRQWLEWRL..RL..E..ENTSE..RLQENERNL....MED.LAAVQQKRQQL.HALRQDVRNFQA...EIEANIQRAED...........EL---QA.............-A.REREEETR.GIKV....RLA....EEVR..R...........Q...........Q.AEMEEREQQA.REAE...RY...RESMA.AQRESAE.AEHQR--...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------llerlrlldascaeara........................................................................
A0A1D8PQB7_CANAL/610-918               .........................................p-NYISVSLSKFLSDIRVQF..YD.D....................LEL...DLN..SIPRLSITNS.......................--IELPTIHDYIKAKP-NLELLELYEFCCNELNKKIIQ.GRELYNEY....EK.TV.....LVN..N....PILFK.....KYY............SM..............D..D.KT...KL............L.................INL...K...IQLIRDFARLKSKKTWYDWRN..QL..T..ENLID..KLDEEINSL....TID.KQEIIKDINRL.NELYDKTRIYLK...GLNHKFNELIR...........LKNEINE.............IP.PNELNKLQ.LDVR....KRK....QDIV..E...........I...........N.KEIEIKLSEL.STIK...KN...LDTSN.NKKLTLQ.TQLNDLE...NQFN.....Q.IR....KY..D.NL.EIK.LIL....................Q.....KYQFLQHLTN.LKYLK.TIe....................sGQK..ISFLF...DDS...I.ICEFDF--in.......................................................................................
G3XZH3_ASPNA/994-1321                  ..........................................QQFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLDRHVQEM....KAD.GDILSKHEALL.AGVVPGLEEKHS...ALEKEATTLQK...........LADEMEN.............CD.QDELHSAR.EKLS....SVE....AEIE..E...........K...........K.RRLQEMQDEL.KTKT...DT...IESGT.ALKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..ITMTY...RNQ...L.QLTFHPA-r........................................................................................
A0A1A0H902_9ASCO/636-943               .........................................w-DVPEISLTDFLENIGVKF..YD.D....................LEL...ATD..FSAMYHASSL.......................-GTGSQPRDAYYKAVI-QLPIFEMYELTCKELTAQIQE.GKRNFDKL....KE.EC.....QQS..N....PFLFK.....HYL............SS..............E..P.HE...QL............A.................MRT...N...YHVVKEYSRQKAKGLWYEWRK..KI..I..QNVLH..VYQNSYEAL....QEE.RIALESQIGSM.DHQIASIHNQLR...ALTFDLRRFKE...........IQADSKG.............LD.RQHVYEMK.ARMV....ELN....KSLL..N...........H...........K.TLISEKEDSV.QALQ...KE...IDDRS.IGMKQLR.SLLSGAE...EELN.....K.MK....HY..N.SK.EIK.DLQ....................V.....STQILQACAG.LKFVG.HQ......................KHL..YEFEI...DPR...I.RIMVDA--tt.......................................................................................
A0A0D2MHZ0_9CHLO/252-558               ......................................aahl-----ITFQDFLQIVDMQF..LD.H....................I--...RRG..TSINMMDLAP.......................-GPVPSDLADGLRALSLTGPEAAVLEGALNELHGVMRS.KRGQVHAL....EE.EL.....EVH..N....PAVFA.....AVQ............TS..............R..R.TD...LE............G.................LKH...A...LVLRKKCCRAQTGSGWKRLRA..GM..E..RGLAG..RLAEQQARL....EEE.LAFNNLRRAHQqRELVQAFALDAQ...QRMD----AEA...........AERDAAG.............AA.RARLQYAR.ARLE....ELR....AINA..D...........R...........Q.RRADSVAAEA.AQLQ...AE...RSRVD.AERAAAQ.QQLEGLA...STVTsvptpA.RG....QP..S.AD.RLI.DAG....................E.....RFDILMGLQP.WRLTA.AE......................GGG..WLLRF...RLG...L.TC------qlsfs....................................................................................
A0A0J0XXP2_9TREE/882-1188              .........................................v-EVQNVPLSAFLEMVGISW..QD.D....................LIG...RKS..LAARTDSLKSq.....................fPKGHDFPLPEYVVANL-ESIYLSMLSWADSEITQRTQQ.GREILTTI....DR.VC.....SEN..N....PPVVH.....DYL............AA..............D..E.ED...RG............M.................FES...V...LLQIKSVTYLRARARWYDWKQ..SI..L.sEKVEP..DVRGIRDDM....LAD.AERHAAERQTI.DRVLPSLRKRRD...ELEAELAAHRA...........QVEAVLA.............CD.PEEIAALR.EGIE....EQD....TELD..R...........F...........R.IELSGKNERN.AEVE...QE...LAALM.SQGDQHT.LAINAAR...SMCD.....-.--....QA..T.VG.DVM.RLD....................A.....ELEALQALHG.WKVLR.A-......................GPR..VEML-...---...-.--------lgelelavpvda.............................................................................
G0SF01_CHATD/907-1217                  ........................................dg--EQRIHLQDFLNMTGIHF..ME.L....................TAT...KRR..HTTAPNASKDg....................gaPDPKDVSLERCVVAGACIVPQLEMYQHACRELKKYISE.GRRIIKEI....EV.ET.....YED..N....PPLFR.....EYM............NA..............T..P.EV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRT..KL..M..EGLKE..GLLKTAEGM....DND.DKLLKRQEELI.ASVLPDMVKRYN...ELEAEKDNLEA...........VAQELAD.............TD.PKDLEDAR.NELL....AVD....KAIQ..E...........K...........A.KKLEEMRREL.EESD...KK...IEQLT.QQKQQYL.EEIREAD...RIRE.....Q.YR....GW..S.AG.EIA.KLK....................E.....S---IERHHG.WAVLR.IT......................NNA.lLTLRY...KRE...L.TLTFDI--vs.......................................................................................
A0A1V6NR63_9EURO/956-1281              ..........................................QEIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVEEMDN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........R.RELEKMQEEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.DLK....................G.....SVQRIQQQTG.WSIVS.ASsps................daeGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
A0A0A2J448_PENEN/963-1289              .........................................a-EIESIQLQDFLKMTNIHF..ME.L....................TTT...KRR..QTTAPGSAIKkltrp.............sgeniPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........K.RELERLQAEV.QEKT...RF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.DIN.ELK....................A.....SVQRIQQQTG.WSIVS.AStss...............dvsgGPL..LKMAY...RDQ...L.ELEFYPG-a........................................................................................
A0A0D2WL06_CAPO3/784-1080              ........................................sp--AEQLSLAQFLIMAQVRF..LD.Q....................ISY...RRR..TTIALPTNIPaagtatgaa....taplldfgrvDDSIRHSISFSIDKAY-LVE-------GCQTYEEITQE.LRRVIGSM....EY.DM.....SKS..N....PPLFE.....TLSi.........ltQA..............Q..D.MA...EI............Q................lLRR...N...LAATKAYHSSISHFRWYEWRA..KM..E..DGILR..DMNEELPLV....RED.LNQIRKTSSRV.SALIEAAKKSKE...QMAARVASLKA...........TA--VNP.............SE.QQNLTAML.QLGN....SNV....ARFR..E...........E...........A.AAVEASKAQA.TKLN...EQ...LNQVT.PKHVQLA.KE-----...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------rytsivrlvsfsvseltkqevvlefldkqlelrlr......................................................
K0KTU6_WICCF/512-817                   ..........................................DEYAPVPLKQFLEDLGVEF..FD.N....................LNI...NED..FTVVLNQIEN.......................--NTEVKKIDYLKAKSIKIPWLELYSFSCSELQKDMSK.LKLFLDNY....ND.EF.....IEE..N....PQLVR.....EYY............QI..............R..D.TQ...EQ............R................rLSD...S...LLLMKTLSDKEAEVSWLEWSY..QL..L..NELDN..RLIDHLDII....EKD.SINISNKVKEL.TNFEEELDLELE...NLSEQMNDLIE...........QNEIFQA.............SQ.NEDVMQTR.NNLY....KIL....KDLN..N...........Q...........E.ENLEKCQIKN.DELS...QK...V----.SQYKEIE.EIVEQKE...HIVK.....I.NG....MD..L.DT.RVQ.IWT....................K.....QFVALQSISG.IKLLS.LN......................DTI..LNVSF...ASN..mI.TASIDLT-k........................................................................................
E9EBN2_METAQ/901-1214                  .........................................a-DDERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..LTVAPKSLQDgs...................sgDGEDDMSLERCVIAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....EE.KT.....FEI..N....PPLFR.....EYI............CA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLISISEGM....DAD.EKMLKEREALL.AAVLPGALERYE...QLEEESENLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLE....ADIE..A...........K...........K.RLIVELRGQL.ESST...SE...AEDLA.AKKQSLI.IGIQQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................S.....RVDALEKEHG.WAVTG.LS......................GTS..LSMAY...KRE...I.EVVFDIA-s........................................................................................
A0A1E3PST3_9ASCO/981-1291              .........................................v--YEPITLSEFLKLIDIEF..YD.D....................GIA...SNG..SKISFSSLDNi....................aeKDLLKPTLTDYSIAIC-KLPVLELYGFACKELTKDIQS.AKEDFARF....ES.GT.....VEE..I....PVLFK.....EYL............DS..............P..A.SV...KM............E.................MIR...N...FKLLKKWARGQAFSGWYNWRF..QL..T..SGAIK..AVKKTLVLL....DED.EKSISKMKNEV.ESSWNDFEIHWE...DTNRSISESEA...........LLEKLES.............ND.LTELKKIK.EELA....IAE....EILA..T...........K...........N.LELESLEGSM.SDLE...RS...ITSNK.SIIDKAN.EAIKKAD...QVRD.....K.NR....EF..N.LN.EIK.SFI....................D.....QFLYTQKISG.FEVLS.IN......................GTQ..INLTM...DKC...V.SVSVDTTN.........................................................................................
A5E5H1_LODEL/668-989                   ....................................sssssv-------LTRFLNDVAVNF..YI.D....................PEI...ETS..SNRAVADVSM.......................-EIEHPELSQFITCLPLK-DFYAQYVYGCEELLQKIGD.YDAEYEQV....IH.HV.....DVE..P....YTNIQ.....EYY............NTnnsnnnvnkfkndeR..E.AS...RA............S.................LNM...L...YQTVRDYTIAECRRDWFMWRV..SS..T..QSLLE..HLEAQRELL....DND.RNLLRGDLELL.DKLLEESLRYVN...ELKVKVSKIMS...........GQEQIDR.............FT.AEELKIIK.QDIR....KFK....TEVR..D...........M...........Q.HLLESKQRTL.SEID...LK...IKEVE.NETSKQE.SELQDLT...FQSN.....R.RR....IF..T.RA.EKT.EIV....................Q.....LYRFLSKFTF.LKYES.TS.....................vDNV..LQFEF...DKS...L.TITFDF--lq.......................................................................................
F8QD76_SERL3/1-295                     ..........................................-------------------..MD.E....................ITA...PPR..SAIRPSTFRPar...................hsSANFEIPLVDYVIGLVVNVPQLELYTHVSKDLEAWIER.IKELYEEA....EE.EA.....AKI..T....PELFR.....EFM............AA..............E..Q.DG...RT............A.................LLH...Q...LKLIKVNTHGQAKSEWYDWKL..QW..V..GQLHQ..EAERGFKAL....ESD.AKVLEGVTRQA.REVLPQLRDEYQ...QIMRELEEEQK...........LVEEIEN.............SD.QDYLNELK.ATLA....EQS....AELE..A...........F...........R.VDVDESNAKL.QRLR...EK...SDEIN.SQKQETT.SEIASLQ...RFIH.....V.QK....SS..T.RF.EVY.RLK....................D.....ELEAMQDLHK.WRITK.VH......................SDL..LEVIY...TST...Y.RVSIPCA-k........................................................................................
A0A1B7TF80_9ASCO/227-562               ....................................eekygv-------LAAFFKQMKLSY..FD.Elp................eyLSN...EKN..KLILNNDFYKsnnki............klfisnEDLNKIEQAIVYLNLYTKTPMLEIDRFIINELNSKLET.SLANFNKI....NK.DYndpenRKK..L....PFLLQ.....NFK............VL..............K..Q.DS...YY............Fe...............kLID...I...FGVMKKNCDLESQKIWLNWRI..QQ..F..DGISL..VLRDNFLIV....KEQ.QNELNIFEEKL.TAILQEVEKLIE...LGTFKNKFFNK...........RESLIED.............SF.RNKNTFNK.SIIT....RSS....EQIN..E...........D...........I.KKWETKRKQLlQKYDidiGE...INEITkEKQREIM.AQIKSKK..nNIKH.....K.VK....PL..N.DS.ASL.VAK....................Q.....NVKNDSALLKiLKINK.LN......................GVK..IESKS...NKN...F.KVSF----ay.......................................................................................
A0A0C3NP96_PHLGI/1-309                 ..........................................-------------MTSIRF..MD.E....................ITA...PRR..STVHPSHLRPhnrrrs...........ltsshsDEAEQIPLAEFMTAMSIEVPQLELYSVLAEDLTGWIEE.SKKICQQA....AE.DV.....LKM..A....PALFT.....EFA............MA..............D..E.YG...KQ............D.................LLH...Q...LKIIKASTVGGAKSQWYDWKS..EW..V..DRLQE..SADESFSGL....ESD.AKFLEQVIGQA.QSMLPALRAEYA...QVMEELEKEEA...........AVAELEK.............SD.KDYLSELK.TSIA....EQD....MEIQ..A...........S...........R.ANISEAEAKL.QRLQ...EK...HIEIE.DQKQEIA.AAIAQAQ...RVIH.....V.QN....ES..T.SS.EVL.RLK....................D.....ELETLEDLHL.WRTTR.LS......................PSL..MEFVY...AGR...H.QVSIPC--in.......................................................................................
M1WAV9_CLAP2/928-1241                  .......................................vdd---GRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTMAPNSLQDgs...................taEGEDAMTLERCVVAGACTVPMLELYQHSCRELKNYIAE.GRRIVKEI....EA.ET.....LED..N....PPLFR.....EYM............SA..............T..A.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRS..KL..Q..EGLRE..GLVNIAEGM....DAD.ERILKEQEDLL.AAVLPDALKQYE...ELEEESGNLEE...........AAKELAD.............CD.PVELEAAR.DELI....SLD....EDMA..E...........K...........K.RLIAELRREL.ESSV...AV...VENLT.TQKQALV.QGIQEAD...KVRQ.....A.CR....GW..T.CS.EVA.SLK....................A.....RVDAIEKQYG.WAVTG.LT......................GTI..LSMSY...KRE...I.EIVFDVA-s........................................................................................
A0A151GAQ7_9HYPO/1118-1396             ........................................eg--EEKIHLQDFLDMTSIRF..ME.L....................TTT...KRR..HTIAPGSLQDgt...................aaEGDDGWCLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....EN.DT.....FEE..N....PPLFR.....EYI............SA..............S..P.DV...KA............L.................MDN...Q...FKNVKSHARLLSKAMWYEWRM..KL..Q..DGLKE..GLINIAEGM....TKD.NQVLQQQEDLL.AGVLPDVVARHQ...ALEEECGNLEE...........AAQELAD.............CD.PAELEAAR.KELS....RVE....SDIA..E...........K...........K.KLISELRQAL.EKST...SD...VEALR.ERKQECV.QDIEKSE...RTRE.....E.CR....GW..T.IG.EVN.ALK....................-.....----------.-----.--......................---..-----...---...-.--------gmp......................................................................................
A0A0L6VFA7_9BASI/670-999               ......................................pptl-----ISLNEFFEQAEIRF..IS.Lsq................prVRN...HDQ..QEHPHISE--.......................AQQRTSSFAQQIYAGMVKIPRLRLLESSSRTLRQKTEL.LDFTTKEH....EG.LI.....ERNgqG....SKLLQ.....QWV............NL..............Q..R.KQ...AQ............LvqsspqasqktiedlnqIMN...Q...LRLKKNWVEMCAKRDCLLFDI..DM..W..KNYQS..HFSIRTAKL....NQD.LEMMRKLDSIV.KPSTESLRERKR...NLTEEIRRRKQ...........KNSEIEN.............CD.QNLLKALK.EEAK....DLA....AETE..A...........N...........R.RALAESDFER.NLWL...GK...FAELE.EEKNEHL.QRIEQMK...LDPD.....Q.TQ....KC..T.VQ.ELI.RLN....................N.....EFMILQKMMG.WELVR.FD......................HNM..MVFIF...VSS...I.AITFHL--dp.......................................................................................
A0A1B8DUD0_9PEZI/1019-1333             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdg..................segQMKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....ASD.ADILAKQQELL.DNVVPELVQKYE...TLLQQESDLQT...........SAEEIAN.............CN.QEDLTEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FNHAT.ERKQTCL.DEIREAD...KVRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0G2HXR0_9EURO/1040-1364             .........................................p-QVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTSEKKraas...............kaddEAGKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLNRHVEEM....QND.EAVLSKKEELL.DRVVPPLVEKHT...KLEAEAQNLQQ...........AVDELEN.............CD.KEELRQAR.ERLA....AMD....ADIA..T...........K...........R.KLLEHSQVEL.ENKN...NI...IKAGT.ELKDGFL.AQIREAE...RVTE.....E.CR....GW..S.VK.EVK.ALK....................A.....SVHALERQTG.WSILS.ASlkp...............sskyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A072PU39_9EURO/1044-1365             .........................................p-DEPKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQTLPNRk....................sqESVHDNTLEETFVAAATTLPLLELYQHSTRELKSYIST.GRKIVRSI....EA.ET.....LAE..Q....PPLFR.....EYI............DA..............R..P.DV...KL............V.................MDN...Q...FRNGKANARLQSKEGWYRWRS..QL..V..DGLKT..GLQSINGNL....SHD.LEILDNQQHML.DSVIPGLLQQQT...ALQKLQPSLQQ...........SIEELDS.............ID.HETLKKYR.QELQ....AAD....EYFL..Q...........R...........T.ALLSSLQEQM.AEKE...ET...LAAAA.ELQVEIR.DQIEEAD...RVRE.....E.HK....GW..S.SA.DVL.ALK....................M.....KVEQIQNETG.WRLIS.AEeead.............epnefGTA..LTMMY...KNE...L.RLFMYPQ-v........................................................................................
A0A166J8Y5_9HOMO/675-988               .........................................v-ETPAISIEDFFTMTGVKF..MD.E....................ITV...PRK..SIVRPTHLMSrr...................dsEGDSKPGLAQCIVAMNVDIPQLKMYAWVGSHMRKWIDE.SKATHRVA....EE.EV.....AKV..T....PAQFT.....AFA............EA..............D..E.QD...RK............E.................YTS...C...LKLIKACEQLRARATWYGWKQ..GW..L..AQLQG..DSEQSLRDL....DSD.ALTIKNLNREL.TELMPSLQEQHA...LIMQELDAEKE...........AVHEIEN.............SD.QEYLEELK.ATIA....EQN....GMLE..E...........Y...........Q.SKVSENRATL.ERLT...ER...LAEVT.AQQQEAT.EVIADCR...RKVG.....L.QK....NS..T.KA.GVF.RLK....................E.....ELEVIQDLHL.WETIK.VQ......................ADS..FEFIY...GSN...L.KVIIPCKN.........................................................................................
A0A0C3P769_PISTI/1-59                  ..........................................-------------MTGIRF..MD.E....................ITA...PRR..QSIHPSTLRPsr...................raSVDGQIPLAEYMVAMAVDVPQLELYTHLIK--------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------.........................................................................................
I2G3W3_USTH4/809-1114                  ......................................qvpv----QMPLNDFLRFVGVHF..ND.D....................MSA...SRR..KPVPPARSEQsaen...............galnESPAPVSMMRLVKAACGAVPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PDFVR.....EIM............GL..............Q.nE.EE...RR............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVDTKKQQLqQEILPVLRAKHA...KLKADLALAKK...........RQAEIET.............CD.AEELKGLY.SSIE....EQH....EVLE..S...........M...........R.AKLMDVEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRIL-.--......................---..-----...---...-.--------dngfdps..................................................................................
C5E2H5_LACTC/442-754                   .......................................ktr---EQASLKAFLHSVGISS..LLsDte...............lelL-P...INR..MSFVSS----.......................QKGRKWPVVEVYYGLYANMPILEIYAFCCKELLRRILK.SRELFKEL....EE.EI.....ARN.pA....PALFK.....RYF............ES..............G..T.LE...RE............K.................LSD...Q...ITLLRRFSRLEAEKVWLEWRS..RH..L..NGIKN..VLQENLLLL....KDE.YNSIMDHVDKV.NRAKRNILNTRQ...NILTEIRLAQS...........LTQSK-Sps........pgiPD.RLKLEALK.AELV....QEM....QALK..-...........-...........-.-SSSEFEKRM.KAVR...SD...IKNVK.LEIERTR.SAINSLR...SEVK.....G.SP....AF..A.AH.QAE.NLR....................A.....TFDIVQKICG.ISFKS.YR......................KSL..LTVQL...NDP..pI.TATFDIK-r........................................................................................
A0A067TNQ6_GALM3/790-1101              ..........................................EEVPSISVAQFFSMTGIRF..MD.E....................LTA...PRR..SMHPSQQPVHq.....................pRNSADIPLAEYVTAMAIDIPQLDLYSRVSKDLEGWMAK.SKVVFAQA....EE.EA.....AKV..T....PELFV.....EYA............RA..............D..E.EG...QA............E.................LMH...Q...LNLIRTHTRFLARSDWYDWKL..QW..V..EGLRV..TADEAFASL....EKD.ARALEEPKKAA.LEIIPALEKEYE...ELMRELEQEQA...........EVAEIEE.............SD.QDYLNELK.ATIA....EQN....IEIE..A...........L...........K.AELAEGNDQL.RWLQ...ER...SSEIE.TQKREAR.NTIATAQ...RILH.....M.KQ....TS..T.RS.EVF.RLK....................S.....ELEALEDLHM.SRITK.VH......................ADL..FEYIY...ASL...F.RVSIPCKN.........................................................................................
A0A109FI42_9BASI/748-1085              ......................................apvp-----ESIDAFLALTGTRF..AD.Dgllev..........vssesSAA...NRR..KSMAAKAVDAgepa..............dptrkDQAGPPTFADMTVAGACQALFHQLYHDEQKMLLEGIRQ.AHELVAQQ....EE.EM.....RRG.aV....PQIFR.....DYA............NA..............G..E.EA...KA............A.................MKS...Q...FGQIKLLYLLQNKCEWKKIRN..QN..H..GAIIG..FMEQNLELL....QRD.REVLQRL--EV.ETVVPSLEARHA...ALQSDLVAERA...........LDRELSA.............MS.TEDIEVRQ.SMLA....DAE....EQEE..QlvgnpekgipgR...........R.PELDRAEQHL.LSYR...ET...FDKYS.GEEARIQ.AEIAELE...ERRR.....D.KR....--..T.RA.DLV.RLQ....................A.....DFDALQQVHG.WRLQR.FD......................PRQ..IRMVH...FDDt.lV.ECS-----lqpgs....................................................................................
W6QAH2_PENRF/954-1281                  .........................................v-EIESIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrp.............sgesmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYI............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KAD.DDLLSEREELL.NRNVPFLVEKHA...SLEEEATNLKQ...........LVEEMEN.............CD.QDELRNTR.SKLS....EVD....SEIA..V...........K...........R.RELEQLQKEV.QAKG...TF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQQTG.WSIVS.AAipsd..............daskGPL..LKMAY...RDK...L.QLEFYPG-a........................................................................................
Q0V4Y4_PHANO/665-976                   .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPALFHDt.....................eVEEKEETLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....MEE..N....PLLFS.....EYL............TA..............P..P.DQ...RI............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..HDLKS..GLLSTLDGF....RRD.EQKLSNQEQLL.DTVLPPLVEKRE...MLSTECKQLQQ...........RHDELNS.............CD.REELEETR.ERLV....ATD....AELE..D...........K...........R.QLLEQLQQEL.AEKD...AR...IQAIK.ERKVECI.EETKAAE...RVRE.....E.CR....GW..S.TS.EVN.DLK....................A.....KVAALEQAYG.WSITS.AS......................SNG..ITMTH...LND...L.ELYFQPS-a........................................................................................
G0RMW5_HYPJQ/887-1200                  ........................................ie--EHQMHLQDFLNLTSIRF..ME.L....................NTT...KRR..HTIAPRSSQSgi...................lpDGEDDRSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....FEE..N....PPLFR.....EYL............SA..............T..P.DV...KA............L.................MDN...Q...FKNVRTHARHLSKAMWYEWRM..KL..Q..DGLNE..GLVSISDGM....KDD.LKVIEEQEKLL.KSVMPSLVSRYE...SLLEESSSLEE...........AAKEIAD.............CD.PAELQAAR.DELT....SLD....DDIA..Q...........K...........K.KLIAKLRQEF.EASA...AD...VEELT.ARKSQCL.AEIQESQ...RIRE.....E.CR....GW..T.ST.EVN.NLK....................A.....RVEAIEKEHG.WAVTG.IA......................GST..LSMTY...KRE...I.ELVLDIT-s........................................................................................
E4ZUU9_LEPMJ/717-1028                  .........................................s-EVERISLQEFLDMTKIRF..MD.L....................STT...KRR..HTAAPAAFHDv.....................eVEEKEESLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RI............I.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKT..GLLHTMDGF....KHD.ESTLANQEQLL.DTVLPPLAEKHK...SLSTEFQQLQQ...........RHDELNS.............CD.REELEQTR.ERLV....ATD....GEIA..E...........K...........K.RGLAQLQQQL.AEKD...SR...IEAIK.ERKVECM.EEIKAAE...RVRE.....E.CR....GW..S.TS.EVR.DLQ....................A.....KVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFHPN-a........................................................................................
A0A167Z2W2_9HYPO/935-1247              .......................................ydg----RIKLQDFLNMTSIRF..MD.L....................TTT...KRR..HTIVPKGQRGss...................saGDEESMTLERCVVAGACTIPMLELYQHCCRELKNYIAD.GRRIVKEI....ED.ET.....FQI..N....PPLFQ.....EYM............SA..............A..P.DV...KA............L.................MDN...Q...FKNVRTHARLLSKAMWYKWRT..EL..H..EGLKQ..GLVNIAEGM....DED.EAEMKRQEDLL.AEVLPRIVASLE...SLQEEGSNLEE...........AAKELDD.............CD.PVELEAVR.NKLK....GLN....AENE..Q...........T...........K.KLLAQLRERL.DHAD...SE...VERLD.TAKRELK.TTIQQSE...EIRE.....A.CR....GW..T.GS.EVE.SLK....................A.....RVDAIKKQHG.WSVTG.LS......................GTI..LSMAY...KRE...I.EIVFDVA-s........................................................................................
G2Q100_MYCTT/286-532                   ........................................sp-------------------..--.-....................---...---..----------.......................---------------------------SCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFK.....EYM............TA..............S..P.EF...KI............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLKTAEGM....DED.DRLLAKQQELL.SSVLPDMVKRLE...ALELEHRELEA...........VARELAD.............SD.PQDLEDAR.AELV....AVD....KSME..E...........K...........T.RKLRQLRREL.DESV...QG...LESLT.QQKQQYL.EEIREAD...KIRE.....E.CR....GW..S.SE.EVN.KHK....................A.....QTDAIEKKHG.WAISS.IS......................GLA..ITMRY...KRE...I.ELVLDLA-s........................................................................................
A0A094BZ75_9PEZI/1048-1363             .......................................dve---NRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATAQdgs.................edqLRKDDGSLENCVVSATCTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............S..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAKQQELL.SNVVPELVQKYE...KLLQQEADLQT...........AAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRTQM.EDNE...TR...FQVAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
M7NN42_PNEMU/736-1042                  ........................................fl---PSITLTEFLKMTSISF..LDgL....................TTT...KRR..ETTFFPYLNT.......................---NPPTLKELVYTSSLTLPTLELYQFSCKELQKYISE.GKEVVNKI....EK.DT.....SEE..N....PLLFR.....EYI............YA..............S..H.DI...QV............I.................MVG...Q...FKLLKNYSRLYAKSVWYDWRD..KL..L..LGLKE..GLEKNLEGL....KKD.ELIINESKPIL.NTCFPLIKQTYE...SLKEKIKHMKA...........IKEEISQ.............CD.QKELRKVR.SSLF....NIN....EELQ..G...........D...........T.EDFEKLRKCI.SEID...DR...LHELS.EKQAKLN.REIEEYK...KVMK.....V.NR....CF..E.KG.EIE.NIK....................K.....MLQILKSVTG.WEVKR.FF......................HDT..VVFIY...LDT...I.ETTFNF--ik.......................................................................................
K5WMV3_PHACS/900-1221                  .........................................s-EEPTISIEQFFQMTGIRF..MD.E....................ITA...PRR..STIHPAHLRTrnrrrs...........ltsshsEEAEPIALAEYMAAMSIEVPQLELYGVLSEDLTGWIDE.SKKICKQA....EE.DV.....LRM..T....PALFA.....EFA............LA..............D..E.VE...KQ............D.................LLH...Q...LKIIKANCVGSAKSQWYDWKS..EW..V..DRLLE..SAEEAFGGL....ESD.AKFLEGITNEA.QDILPSLRAEYA...QVMEELEKEET...........AVAELEK.............SD.KEYLNELK.VSIA....EQD....TEIQ..S...........F...........K.ANVSEAETKL.QRLQ...ER...LDEIE.AQKKETN.AAIAEAQ...RVIQ.....V.KT....ES..N.SS.EVS.RLK....................V.....ELETLEDLHS.WRVTK.IS......................PDL..FEFLY...ATR...Y.HVTVPCV-n........................................................................................
A0A1Y2FXI1_9ASCO/637-947               .......................................tpl---SPISLKSFLDMTGISF..LTgL....................STT...RRR..ETIHANQVMT.......................QDTPVDAEAARMEANAGVLPVLEMYQHSCRELTRYISE.GRHMCDEM....EA.SM.....NDE..N....PEVFE.....AFR............RA..............D..G.PG...KR............E.................LEG...K...FRDMKSAARLAARGVWYAWRT..NL..M..MGVSQ..PLASNFEDL....QRQ.AKALEVKEAEV.LPKHAALEEDYA...ALKERVEALLR...........EEDAYDA.............SD.VETALALA.AENE....EVE....RHLQ..A...........E...........T.ELSAQLAQQE.AMLL...AE...TTALS.SHLAETG.KEVSMLE...REAA.....Q.QR....GF..S.LA.ELA.ELR....................R.....VLVELGRRSG.WEVIQ.VT......................KQT..MQLVL...LSS...L.AVSVPLQ-g........................................................................................
A0A139A6U2_GONPR/834-1136              .......................................pps----SLTLDMFMDMINLSF..SS.T....................TQS...ALQ..PVPALTQHDP.......................MKFDEEFFNGVYVGSK-EV----IVLHESREFEQNIAT.LEAGLAHF....NN.RA.....LES..M....PLVIL.....DYL............NG..............S..R.QE...QS............Q.................FSD...K...VKKAKSLQHLQWESNRQTYLR..DV..A..QSQIS..YLTPHLLTL....REN.KRHIAEALKIL.HQ-LPLYERRNQ...SLEREFVRLKE...........RLVGVVP.............AH.EAEIQAVQ.TAQM....DSL....VRHE..Q...........C...........R.ERRKLLAERL.AAAK...KE...SEQLL.AEETSIN.RQTTEAK...EKMV.....M.KK....VL..S.LR.EFT.SLQ....................E.....DYQILVAATS.WSPIR.IS......................PSK..VSLQY...DDT...V.TITFNR--hv.......................................................................................
F2STM8_TRIRC/974-1296                  ........................................tp--VEPIKLSDFLEMTNIHF..ME.L....................TTT...KRR..HTIAPGSPEKcgt.................eslQGAKEFGLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YSE..N....PPLFQ.....EYI............TA..............T..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHVDEM....KQD.DEILSKKENIL.ANVVPGLIERHG...KLEIDSQNLQK...........VIDEIEN.............CD.QEELRDAR.EKLL....AVE....TELS..G...........Y...........K.DKYTQARGRL.EAKS...VS...LEKAQ.ARREELL.QEIREAE...SIKE.....E.CR....GW..D.EK.EVR.VLQ....................D.....SVNSLEKQTG.WAIIS.AKpsm...............davkGIT..LSMRY...RGE...L.QLDCNPS-h........................................................................................
C9SHA3_VERA1/966-1278                  .......................................qge---DRIHLQEFLNMTSIRF..ME.L....................TTT...KRR..HTQAPEAFKDg....................liDDEGNFPLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FED..N....PPLFR.....EYM............SA..............T..P.EI...KN............V.................LDN...Q...FKNGKSHARLESKAMWYAWRT..AL..Q..EGLKE..GLIRIAEGM....DAD.DKVLEQQQTLL.SSILPILISRFE...ALNEERINLEA...........VAQELAD.............CD.PSELEAVR.SELA....DVD....SDME..K...........K...........T.KQIVQLRAQL.EESE...AT...VEQLT.ARKRAWQ.EEIEEAE...KIRE.....E.CR....GW..S.TS.EIS.TLK....................A.....RVDAIEKQHG.WAISG.IA......................DST..VSMTY...RRS...I.ELVFNIS-a........................................................................................
A0A1Q8RBK8_9PEZI/1034-1346             ........................................qs--EERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKDg....................llGGKDDLTLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKSHARFESKAMWYEWRM..KL..Q..EGLRE..GLVKIAEGM....VAD.DKILQEQQKLL.SSVLPNIVSRFA...SLQTEHEDLQA...........VADELAD.............CD.PEELEAAR.YDLT....EVE....KDVQ..E...........K...........T.RRVAELREQL.QEAE...RD...IDLLT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IG.EIK.ALK....................D.....RVDSLEKQYG.WAVTG.VS......................GSI..ISMTY...RRD...I.ELVFDMA-s........................................................................................
H0GG70_SACCK/450-761                   ........................................pt---QDYTLREFINEVGVGF..LD.T...................kLID...DLD..KKVNFPLNSF.......................NFVENQRIDNVFSAFYIDIPILEVEAFRCKELWRSINE.SKDKFKDF....EA.QI.....DKS.hP....PLLLQ.....EYF............SS..............D..E.KM...KQ............L.................MRD...Q...LQLVKGYSKLEAAMEWYEWRK..KQ..L..NGLEL..ILAENLNTL....KRE.YEKLNEEVEKV.NSIRGKIRKLNE...AIKEEIRSLKN...........LPSDSYKp..........tlMN.RXKIEAFK.QELM....EHS....ISLS..-...........-...........-.-SSNDFTQEM.RSLK...LA...IAKKS.NDILTLR.SEVASID...KKIE.....K.RK....LF..T.RF.DLP.KLR....................D.....TLKILESLTG.VRFLK.FS......................KAT..LSIAF...LQLd.dL.RVDINLA-n........................................................................................
A0A1V8SXB9_9PEZI/850-1166              ........................................qp--KQPVHLQEFLDAAGIRF..MD.L....................TTT...KRR..MTVMPTPSKNrk..................stdVLEPEVTLATAVIAAACTEPEKELFSHACHELRRYIHE.GKGAIKEL....EA.ET.....FRE..T....PPLLQ.....AYM............SA..............G..S.PR...KA............V.................IDA...Q...LRDIKTHARLRSKEMWYGWRG..QL..L..EELMH..VLHGIAEGL....LRD.DEVLLEKEEII.AEVLPALLEQRD...GLEIEAARLQE...........AANAVSP.............EE.KEDLDAAR.KRLV....EID....DELE..A...........K...........R.LLLQSLEEES.QALA...IT...EETLI.DARTEYT.AAIASAD...KVRD.....S.CR....SI..S.LD.EIT.ILQ....................N.....HIETLEATHH.WSITS.ASs....................hPTT..LTMTY...AST...L.QLFFHPT-a........................................................................................
G4TA55_SERID/719-1025                  ......................................rlpr------SIDELLKLVGGEF..MD.N....................MAA...RRR..STMALRAKDQ.......................YPDTPPTIGDFANAIVIDYPQLSYYDFVVKHLQTYIDQ.LDKQQAEI....NE.TV.....VEN..P....PPCFI.....DFA............TG..............G..P.DT...LP............E.................LKL...M...LESLRRLVRSRTKLQWYRWRY..EG..V..SDLIN..TVETREKAA....LVD.LTQTRALAPEV.IANAEIIEAEHA...AIMAELERERA...........VVAEIEK.............CD.AKELASLK.ADIA....MNN....TELK..A...........L...........E.QEIFQLQADI.EAIT...QQ...ENELK.LEQKRLQ.QRMETAN...RICA.....-.SE....NC..E.RD.AFG.ETR....................A.....AIELLENVSG.WKALK.IS......................SSI..VDLEY...INQ...Y.TVHIPCK-d........................................................................................
A0A1V1T7B6_9FUNG/956-1266              ........................................dg---DHIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPNTQKDv.....................lRGQEDLSLERCIVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFK.....EYI............TA..............T..P.EF...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLEKIWEGM....AAD.EKLLQKQQALL.NSTLPDLIQQSE...SLTTEHENLEA...........VAQELAD.............CD.PEDLDSAR.TELT....SVD....SDIE..A...........K...........K.RKIEELRRQL.AETE...SS...IGTAA.ERKQSCI.IDIEAAE...KERE.....E.CR....GW..T.SN.EIN.SLK....................A.....KVDNLETRYG.WAISG.LA......................GTT..ISMTY...ERE...I.ELAFDAS-s........................................................................................
G8ZYQ8_TORDC/272-592                   .........................................e-TVESHSLREFIDETGVSF..MI.Dt..................dLID...KRR..NPITFKTIQS.......................SQREKFRINQLLYALYLDTPVLEMNAFICKELLRRITQ.SKKQFDDL....DE.QV.....SSAqsQ....PLLFT.....EYF............TS..............S..Q.EM...RQ............L.................MNQ...Q...LQLVKSYSKLEAKKSWYEWRT..QH..L..NGIKT..VLHENLLLL....EED.RAKVRKSLNRV.QDLKVKAQNLRN...SIKKEIALLKEnn.......tdDYQEEPS.............LNeRVKLETLK.QELA....SYS....LNIN..N...........G...........Q.ELTKKDEQLK.EEIE...RK...KEQLF.DLKEQL-.TILSQKH...NMRL.....E.KK....NF..T.EY.DVV.KCR....................N.....KLQLLSIISG.VEFVR.YQ......................NTE..LTIGFpyiASS...L.QISVDLSN.........................................................................................
A0A229Z460_9EURO/995-1318              .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASKraar...............lsaeSKAAAASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLYRHVDEM....KAD.GDLLTKYETLL.DGVVTSLVEKQS...TLQEEATNLQQ...........LADEMEG.............CD.QDELRNAR.EKLS....SLE....DEID..L...........K...........R.KQLQELQGQV.QEKT...NS...IESAA.ELKAEFL.AQIQEAE...RVKE.....E.CH....GW..S.AK.EIS.ELK....................E.....SVRKLELQTG.WSIVS.ATssg................spaGPL..LTMSY...REQ...L.QLVFHPA-t........................................................................................
A0A0U1M356_TALIS/976-1297              ........................................gw---EPIQLQDFLNLTNIHF..ME.L....................TTT...KRR..HTTVPGNDSTlsrv...............gsphLGKGEVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....FAD..N....PPLFR.....EYV............TA..............P..P.DI...RV............V.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....KED.DTSLSKQETIL.KGAVPGLVDKRA...SLDSEATKLQD...........LVDEMEN.............CD.PEELRMAR.ERLA....KVD....AEIA..A...........K...........K.QQLQTMQEDL.QDKV...NT...IETGI.ELKSELL.EQIHNAE...RVRE.....E.CR....GW..S.IK.EVS.TLK....................D.....SVDLLETQTG.WSVLL.ATngp................gpaGPA..LTLSY...KGE...L.KVKL----fpk......................................................................................
A0A1F7ZN74_9EURO/1011-1333             .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YTE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLSRHVEEM....RGD.DELLSKRETLL.SGAVPALVEKHS...SLEEQATTLQQ...........LADEIEN.............CD.QDELQDAR.EKLS....STE....EEIA..S...........K...........K.KLLEELQAEA.QEKT...NT...IETGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKMERQTG.WSIIS.ATsps................spaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
A0A066WG66_9BASI/583-895               ........................................dm----QLTLQSFLDAMGLKF..QD.Q....................LSA...VRP..RVARPNDLDHg.....................rLGPNVVRWSKVAAGG---SVLLENLSRSCKELEGHIET.SREALAEV....AN.QF.....DAQ..P....PAYAR.....DVM............SY..............P..P.EMekeRK............L.................IEA...Q...FKLQKQCARAHSVGQYYGWRLdnEY..D..EDTVK..RLQANRRRL....DED.AAKLAAKSLRLrEELLPELRARHA...QLKAELQAEKL...........HQAAVAA.............SD.QEELGGIH.AAIE....DQM....NMLE..S...........F...........R.SENREALETL.ERVQ...AR...VNEQL.ERKHAAE.DGIAAAR...SACE.....Q.IK....GF..T.RG.EAA.RLL....................S.....EIRSIEQAHL.WTLIS.AT......................ETH..IALLH...NSV...I.DVNLNIS-v........................................................................................
A0A0G2EVI9_9PEZI/1-305                 ..........................................-------------------..MD.L....................TTT...KRR..HTGYPGAQSAfgrga.............slsaaEIEGKDDLETCVVAAACTEPEYLMYQHACHELKKYISE.GKNLVRQI....EE.EV.....HEE..N....PALFG.....EYM............SA..............P..A.DQ...RQ............V.................MDI...Q...FKNMKTNARLRTKEAWYGWRS..NL..L..HDIKA..ALTRTVDSF....DRD.DAALKEQEQII.DSTLPALQDRHA...HLESECKQLQR...........RAEELNG.............PD.REELDAAR.ERIV....AAE....AAIE..E...........K...........K.RKVEALQQQL.TEKE...AG...IEAVE.ERRVECE.NEIHAAE...RVRE.....E.CR....GW..S.VD.EVK.ALK....................A.....RVSALEKEHG.WLITS.ASas..................aeSKT..VTMTY...RND...L.QLFFHPD-a........................................................................................
A0A1J8Q321_9HOMO/1725-2038             ..........................................EDGPQISITQFFEMTGIRF..MD.E....................IAA...PRR..SMVHSSALRPsr...................rqSTESEIPLSEYVVAMAVDVPQLELYTHVSKDLQVWIER.IKGIYKEA....EE.EA.....LKM..T....PELFQ.....EFV............MA..............D..E.EG...QN............E.................LLH...Q...LKLIKVHKHAQAKSEWYDWKM..QW..V..DQLYQ..KADRGFRDL....EAD.AKVLEDIINQA.QEVVPALNEEYE...NIIRELKQEQA...........DVAELEN.............CD.QGYLHELK.TTIQ....EQS....VALE..A...........F...........R.ADVDEGKAKL.DRLQ...EK...LDEIE.AHKLETT.NAIQVAE...RQVQ.....V.QK....NS..T.HA.EVF.RLK....................D.....ELEALQNLHM.LHVTK.VL......................PNL..FEFRY...ASS...Y.DVSVPCE-d........................................................................................
A0A066WXN1_COLSU/1024-1336             .........................................q-AEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPEMFKDg....................llGGKDDLSMERCVVAGACTVPMLELYQHSCRELKKYISE.GRSIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVKIAEGM....AVD.DKVLDQQQKLL.SSVLPAIVTRFT...ALQQEHDNLQA...........VAEELAD.............CD.PEELEAAR.SDLA....NIE....SDME..E...........K...........I.RRVAELRREL.EEAE...QD...VEELK.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..ISMTY...RKE...I.ELVFDLA-s........................................................................................
N1Q9P3_PSEFD/751-1065                  ..........................................ENIEPVGLQDFLSKANIRF..MD.L....................TTT...KRR..LTTAVPPSQGs....................qdVQAEKVDLESGVVAAACTIPELELYQHACHELKRFTKE.GKRVIGEL....EQ.ET.....RKN..Q....PPLLQ.....VYM............NA..............S..P.DK...KM............V.................LDA...A...MRDMKTNARLRSKEMWYAWRS..QL..L..EELMG..GLSKIGEGL....IQD.VEILTQSEEVL.DEALPPLVKQHE...ELQQEADILEK...........SAKEIPE.............ED.KAQLNEVR.ENLV....DIN....NTVA..E...........K...........R.RLLNDLRRKV.EEQD...NL...AEHLQ.DSKQELM.AAIQESN...RVRE.....A.CR....GV..S.IE.EVC.KLK....................E.....SVARLESESG.WAITS.ASs....................sPST..ITMTY...RSQ...I.QLFFHPR-a........................................................................................
A0A1B8FVU0_9PEZI/1024-1339             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqLGKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.ADALAKQQELL.DHVVPELVQKYG...TLLQHEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDSE...TR...FQIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KVDALEEKYG.WTITG.IA......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0L1ILX7_ASPNO/1025-1347             .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATRrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YTE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARFLSKATWYEWRM..KL..L..EGLKD..GLNRHVEEM....RGD.DELLSKYETLL.SGVVPALVEKHS...SLEEQATSLQQ...........LTDEIEN.............CD.QDELRDAR.EKLF....SIE....EEIA..S...........K...........K.KLLEELQAEA.QEKT...NT...IETGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKMERQTG.WSIIS.ATsps................spaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
L0PA06_PNEJ8/723-1001                  .........cnnspnfkkneysdhlvemqdenncficytnif-------------------..--.-....................---...---..----------.......................--------------------------KSCKELQKYIEE.GKEVINKI....EE.DT.....SEE..N....PLLFR.....EYI............SA..............T..H.DI...RV............I.................MDG...Q...FKLVKNYSRLYAKGIWYEWRD..KL..L..LGLKE..GLQNNLEGL....KKD.ELIINDIKPVL.NTCFPLIKLKFE...SLKEQLNHLRM...........IKEEINQ.............CD.QKELREVW.SSIS....RVN....EEIQ..R...........N...........V.EKIEDINKNI.YEID...NQ...LNKLS.EKQIILD.REIEEYK...KATE.....A.NR....CF..E.KE.EIE.NIK....................R.....TLETLKTITG.WEAKS.FS......................QDT..VVFIY...LGV...I.ETTFN---fiq......................................................................................
A0A165PST1_EXIGL/1-307                 .........................................m------TMDEFFAVTGIKF..MD.E....................FTC...PRY..STALGLMNAPp.....................eNDDQVYELEQYFKALAVDVQQLETYQWTTNFLQGWLAT.SKANYAEA....EQ.NV.....LSN..P....PAIFQ.....AFV............FA..............D..E.EQ...RA............S.................MMH...Q...LKIIKTNSLALAKAEWYAWKS..DW..I..ADLRS..KADVCLAEL....DED.EGKLRDAARRV.NDRLPEIRAMRD...RVMRELAEERA...........TVAEIET.............CD.QDHLASLK.AEID....VQA....AEIE..R...........Q...........K.NEVADQETTV.AHMH...EK...LAEQE.HERREVI.SAIEDAD...RQSA.....H.QR....GC..T.RE.GLH.AQL....................D.....ELDAMQALHG.WRIAR.LS......................PAL..VELVY...ADK...F.TVRIPCR-e........................................................................................
C4YB32_CLAL4/578-887                   ........................................tp--IPHFTLTDFLKEIGIKF..YD.Dle................frIDL...STR..QTLSISES--.......................--AEEKSKEDYYRANI-QLPLLEVYELSCKELAGKIQQ.GKKLFDEL....QE.KT.....SND..N....PELFK.....LYY............RA..............S..F.YD...QM............M.................LKA...R...FHLLKEYTRQQAKSIWYQWRS..KL..I..QNILE..VLQGNLEIL....QSD.KTILINNITIL.DGLYDEMHRKSQ...ALRLEVLQFKE...........IQSTFQD.............LD.ANQIKRIK.LQLT....ELN....NRLL..E...........H...........K.KKISEKEEEL.HNLE...DQ...IRLRN.DEIQGLQ.KEISAAE...NQLD.....E.TK....HF..N.TK.EID.ILK....................N.....KSRLLQAAAG.LKFVKsIS......................EHI..DEFEF...NSE...I.GVTIDFS-k........................................................................................
A0A177E400_ALTAL/748-1059              .........................................s-DVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPAAFHDv.....................eIEEKEESLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTL....EN.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RK............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..HDLKA..GLLHTMDCF....SHD.ESTLHKQEKLL.NDTLPPLVEKKE...HLSVECKQLQQ...........RHDELNS.............CD.REELEQTR.EQLT....ATD....AELE..E...........K...........K.LLLAQLQQEL.VDKE...TR...IEAAK.NRKVECI.EEIRGAE...RVRE.....E.CR....GW..S.TS.EVS.SLR....................A.....KLTALEQAHG.WCITS.AS......................STS..ITMTH...LND...L.ELYFEPS-v........................................................................................
U4LG14_PYROM/971-1230                  ..........................................EEEEIITLPEFLKTINYDT..TI.L....................--Q...PYG..YKIKRTRR-Sl.....................tSNSGEARLSDRIWAGACAASMLEFYRTFCRDFERHLDE.SRSAVQQI....EE.IT.....AKE..N....PLLFR.....EYM............RA..............T..A.EE...KE............I.................MKL...Q...FDTVNSNSRHLAKMDYYQSRI..TN..A..KGIME..TVKSNMEGL....LGD.EKYIQQQEEVV.KTLLPQMEQEWL...DAKYQFNKVES...........LKERINA.............DP.ASDLEAAR.VRLA....AAL....EKQA..S...........L...........K.SQIEAVIATD.NEIS...AQ...ISTLE.STDTKLK.QAIENLT...HSRE.....N.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------tv.......................................................................................
X0KTS5_FUSOX/989-1302                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..ISMAY...RRE...I.EIVFDIA-a........................................................................................
A0A0L6WWV3_9AGAR/747-1058              ........................................id--NPSISISQFFVMTGIKF..MD.E....................LNP...PRR..SIHPSQQVVSq.....................pREPEGILLAEYVAAMGMDIPQLALYSRVSKDLEAWIEK.SKADFLQA....ED.EA.....AKI..T....PELFT.....EYS............RA..............D..E.EG...QA............E.................LLH...Q...LQLIRTNTRALAKSDWYDWKL..QW..L..EGLRV..TADQTFRSL....ETD.AKTLEAIRAPA.GDLIPALRLEYE...EIRKELDRESA...........EVAEIEA.............CD.QEYLNELK.ASIA....EQN....IEVE..A...........L...........R.AEVAESKAKL.LSLQ...ER...LRETH.TEKQETG.AVIDEAR...RVLH.....L.QK....NG..T.RA.EVL.KLK....................D.....ELQSLEDLHM.FRVTQ.VN......................PDM..FEYVY...ASQ...F.RVTIPCK-s........................................................................................
M7WNI6_RHOT1/784-1122                  .......................................lpd------SLDAFLVATGTHF..AD.Deffev..........vnsesTAA...KRR..KSMAATARAGeededd..........etkqmggAKAVEPTFADMTVAAAVKSLFHQLYKSEQGGLLEGINQ.ARQMLEDS....EQ.RL.....RSG.vV....PQVFK.....DWA............NA..............T..D.EA...KA............I.................MKT...Q...FGQIKLNYLLSNKLEWKTRRI..QN..Y..DQVVD..IMAQNLQFI....QQD.RAVLAEVQTQF.EGVIPSLEARHA...ALLADLTAERS...........LDAELSS.............MS.PEDVEMRE.NMLA....DSE....EQEE..QlngnpdkgipgR...........R.PELDRIEQHL.RSYR...ET...FEKYS.TEEQRLQ.AEIADLE...ERRR.....D.KR....--..T.KT.DLV.RLQ....................A.....ESEALQHLQG.WRLEQ.FS......................TQH..LALRH...CDE...F.LVGFE---li.......................................................................................
A0A1E5RRW2_HANUV/134-433               lqkaslnysdeipeffenendkylvptdfykrnpdiklfine-------------------..--.-....................---...---..----------.......................KDLNNINQETIYNNLYTKTPLLEIDRFIINELNSKLEM.SYNNFQKIindyNNpDN.....FEK..L....PYLLRkfekhEYK............KM..............L..D.ND...GY............N.................LDK...LiklLNIIKDNCDLESKKIWLNWRI..QQ..L..DGICL..VLRDNLKMV....EEQ.QRELNFFKNKL.DMINYELDKLKK...LSTFKKNKIKA...........XNFENEK.............ST.TENYENKK.WEIK....R--....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------tiilkkynfdigerxalnneenexxliaklqelektsesdipvrspivkpkeexdgkfisifkayfsayeyel................
A0A0C9M0A5_9FUNG/414-720               ........................................iq--SNNMSLSDFLLIAGIWF..SP.E....................IPAkalRRR..STYIADYGVA.......................------TVSEQGAAALSTLPQLELYETSCQKLNQFIHE.CKDRIDQI....DQ.DV.....SSA..N....PQIFQ.....EYN............EG..............S..V.EA...RN............A.................MGV...K...LTAMKKYAWKRAASEFYKIWS..NT..L..AEFTE..ILQANRNKL....LQD.NEVAAQFEQDV.SKKMSDISTYSD...SLAQLHKEAER...........KEQAYDR.............ID.HKALAQLE.EEIA....QQR....ASIE..G...........F...........K.RHYKELEDRE.SQLV...EE...AATLE.KRKQEVL.DAIQLAD...RLKA.....N.NQ....YV..T.DR.DLA.YAA....................D.....KFQRCSKINK.FRLPK.AP......................DDT..LELSI...NGD...V.DIVVD---kkk......................................................................................
A0A162Y2E5_DIDRA/837-999               ......................................gecf-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....THD.EACLFTQERLL.DVVLPPLIEKQE...QLSAEQKQLQQ...........RHDELNS.............CD.REELEQTR.ENLT....ATD....AALQ..A...........K...........R.ELLMQMQQDL.ADKE...AR...IDAVK.ERKVDCL.AEIKAAE...RVRE.....E.CR....GW..S.ST.EVR.DLK....................A.....KVAALETAHG.WSITS.AS......................STS..ITMTH...LSD...L.ELYFQPQ-c........................................................................................
G7E8S4_MIXOS/651-961                   .........................................e-QQPVLTVDDFFEITGVQF..MS.Dm..................iVPA...SRK..SAASPNRPRE.......................-SFGSSLLAEQIKAAASSVFFLDTYKHMVMKLGEQLKE.NRAAREEI....DE.VI.....ELS..Q....PRIFS.....EWL............RA..............D..D.DK...RA............A.................IES...E...LKLVKTWCRLDVRSDWYSFRT..QL..F..LQVCD..SLQINLAQL....RQD.QAQVASWGANV.TELLPDLRSEYG...RLKEELVREQA...........RQRELDA.............SD.KDELHSLH.LAIA....EQG....AALE..E...........I...........Q.KDHAEVQGQL.ERLE...SK...SADID.AEMSHME.STIAKST...SYCD.....R.VR....RF..T.QT.EVR.RLK....................D.....DYEALERITG.CKIVG.LR......................SGQ..IKLCL...CDE...L.QVTLDIS-s........................................................................................
A0A179GZY1_9HYPO/944-1257              .........................................a-DDERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPGSLQDgs...................taDGQDSMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....EN.DT.....FED..N....PPLFR.....EYM............SA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARFLSKAMWYEWRM..KL..Q..DGLKE..GLVGIAEGM....ESD.DQVLKQQEDLL.ASVLPDIVKRYE...ALDEESNNLQE...........VARELAD.............CD.PAELQAAR.NELS....SLE....SDIA..Q...........K...........K.RMIAELRQQF.DDSS...AE...VEVLA.AKKQHCL.EEIEKSE...KIRE.....E.CR....GW..T.SS.EVN.TLK....................A.....RVETIEKKHG.WAVTG.LS......................GTT..LSMTY...KRE...I.ELVFDIA-s........................................................................................
A0A2H1A7T4_CANAR/681-988               .........................................p-NYQPVELSTFLHDIGVKF..YD.D....................LEI...ATD..SANRFSLHDD.......................--SLDVSMEDYYKCNV-HLPLLEVYEMSCKELSQKIQQ.GKALYQEI....SE.RT.....FND..N....PMLFK.....QYY............CA..............S..Y.YD...QV............S.................LKA...E...FHRLKEFTRHQAKQVWYQWRT..QL..M..RNVLE..VQQGNLEIL....QAD.KKVLEEAITEI.EDQKNRFQEDLQ...RLRRDITSFKE...........IKASYKE.............LD.SAQIKNIK.SQLL....KLN....QTLL..N...........H...........R.DEITKKEEEL.VRVN...ED...IKNID.SSIQIQR.DELRKAE...SRLS.....R.RR....HF..S.DK.EIR.ELE....................S.....EVKALEKRVG.LQYLS.EV.....................dSDV..VEFAC...NPY...I.--------satitfkd.................................................................................
A0A0W0F5T4_9AGAR/816-1126              ..........................................EDIPTITIEQFFEMTGIKF..MD.E....................LTA...PRK..SIHPSQLKRQ......................pRPPAEIPLAEYAVAMGIDVPQLTLYSRVSKDLEAWMEQ.SKVIFEQA....EE.EA.....AKM..T....PELFV.....EYS............RV..............D..E.EG...QQ............E.................LLH...Q...LSLIRTNTRLLAKADWYEWKH..QW..I..EGLKA..TAQESFMNL....ESD.ARVLEQLKHKA.DELVPALQQEYD...EIMRELEREQA...........EVAELEQ.............CD.HDYLNELK.TSIA....EQS....VEVD..S...........L...........K.NELKEGNDQL.KWLE...ER...LEELE.SQKREAT.SAIAEAD...RFLQ.....I.QK....NS..T.HA.EVL.RLR....................D.....ELEALENLHM.FRVCK.VN......................ANL..FEYVH...ASR...F.RVTIPCKN.........................................................................................
C0NYM3_AJECG/1011-1335                 .........................................r-QVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTNDNKkats...............ktddETARGISFEDCVVAGLCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEYM....QND.DAVLSKKEEIL.NCAVPPLVEKHT...KLETEARNLQQ...........AVDELEN.............CD.QEELRQAR.ERLA....ALD....ADIV..T...........K...........K.VLLEQSQAEL.LNKN...NV...IKAGT.ELKNEFL.AQIGEAE...RVRE.....E.CR....GW..S.VK.EVK.PLK....................V.....SVHALECQTG.WSILS.ASlkp...............sskyGPS..LRMRY...RNE...L.QVDFYP--gt.......................................................................................
A0A1E5RDG4_9ASCO/373-665               ...........llvkflksshldylnnipxlrdfnhshdvkp-------------------..--.-....................---...---..---------Fdf..................nvfKYKSDVSTAEVYKELYTNLPFLIILKYMWFELNRKISK.SKSRFALL....EK.EL.....SDN..Ps.klPALLS.....LFL............NSs............iS..S.DG...KT............N.................LRN...Y...IFVLKQNSDLVAESVWLNWRV..NQ..V..EGINS..DLEDGLXNL....QAX.IVNNESDSESI.VKMREEAETVYN...DYVREFEKRKIm.........hNQHTLKS.............VE.TENLNKVN.XNIS...fEHK....LKWV..E...........K...........K.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------nylfkkynvdigdfesypsrkfdilkalnsacsrqpskadiedtqlktfeakfadqrnnlkfirssn......................
A0A0A1NXA1_9FUNG/118-426               ..........................................EDSEQTTLADFLEMAGITF..PR.Q....................IPL...NDI..---IPISIVD.......................VDYESPTIAEQAAAAAFTLPQIDMYDSISKQMHSLIDA.SQDVIQKV....ED.RV.....NRT..S....TEFFS.....DYL............RA..............N..A.ST...RI............T.................MEP...E...YRLTKQYAELKSLERWYEWCV..NI..F..VEHLG..TLKGHINTL....TQD.RQTLASLEDEL.RGQLPKIVEYQQ...GISQLLAEAHE...........IEKEYRR.............FD.HKKLSRMR.DEIE....HQR....QTIE..L...........F...........N.KDLENLGAEE.AELF...ER...IDMLE.HRKSRLI.KDTVDAR...EISS.....M.NH....II..T.EN.DLN.LVR....................Q.....LYERSCNVGG.LRLLK.DNe....................dDDT..LEILV...AKC...L.VLTIHR--nd.......................................................................................
M5EKW6_MALS4/374-684                   .....................................dasfh-----LPLSEFLQRVGLKF..HE.D....................MTA...SRT..RTDRPIDTGT.......................-TPATCVQHAKMAAGA--APMLQALRSACHELKQHVEV.GRERLQTM....EQ.DF.....YAR..P....PAFVQ.....EWG............QL..............D.dE.DM...RR............S.................MKG...Q...LNVHKQAARAAAMHDYYGWRT..DM..QydDDMAR..MLAQHRDVL....RAE.AARVQERHIMLeQELLPLLRTHHA...ALRRRVDEAHA...........RQREIRA.............CD.ADELRQLH.ASME....EQD....QVLQ..G...........M...........R.TKHRDAQEQL.ARVR...AR...IEEAV.VRRAQTE.EAIRAAR...AVTD.....Q.IR....GC..T.PG.EAV.RLA....................R.....RIQHMETLLQ.WSLTS.KT......................PTL..LQLTY...AHR...L.QVAVE---wde......................................................................................
A0A0F2LSN0_SPOSC/1025-1347             .........................................d-DAERIHLQDFLKLANIHF..ME.L....................ETT...KRR..ATEGPGALNKdsgnsh..........srlstdeDGKPKDPEIESLVTTVCKVPLLEMYQHACRELKNYIEE.GRSIMREI....ET.ET.....YED..N....PPIFR.....EYT............TA..............T..P.EM...RA............Q.................MDN...Q...FKNIKIFARLQSKKQWYEWRT..KL..H..EGLQE..GMLKVLRDL....QKD.KDVLKERRDKV.DAVYPALLAEYE...ALERERVQLET...........FAAQLGG.............DN.QEALIAAR.VQKS....RLA....ETIE..E...........H...........K.GATARLETEM.KESR...AR...VAAMK.TEREQYL.KELEEAK...RIQE.....E.RR....SW..S.HQ.EIS.SLK....................T.....QVDALEKKSG.WAVTG.AQ......................GTT..LSMAY...RRE...I.ELVFDVA-a........................................................................................
S0DKC7_GIBF5/986-1299                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDNgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLSGIDDGM....ETD.KELLDKQKSLL.DSVLPPIVARYK...SLLEERNNLEE...........VARELAD.............CD.PADLEAAR.EELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A1R3RNN2_ASPC5/1003-1329             .........................................p-ESEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseAKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....FAD..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLGRHVQEM....KAD.GDLLSKHETLL.GGVVPALVEKHS...TLEGEATRLQQ...........LADEMEN.............CD.QDELHSAR.EKLV....GIE....AEIE..E...........R...........K.RQLRKMQDEL.KDKT...DT...IESGT.ELKAEYT.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNIERQTG.WSIIS.ATsee...............espaGPT..VTMTY...RSQ...L.QLTFHPA-s........................................................................................
A0A084RJ23_STACH/975-1288              .........................................t-DENRIHLQDFLDMTSIRF..ME.L....................NTT...KRR..HTVAPGSLKGgs...................lfDGQDDLSLERCVVAGACTVPMLELYQHSCRELKKYIAE.GRSMVKEI....EM.ET.....FQE..N....PHLFK.....EYM............SA..............T..P.EV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLRE..GLVKIAQGM....EED.EKLLKEQQDIL.NSVMPALASRFE...QLVEESQLLEE...........AARELAD.............CD.PEELQTNR.EELM....ALD....EDIE..Q...........K...........K.RLIEELRAEF.DISE...AS...VKDLT.IQKERCL.ADIEDSE...KIRE.....E.CR....GW..T.ST.EVN.TLK....................A.....RVDAFEKEHG.WSVTG.VA......................GST..LSMAY...KHE...I.ELVFDIA-s........................................................................................
A0A176W8C1_MARPO/1171-1495             .........................................k-DGDTISVDDFFKLTEVNF..CA.K....................---...-RE..SSGCASKDKFs.....................iQAYQVNTIDAALKHFFLVQPRIGHMMEACSLVQDDLEK.IRTKEARL....ED.EL.....TAS..N....PSLFS.....RFQ............KV..............G..P.GE...KQ............Q.................IKG...R...IHRLQTKCRLVEKRHWLNFRL..GL..E..KDWNV..KLLQSKSEL....QLH.VEELRNGNSFL.EENYQQILHLQA...RIPTNEFEVEEypsdktapkavEEKARNK.............CA.LDKIKYLK.EQLV....DVNssakTKLE..K...........L...........L.NRTKVTEEAL.RTSK...ER...LAFSQ.CRLHDLQ.TKLAEHV...RM--.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------ghspaaglqiaarpefyvkemsnkvsllkalqggwqvavvgqdivelsytrkylld.................................
A3IXG6_9CYAN/246-385                   ......................................ylpl-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-GLVG..AMKQRTTQL....AET.NQHLEQTQSQL.QQIKEALQQKLE...QTNQELQETQT...........QLQE---.............-T.QTQLQETQ.TQLQ....ETQ....TQLQ..E...........T...........Q.TQLQETQTQL.QETQ...TQ...LQETQ.TQLQETQ.TQLQQSQ...ER--.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------iiamestkfwklrtqwlkfkkl...................................................................
T0JZP8_COLGC/1039-1349                 .........................................e-SEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFRE......................mGGKEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLKE..GLIRIAEGM....KTD.EKVLQQQQKLL.ASTLPAIVSRFT...ELEQEYSNLQA...........VANELAD.............CD.PEELETAR.ADLA....EVE....SDVQ..E...........K...........T.QLIAELRQEL.EDAE...RG...VETLT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.TG.EIS.ALK....................G.....RVDALEKQHG.WAVTG.VS......................GSQ..ISMTY...LRE...I.EIVFDIA-s........................................................................................
A0A2C6A956_9HYPO/141-454               .........................................i-EEEKIHLQDFLNMISIRF..ME.L....................TTT...KRR..HTIAPGNGQDgt...................vaDGQDDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....EN.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLVSLAEGM....DRD.DRVLQEQQDAL.TLVLPAVVARYE...SLSREHSNLQE...........AARELAD.............CD.PGELTSAR.QELR....NLD....ADIA..R...........K...........K.QRIAELRGRF.ENSS...TE...VEELS.QRKAKCM.EEIESCE...RVRE.....Q.YR....GW..T.SR.EVN.GLK....................A.....RVETIEKEHG.WAVTG.LS......................GTS..LSMSY...RRE...I.ELVFDI--vs.......................................................................................
A0A0C9YBW4_9HOMO/1-301                 ..........................................-------------MTGIRF..MD.E....................IAA...PRR..QSIHPSVLRPsr...................raSVEGQIPLAEYMVAMAVDVPQLELYTHVSKDLQAWIER.IQAIYREA....EE.EA.....LKM..T....PQLFQ.....EFV............SA..............D..E.TG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKL..QW..V..ERLHE..KASKGFENL....EKD.ANFLEEIIREA.QSILPGLQQEYD...QLVEELEQETA...........EITELEA.............CD.QDYLKELK.ASIA....EQG....MELD..N...........Y...........R.REVEEAKAKL.ERIE...EK...LKEVQ.IEKNEVS.ASIEKTE...RLIN.....V.QK....NS..T.HA.EVF.RLK....................G.....ELEMLQTLHV.VQITK.VD......................AEC..FEFVY...GSS...Y.VVSTRC--ve.......................................................................................
A0A1C7N0J4_9FUNG/1-272                 .......................................mta-------------------..--.-....................---...---..----------.......................---SSATLTQQATAATSTLPQLEFYEKIVKKINDLIEH.AKEKVELI....EQ.GI.....NQA..N....PQFFF.....EFR............EG..............S..V.EL...RT............Q.................MES...R...LDRLKTYARLKASIHWFEWLA..NE..V..VPLVD..KLKQANDSL....ESD.QSEIQAFEDMI.HLKVADIGLYHT...ELSRILSELQE...........KEIKYNT.............LD.SKRLQKLQ.EEIE....QQR....DTMQ..S...........Y...........Q.KQLNSLESEE.FEMV...EK...LALLN.KQKQDHL.EAIQQAN...QTLE.....E.HP....YV..T.EK.EFV.AAA....................D.....TFNRYMDIHQ.FRLEK.NN......................DQL..LQFSM...GGG...I.HITFDRT-q........................................................................................
A0A093ZW74_9PEZI/1023-1338             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPTAAAQdgs.................ddqLKKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRGQM.EDSE...TR...FNIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0D2JTF5_9EURO/1022-1343             .........................................s-EEEKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQSIPASg....................feTSTSGSDTADNFVAAATTLPLLELYQHATRELKSYISA.GRKIIRSI....EA.ET.....LAD..Q....PPLFR.....EYV............DA..............R..P.DV...KI............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKN..GLEGIDQGI....QAD.LQVLQQQRQIL.DSVLPRLDRERT...ELEEQKASLQQ...........SLEELDS.............ID.HDSLTNLR.RELQ....SAD....EYCL..Q...........R...........S.ALLDSLREQM.GEKE...EA...LLGAA.ELKIEME.EQIAEAD...RVRE.....E.NK....GW..P.VA.DVL.NLR....................S.....RVDAIEKQTG.WRLIA.AEeeve.............eptefGAA..LTMMY...KDD...L.RLFFYPQ-a........................................................................................
A3LTB2_PICST/542-850                   ..........................................DDYEPVSLDDFMNDVQLKF..YD.D....................LDI...DVD..SINRLSVTSS.......................SKGLNLKLADYIAGLP-RIELLSLYRFSCEELSKNIKE.GRDMFLQY....SK.TI.....AVS..N....PILFK.....EYY............SA..............S..E.DE...RQ............V.................LNV...K...LQLVKDFSRFQSRKTWYDWRS..QL..T..TNLLA..ELEDRYQRL....VKD.KDYLERDIVKI.DVIISRSRQYLV...ELKERITSLRS...........FRSRLGE.............FS.VEEALSIK.KQLL....LTS....EKLS..K...........L...........K.DELQNKNDEL.SKIN...DA...VTETK.KQKQILN.EEIAEQE...KIVR.....N.SR....RF..E.MK.ELN.TIC....................Q.....KYSLLQKLAN.LKLER.IE......................GSK..VVFQF...DKT...F.DCVFDFQK.........................................................................................
A1DFJ3_NEOFI/990-1313                  .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSVSKraar...............lsaeSKAATASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLYRHVDEM....KTD.GDLLTKYETLL.DGVVPSLVEKQS...ALQEEAANLQQ...........LADEMES.............CD.QDELRNAR.EKLS....CLE....DEIE..L...........K...........K.KQLQELQGQV.QEKT...NS...LESGA.ELKAEYL.AQIKEAE...RVKE.....E.CH....GW..S.AK.EIS.ELK....................E.....SVRRTELQTG.WSIVS.ATssg................spaGPL..LTMSY...REQ...L.QLVFHPA-t........................................................................................
M7SFR3_EUTLA/773-1085                  .........................................d-DGEHIHLQDFLNMTNIRF..ME.L....................TTT...KRR..HTQAPTSRRSs....................ggLGKEDLSLERCIVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFK.....EYM............SA..............T..P.EF...KI............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRT..QL..Q..DGLKE..GLVKIAEGM....DSD.EQILQKEQKLL.DSVLPTLLKEFG...ALQVEHDNLQA...........ISQELAD.............CD.PEDLQAAR.ADLT....EID....GDVR..A...........K...........M.QKIDELRQQL.NETE...SA...ISDMS.QKKQECL.ADIEQAE...KIRE.....E.YR....GW..T.SN.EIS.SLK....................A.....KVEDLEKQHG.WTITG.IA......................DTT..VSMTY...QKE...V.ELVFDIS-s........................................................................................
N1QM58_SPHMS/728-1042                  ........................................pq---QKIGLQEFLAKAGIRF..MD.L....................TTT...KRR..LTVAPPSKTKgh...................tqSETEVVSLEDGVVAAACTVPELELYQHACLELKRFTKE.GKQVITEL....ED.QT.....LRA..Q....PPLVQ.....SYA............HA..............P..P.DR...KL............T.................LDA...Q...MRDMKTNARLRSKEMWYAWRS..QL..L..EELMG..GLSKIGEGL....IRD.DETLAHAEEVL.DQALPPLLTQHA...SLRQDAAQLER...........TANAVPE.............GE.KEQLSNTR.ESLT....IVN....AELA..E...........K...........R.VLLERLRKEV.EEQE...ST...IEHLQ.ESKVEFA.AAIEEAN...RVRE.....T.CR....GI..S.ID.EIT.ALQ....................E.....SVRKLEKRYS.WSISS.ASv....................ePEA..LTMTY...KSD...I.QLFFNPK-a........................................................................................
A0A0A2LJ13_PENIT/965-1291              .........................................m-EIESIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSAIKkltrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHAEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........R.RELERLQAEV.QEKT...AF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQQTG.WSIVS.AStps...............daskGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
N4TQL5_FUSC1/963-1270                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRD.....L.KV....T-..-.--.--N.TVL....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
J3P495_GAGT3/958-1271                  ..........................................DDSEAISLQDFLNLTSIRF..ME.L....................TTT...KRR..HTVVPSANKIgp...................deDGKADMSFERCVVAGACTVPMLELYQHSCRELKKYISE.GRDIVREI....EM.ET.....LED..N....PPLFR.....EYM............SA..............T..P.EF...KL............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLDRTVEGF....ESD.QQILRKQRELI.DSVLPGLVAQLE...SLQREYQVLDE...........AVRELAD.............CD.PEELEAAR.ERLM....AAN....DDVA..V...........K...........R.REIAALREDL.RESE...AD...VEELA.SRKAQCL.ADIEEAE...HVRE.....E.CR....GW..S.SG.EIV.ALK....................A.....RVAAVEEEHG.WAVTG.CS......................GTT..VSMTY...RRE...I.ELVFDPT-c........................................................................................
A0A1V6V5I0_9EURO/966-1292              .........................................m-EMEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTVPGSAAKkptrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYA............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVDEM....KAD.DDLLSEREELL.NRSVPLLVEKHA...SLEEQAANLQQ...........LMDEMEN.............CD.QDELRSTR.GKLF....EVD....SEIA..A...........K...........R.QELEQLQKEV.HEKT...AF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVHRIQQETG.WSIVS.AStps...............daakGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
B2WAC9_PYRTR/733-1044                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPASFHDv.....................eVEEKEESLDRYVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LED..N....PLLFS.....EYL............TA..............P..P.DQ...RK............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..HDLKA..GLFHTMDGF....KRD.ESTLVNQEQLL.DVVLPPLIEKKE...HLSVECKQLQQ...........RHDELNS.............CD.REELEQTR.EKLV....ATD....AELQ..K...........K...........K.QLLLRLQQEL.ADKE...QR...IQAAK.DRKVECV.EEIKAAE...RLRE.....N.CR....GW..S.TS.EVS.NLK....................A.....KVTALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFAPS-a........................................................................................
A0A1G4J3W3_9SACH/417-726               .......................................sae---NGITLRTFLDAVGIST..LS.N....................DVS...KDI..SKLEFNHLPE.......................--GAHLSASGTYNTLYANMPILEIYAFCCKELLQRIAK.SKQVFKAV....EE.QV.....AAS.pP....PAIFH.....KYL............SA..............T..P.ED...RE............A.................MKN...Q...IELIRRYSQLQAAKVWYEWRS..RH..L..KGIQN..VLQENLMIL....RDE.LETLSARIDNI.TGINKRVNEIKL...NLSREIHLYREs........skF----KNvh........skiPD.RLKIEKLR.VDLA....GEV....ENLN..-...........-...........-.-ECTHLISRA.KSLK...KE...IEELQ.SKANKTQ.KQISILS...SEVK.....K.KA....HF..A.IR.EVP.KLQ....................S.....TFHQLQLISG.VLLKG.YT......................GTK..LNVQL...CGS..yI.TLEFDVK-r........................................................................................
R4XA62_TAPDE/673-984                   .......................................spl---PRTTLSEFLKMTGISF..LTgL....................STT...RRR..ETIVMPEKVSe.....................sADPLDREIEHLVDQAY-TVPMLEMYQHSCRELTRYITE.GRAMCEEI....ES.DM.....NDQ..N....PELFD.....QYR............RA..............G..P.AE...KR............D.................LEG...K...FKELKTTARLSAKGVWYVWRE..NL..L..SNVLV..PLKKNLADL....EKE.AARLQEFEEKA.TPKFEQVQREYD...ELKAKVDELVR...........EEDLYDS.............YD.HEEAAKLA.ETIE....AQE....AQMA..I...........D...........A.AEIERLKAQD.AQLD...AE...LAAID.LEYDQKL.AEVKHLE...AQVE.....K.HR....GY..S.AS.EIQ.EMQ....................L.....EYRRLVESTG.VCVLH.VT......................DSA..IQLVM...DDS...L.LVDLSL--ad.......................................................................................
A0A0C9YGQ8_9HOMO/96-214                ..........................................EEGPPISIEQFFEMTGIRF..MD.E....................IAA...PHQ..QSIHPSVLRPsr...................raSVEGQIPLAEYMVVMAVNVPQLELYTHISKDLQAWIER.IQAIYREA....KE.EA.....LKM..M....PQLFQ.....EFI............LA..............D..E.TG...QA............D.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------celdht...................................................................................
A7SR58_NEMVE/1049-1355                 .......................................skk---KQIKVAELLSMSGIFF..-D.T....................RVT...SRR..STVAFLEKME.......................---KPKTISEAICMSYIIKPKAEQYLTVCDEVEKELTE.LRAASEFV....VQ.QL.....DAS..D....SGILQ.....IAG............AA..............G..D.FE...QS............D.................LAD...Q...LNDLHIACKKLAKKKWSEKKK..TL..K..RRVAH..SLKEYHNML....SSD.LGTLSETLSVA.NDCAKLLCDVEA...ELDAGLARIHA...........ENTSEEN.............VD.PSSAD--S.NDLG....KES....PELL..A...........L...........E.EELSKREAYR.QELT...SE...KEALT.REKNGLErEEIECEE...LVLR.....L.GG....NA..PfGD.NTD.ELE....................H.....KYKLLNELSE.WTLEE.WE......................PAR.lARFTF...LN-...-.--------stldlnvtfg...............................................................................
U1HQE8_ENDPU/709-1030                  ..........................................QEVERISLQEFLSMANIHF..ME.L....................STT...KRR..HTLAPGKPSQl.....................pLDGSSTSSGACFAAAATTLPLLELYQHATRELKSYIST.GRKVIGAI....ER.DT.....MEE..Q....PALFR.....EYV............DA..............R..A.DV...KT............V.................MEN...Q...FRNGKANARLQSKESWYAWRR..QL..V..EGLRG..GLYDIKSGM....EED.AQLLTQQEAIL.DRIVPALVKHFA...ELEQEAGMLQQ...........RAVDFES.............ID.HESLNNAR.SQLE....SAD....LEVA..H...........K...........M.DLLSQLQQQM.ADKA...EA...LTAAD.ELKSEFQ.SQIAEAE...RVQD.....E.CR....GW..K.AE.DVR.KLK....................E.....QVKRIEQGTG.WMLVT.AEhevee............ggvdfGPA..LTLRY...RNA...L.RLFFYP--gv.......................................................................................
A0A151Z514_9MYCE/806-980               .......................................pql-----ISFNDFIYLANCRF..MD.Dy..................sFKS...KRS..SLIGMNMATD......................iEENSETDFKSVLIAVYSHNRHKNVLKAGYEELKRMINQ.INEDNKVQ....EE.HI.....TKN..N....PPIFQ.....HIQ............LS..............T..K.DD...LL............S.................KQH...L...LKKIKNTSKLSTQLTYIQWRN..EL..E..KAIQQ..EILRSKSEL....EKD.QQVMLERIQQM.K-----------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------teelgmia.................................................................................
J7R7N6_KAZNA/405-715                   ........................................ls---PSYSLREFIEGIGDGF..LP.Ki..................sLLQ...KNP..KKITFSYTKP.......................LKGPEPAVEKVYATLQYELPVLQLKNFIALELLRRNNQ.SNLDFMNL....QE.QI.....KSSssP....PLLLK.....EYY............ES..............S..T.DI...QE............A.................MNQ...Q...LQILKGYSTLVAKKNWCKWQI..SQ..L..ERIKE..VLKENVAAL....DQK.VQTISSKLSTC.RDIAQKTERIKD...WIKQDILLLKDpp.......eiHASNTDS.............LKrKVKLESMK.RYLA....VQK....LTVE..-...........-...........-.-KLPVLIKEN.EELK...TR...LKESK.EKLVELE.KITR---...---E.....Q.SV....DK..G.EE.KIK.QLQ....................N.....KLDFVKMVTG.IHLIG.VD......................QTT..LIARF...D--...-.--------tipgieftfntnvk...........................................................................
A0A0F8UVK0_9EURO/999-1323              .........................................s-DVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSISKraar..............lslddDKSSAANFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAD..N....PPLFR.....EYM............TA..............A..P.DI...RL............L.................MDN...Q...FRNVKTHTRMLSKATWYEWRM..KL..L..EGLKD..GLDKHVEEI....KAD.GSLLSKHEELL.NNAVPALVEKHS...ALEKEATNLQQ...........LVDELEN.............CD.QEELRSAR.DKLA....QAE....EEIA..L...........K...........K.KMLQELQDEV.QGKT...DT...IETGA.ELKAEFL.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIC.ELK....................D.....SVQKIEQKTG.WSIVS.ASpse................faaGPV..VTMSY...RHQ...L.QITFHPG-s........................................................................................
A0A063BXY3_9HYPO/949-1262              .......................................ldd---GRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPNSLQDqs...................tvEGEDGMSLERFVVAGACTVPMLELYQHSCRELKNYIAE.GRRIVKEI....EA.ET.....LED..N....PPLFR.....EYV............TA..............T..P.NV...KA............L.................MDN...Q...FKNVKTYARLLSKAMWYEWRM..KL..Q..EGLKE..GLVKISEDM....DRD.ERMLKEREDIL.AAVLPDAVAYHD...ALEREREVLEE...........AARELAD.............CD.PAELQAAR.DELT....NCD....AGIE..V...........K...........Q.RLIAEMRQQL.QSAA...SI...AEDLG.AKKENLV.REIEQHE...EVRE.....A.CR....GW..T.CS.EVE.ALK....................A.....RVDVLEKQHG.WAVTG.LT......................GSN..LSMAY...RRE...I.EIVFDIA-s........................................................................................
K1X8X9_MARBU/1056-1365                 ........................................dd----RIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPRSSIRa.....................aGEDKHISLQDCVAAGAATIPMLELFQHACQELKRYISE.GRKTVREI....ET.ET.....FEE..N....PPLFR.....EYI............SA..............T..P.DI...KV............V.................MDN...Q...LKNVKTHARLLSKGMWYEWRM..TL..L..GTLKE..GLFKSAEGM....MED.EEILDHQQELL.EAVLPELIRRAE...ELQLEEADLKS...........AAEEIAN.............CD.QEELSEAR.QKLI....AVD....ADVE..A...........K...........K.QLIADLRRQL.KGKE...SE...IKAGI.ERKQLCL.EEIREAE...KIRE.....E.CR....GW..T.SS.EIS.TLK....................E.....KVDAIEREHG.WTITG.VS......................GTT..TSMTY...RKD...I.ELVFDAS-s........................................................................................
A0A1W5D2P7_9LECA/1060-1329             .........................................e-EDDRIHLQDFLNLTSIRF..ME.L....................TTT...KRR..HTVAPNAVLDgsark............ptregeDTNPGQDLERCVVAGACTVPMLELYQHSCRELKKYISE.GRSIVREI....EA.DT.....FEE..N....PALFR.....EYM............SA..............A..P.EV...RS............I.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..L..DGLKE..GLLGVGEGM....TAD.AEILAEQEALV.KPALPTLTAEHE...RLETQCQLLQA...........QADELAS.............CD.QEELKEAR.EKLV....STE....EDIE..T...........K...........R.KAVEELQRQL.QEKE...EG...IANAT.ERKQECL.LEIKEAE...K---.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------nslk.....................................................................................
A0A1E3I5K9_9TREE/621-931               .......................................eip---QNISLSAFLEMTGVQF..LE.Gl..................pGML...RRR..SSVAKGILGQs....................ysGGERDFSLHEYTEAQVNSI-FLNMYTWAANKLRDDIKT.GNDELSLV....SA.RC.....DLD..S....PPVIQ.....EYL............LA..............S..D.ED...KQ............L.................FEM...T...FKSYKTNTHLKAREMWYDWKW..QL..L..ETIKP..DVESMLNDM....KND.NKRLTEITEQT.TALLPQLRARQI...ELQAELQKERD...........AVVEIAT.............CD.QGELATYK.EAIA....EQS....AQIN..N...........F...........S.TELADSKSKL.FILT...CK...LQELN.AKRQESV.AAINHAK...S---.....Q.CD....QY..T.RS.DAI.RLQ....................E.....EYTSLQHLHL.WNVSK.SL......................PDI..LQLTY...DAE...I.TLSFTCH-m........................................................................................
F0XSS8_GROCL/925-1238                  .........................................v-ETERIHLQDFLNMASIHF..ME.L....................ETT...KRR..PTEVGLPATNkdg.................sqpEDSTRDPETEELVTSVCKVPLLEMYQHACRELKNYIEE.GRSIMREI....ET.ET.....YEE..N....PAIFR.....EYM............TA..............T..P.EL...RT............Q.................MDN...Q...FKNIKIFARLQSKKQWYEWRT..KL..Q..QGLQE..GMQKTLWDL....EKD.REVLQARRSVV.DAAYPQLLAEYE...GVEGEIVRLMA...........VARGV--.............GD.GDGVTALR.QQKR....QLQ....ASLA..A...........R...........K.RETERLQAET.QASR...AR...VAAMK.AERERHL.QELEEAK...RVQE.....E.RR....SW..S.HQ.EIT.TLK....................A.....QVDGLERKSG.WAVTG.AQ......................GTT..LSLAY...RRE...V.ELVFDVR-a........................................................................................
A0A238FH77_9BASI/703-1020              ........................................ap--VPKLTLIDFFKSTGTAN..MK.Dvia.............mtgvDLT...NRR..KSVAPASFASr....................deESGGPPSFADLAVTGGCMSLFYQMYQNDQARLQEQIIA.NVEFLTAI....DE.RL.....EHD..Q....PALFR.....QWQ............SA..............T..D.EQ...RA............A.................LQV...Q...FNMIKRHSHLAERIQWNECRT..TN..L..DSIID..VMEHSLQGL....RTD.NAVIEE--ARI.GSVIPDLQARRE...ALLAELLAERQ...........RDLELCA.............CD.QEELAQAH.ESLQ....EQA....GEMD..R...........L...........D.GQHTQIASQL.AGLV...SR...LNDLT.DEVTLAT.RERDRLH...RSLE.....D.GR....CF..T.KA.EVF.RLQ....................A.....EYEALQRLSG.WSLEQ.FS......................GTE..VRLIH...LGE...V.VVT-----lvlgq....................................................................................
A0A1E3PB12_WICAO/496-801               ..........................................EEYIPVSLKQFLSDLSIEF..FD.N....................LNI...NDD..LTVSFSEQFD.......................--ITGIHTFDYLKGKMSLIPWLELYMFSCTELQKNMTE.LKRLFDNL....NE.EF.....SEE..N....PPLVR.....EYY............QS..............T..N.IQ...QQ............K................kMSD...H...LLFMKTLSDKQAETSWLTWRN..QL..L..EELVS..RLDTNLRTL....KEE.STNLSSVLEEV.TNLEKTIDEEFF...SIDNQLQGYLK...........QNEVAEA.............SS.SEDVTSLR.HELL....EFL....DTSL..S...........Q...........Q.KVFDDLEIQV.QESS...DK...LKDSK.DLEKEVN.QKLE---...-FIE.....T.NG....RD..P.LS.RLE.HLK....................K.....SFLTIQSISG.LKFHQ.LA......................GTI..VTVGL...CDG..lV.ELKVDLS-d........................................................................................
A0A2H3C1J5_9AGAR/734-1045              .........................................d-EGPPISIQQFFEMTNIKF..MD.D....................LTA...PRR..SMHPSQLASRq.....................pRNPADIRQAEYTIAVAIDIPQLLLYSRVSSDLQAWMQQ.SKSVFVEA....EE.EA.....AKM..T....PELFI.....EFS............RA..............D..E.EG...QA............E.................LLH...Q...LNLIRTNTRAQAKSDWYEWKL..QW..I..EGLRV..TAEQALSEL....ETD.AKTLAGLRAHA.DDIVPALQQEYD...SIMRELQQEQA...........EVAEIEQ.............CD.QEYLNELK.SSIA....EQN....LEVD..A...........L...........K.TEVSEGNEQL.KWLG...ER...LEEIE.LQRRQAN.TAISEAN...RILH.....M.QT....HS..T.EA.EVF.RLR....................S.....ELEALEDMHM.LHVAK.VD......................SQL..FEYVY...ASQ...F.RVSIPCV-n........................................................................................
B6HCL6_PENRW/924-1250                  .........................................v-EIKPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTAAPGSATKkltrl.............sgenmSKPGSITFGDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLLRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVDEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..A...........K...........R.RELEQLQEEV.KEKV...TF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQQTG.WSIVS.AStps...............daskGPL..LKMAY...RDH...L.QLEFYPG-a........................................................................................
A0A1Y2CXJ9_9FUNG/1206-1513             ........................................ne--DKSLTLTRYLQLIGIQF..KD.N....................FEK...KIE..RKLPNIEINN.......................---AQLSEVEKLKAISVYLQELEGLKYECVDIRKSIKE.CQNSLDNF....DK.EF.....LKN..L....PTCFK.....DYS............NA..............V..D.DQ...RR............D.................LQQ...K...FKTTQEYSRLKAKQAWYRWRT..SM..C..NEMNK..KYKKTIELF....KMD.MEKINNFSSEV.TKYVPSMKRYYK...QLIEAIDLNKS...........-QDVFSE.............SF.EERMSLLE.KKTL....EQK....QYIL..S...........L...........K.TDTLSYEKEK.ENSL...KK...IEELN.STIEQLN.NIIKQSE...ERIKq...lE.ST....IF..T.KE.TLK.KSK....................N.....EFNLVVSISN.WKIKN.LS......................PDL..ISYIH...DDI...L.QVSFNRR-n........................................................................................
A0A0D2DRC3_9EURO/1020-1341             .........................................s-EEDKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPASg....................sqADVDASNTADNFVAAATTLPLLELYQHATRELKSYISA.GRKIIRSI....EA.ET.....LAD..Q....PPLFR.....EYV............DA..............R..P.DV...KV............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKN..GLEGIGHGI....QAD.LQLLQQQQQIL.DSVLPRLNQERT...DLENRKASLQQ...........SLEELDS.............VH.HESLTNCR.RELQ....NAD....KYCL..Q...........R...........S.ALLDSLHEQM.REKE...EA...LLAAA.ELKTEMN.DQIAEAD...RVRE.....E.SK....GW..P.VA.DVL.DLR....................S.....RVNAIEKQTG.WRLIA.VEeemd.............eptdfGPA..LTMMY...KDD...L.RLFFYPQ-a........................................................................................
G8JPM9_ERECY/427-737                   .........................................e-AIEPISLESFLDATGVSF.lID.L....................QII...EKI..EKIEFRYTED.......................--ITKVSTAQIYNALYLQIPILEIYSFIVKELYRRIHD.SQELFHEV....QE.QI.....SNN.sP....PLLFR.....SYF............ES..............S..D.EV...KK............L.................MNE...Q...IVLIKSFARMEAKKVWLEWRC..QH..L..KGIKS..VLEENLSLV....QTE.YAGVVKHLNEI.NDIKDRVKTIEQ...TLMRELQTLKNg........gpVVRHGSS.............IAeRMKIEKLK.RELS....DNM....VKLN..-...........-...........-.-GLEDLEKQR.TIIR...EN...KSKLH.SQIAAVK.KEIDSLK...ALLN.....R.KK....IH..S.SY.DVK.KLQ....................N.....MFSQIQLFTG.INFVK.LV......................GSE..LHLSL...KAN..kV.NIGFDL--lk.......................................................................................
A0A286UQM9_9HOMO/761-1073              ..........................................EDLPPISIKEFFLMTGVKF..MG.D....................LTA...PRR..STIHPSQLNRr....................esATMIIPTMAEYVMAMNVHFPQLELYSWVAKDLQLFIDN.SKRLYEEA....EE.EV.....AKL..T....PSLFR.....EFS............QA..............N..D.EG...RE............E.................LLH...Q...LKLIKANRHSAAKEKWYEWKY..QW..I..QNLLA..NVDRGFSDL....EKD.KITLTNFIDQA.EDILPALRQQHA...QTLAELERERR...........EVEEIEN.............SE.TSFLEELK.GTIE....EQN....ILLN..D...........Y...........K.TDAAESNAKL.ARLE...EK...LQELQ.IQKEENE.TAIAQAE...KRIA.....L.NK....TS..L.TT.EVF.KLK....................D.....ELESLQIMHN.WRISK.IE......................KHY..VNLVY...SEL...F.LVHVPC--ik.......................................................................................
A0A163K478_ABSGL/570-870               ....................................ksktls-----------------HF..LD.I....................CGF...PSK..ATTTRKPKQVl.....................hTNHAPASFDEQASAAASTFLELDAYEKLVEKTEDLIKD.LTAKLQQM....DE.DL.....SQN..N....PQVFA.....EYD............SA..............T..P.AM...IT............D.................MEN...R...FTELRKLAYTETEQQWYNEHI..SV..M..ESLLD..VFRNQMTGQ....HKD.QELLKQKTDYL.TKHLPFVLKKRQ...DVAKDLEEARK...........RLQTYEQ.............LD.LTLLDRWE.RDIR....DQE....AVIA..K...........S...........L.KDAQKIEEKE.EKVS...KE...LALLA.EKKAELQ.LAIAQAE...ETKN.....A.HT....YV..S.EL.DVL.QAK....................D.....TYDTCTVLCA.WKLEN.HT......................DDT..LQFIV...HDD...L.DVLLDTN-k........................................................................................
A0A1L0C059_9ASCO/536-845               .........................................i-DIPVVSLTEFLTEIGIKF..YD.Dl..................eFST...DMS..NRYRLSLSDA.......................--HSPLTQADYYRANI-QLPVLEVYELCCKELSGKIKQ.GMDLFDEL....KT.AT.....LQN..N....PDIFR.....EYF............KA..............S..F.YD...QM............T.................MKS...R...FHTLKEYTRQQAKQIWYQWRT..KL..I..ENIID..VLRGNLEII....QSD.KSTLIDQISSL.DTIYRDIQLEHH...RIRLDILQFKD...........IQSRFED.............LD.TEQLKNIK.SKLT....DLN....KQLI..D...........Y...........K.AKIKEKETEL.KALQ...SK...IEDRN.TQISSLK.LQITESD...NKLL.....K.TR....PF..N.SA.EIG.ALE....................L.....KSLIFQAGAG.LEYVK.VV.....................qEKT..IEFRF...NSI...I.KVTVNF--me.......................................................................................
A0A1L9X3H8_ASPAC/1014-1340             .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSGRKrnlr..............lssenEARSPASFEECVAAGFCTVPMLELFQHSCRELKSYINE.GRQVIRSI....ET.ET.....LAD..N....PPLFR.....EYM............TA..............P..A.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLRD..GLNRHVQEM....KAD.DELLAKHETLL.SDTVPALIEKHS...SLEAEATTLQQ...........LADELEN.............CD.QDELRSTR.EKLA....GVE....DEIA..Q...........K...........K.KLLQEMQAEL.EDKT...NI...VETGT.EVKAEYM.AQIQEAE...RVKA.....Q.CR....GW..S.AQ.EIS.ELK....................D.....SVRNIERQSG.WSIVS.ATasdg..............stpaGPA..VTMSY...RHQ...L.QLTFHPA-c........................................................................................
A0A2B7Z916_9EURO/1040-1364             .........................................s-QVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTSEKKraas...............kaddEAGKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLNRHVEEM....QND.EAVLSKKEELL.DRVVPPLVEKHT...KLEAEAQNLQQ...........AVDELEN.............CD.KEELRQAR.ERLA....AMD....ADIA..A...........K...........R.KSLEQSQAEL.ENKN...NI...IKAGT.ELKDEFL.AQIREAE...RVTE.....E.CR....GW..S.VK.EVK.ALK....................A.....SVHALERQTG.WSILS.ASlkp...............sskyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A0D1Y5I1_9EURO/1077-1398             ..........................................QEEEKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQSLPADg....................lqEPAETSSTETNFVAAATTLPMLELYQHATRELKSYIST.GRKIIRTI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KL............V.................MDN...Q...FRNGKANARLQSKEGWYQWRG..QL..V..EGLKA..GLEGIKQGM....SDD.LNLLQQQERVL.NDVVPQMLQEHD...RLQKQQESFQQ...........SVEELDN.............ID.HEAMADCR.NQLR....DAD....AQYL..Q...........R...........S.TLLKALQLQM.TEKD...EA...LCAAA.EMKTEMQ.DQIAEAD...RVRD.....E.LK....GW..P.VA.DVV.SLK....................S.....RVDNIQKQTG.WRLLT.AEteve.............epdefGPA..LVMRY...KDE...L.RLFFYPQ-a........................................................................................
M2LKC9_BAUCO/773-1092                  .........................................e-PVEKVHLQDFLDQAGIRF..MD.I....................TAT...KRR..LTTAPTPSKArkds...............saesVTEEATSLETAIVTAACTQPEHDMFQHACHELKHYISE.GKKLIKQL....EA.ET.....YQD..C....PPLIH.....AYR............QA..............S..P.ER...KA............A.................LDA...Q...MREMKTNARLRSKEMWYAWRT..QL..L..EDLMK..GLSGIGEGL....LRD.DEVLQRTEKML.QEVLPELVERQQ...LLQDEAETLEQ...........AAEATSE.............EE.KVDLETAR.VRLS....EAE....GEVE..E...........K...........Q.KMLAELQQAA.EEQV...RQ...VGDLQ.ESKAEFA.AAIKEAE...RVRE.....A.CR....GV..S.MD.EIA.ALK....................D.....SVRKLEETYG.WTIAS.ASs....................aTPT..ATMTY...KSQ...L.QLFFHPA-a........................................................................................
G4N6Q2_MAGO7/934-1246                  ..........................................DDEERISLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPQAKDNs....................gsDGKDDMSFERCVVAGACTVPMLELYQHSCRELKKYISE.GRDIVREI....ES.ET.....LAD..N....PPLFR.....EYM............SA..............S..P.DF...RV............L.................MDN...Q...FKNVKLHARLLSKAMWYEWRM..KL..Q..EGLKE..GLDKTAEGM....AQD.EQVLKKKQALI.DSTLPALVEKFA...ELEKEHGLLDE...........AVRELAD.............CD.PDELQAAR.DELL....TAT....QDID..L...........K...........K.QQIAELEQDL.QQSE...EA...IGELT.TKKQLCL.NEIREAE...RVRE.....E.CR....GW..R.PD.EIM.DLR....................A.....RVEAIEKEHG.WTVTG.CS......................DTT..ISMTY...NRE...I.ELVFNPT-s........................................................................................
A0A0S6X8Z0_9FUNG/812-1104              ........................................ep--AHPVTLNGFLDLAGIKF..MD.L....................TAS...KRR..YTVAPTPAKTprsaaa...........aeedgdLASAEARFEEAVAAGACTIPELDLYQHSCRELKRYMSE.GKTCLKQL....EA.EV.....AAD..P....PPFLR.....AYM............SA..............S..P.EQ...RA............Q.................WDR...L...VVDVKTRARLHSKELWYGWRT..QL..L..LGLQE..GLRGIERGL....DGD.VAELRKRREII.EDVLPSAVAERA...QLIEELASLQD...........IAAQNSV.............DD.REMLDSAR.EELL....EVD....EAVT..E...........Q...........R.EVLYQLQAQL.EEQK...QL...VDMLN.DGKSEAV.AAIEEAH...RVKE.....A.SR....GI..S.KA.EAA.SYQ....................G.....----------.-----.--......................---..-----...---...-.--------mslplqvc.................................................................................
A0A0G4LS29_9PEZI/1002-1314             .........................................q-DEDRIHLQEFLNMTSIRF..ME.L....................TTT...KRR..HTQAPEAFKDg....................liDDEGNFPLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FED..N....PPLFR.....EYM............SA..............T..P.EI...KN............V.................LDN...Q...FKNGKSHARLESKAMWYAWRT..AL..Q..EGLKE..GLIRIAEGM....DAD.DKVLEKQQKLL.SSILPSLISRFE...VLNEERTNLEA...........VAQELAD.............CD.PSELEAVR.SELT....DVD....SDME..K...........R...........T.KQIVQLRAQL.EESE...AT...VGQLT.ARKRAWQ.EEIEEAE...KIRE.....E.CR....GW..S.TS.EIS.TLK....................A.....RVDAIEKQHG.WAISG.IA......................DST..VSMTY...RRS...I.ELVFDIS-a........................................................................................
A0A0N0NM00_9EURO/996-1315              .........................................a-EKESISLQNFLNMTNIHF..IE.L....................STT...KRR..HTQAPAPQRP......................sQEQEDRSTEAQFAAASTTLPLIELYQHATRELKRNISD.GRRVIRSI....EA.ET.....LHE..Q....PALFR.....EYV............DA..............R..P.EV...RA............V.................MDN...Q...FRNGKTNARLQSKEIWYTWRG..QL..V..SGLKS..GLDDIAKGL....QGD.DKLLEEQQREL.DQVLPALQEQHS...SLSEELLKLQE...........LRADLDN.............VD.MDALEQTR.KELK....AAD....EEHA..R...........K...........S.ALLDELKQQM.REKE...EA...LEAAE.DFKVEMS.AQIEEAD...RVRQ.....E.YR....GW..P.VA.DVL.ALQ....................S.....RVESIEKQTS.WKLIT.AEddte.............dpnefGGA..LTLSF...RDQ...L.RLFFYPS-a........................................................................................
A0A162MR83_9HYPO/917-1230              .........................................n-DEERIHLQDFLNLISVRF..ME.L....................QTT...KRR..HTTAPGTLQDgt...................taNGEDDMSLERCVVASACTVPMLELYQHSCRELKKYIAE.GRRMVKEI....EA.DT.....LED..N....PALFR.....EYL............TA..............A..P.DV...KA............L.................MNN...Q...FKNVKTHSRLLSKAMWYEWRM..KL..Q..EGLRE..GLVKISSDM....DGD.CQALKEQMDIL.ESVLPGLTSTYE...ALEEEHGTLEE...........AAQEIAD.............CD.PEELSSAR.QELV....SLD....ADIE..A...........K...........K.GQIAELRLQL.QAAQ...TS...SESLS.TKKASCL.ADIAQSE...KIRE.....N.CR....GW..S.SA.EVN.SLK....................G.....RAEALEKKVG.WAVTG.VH......................GTS..LSMTY...RRE...I.EIVFDVT-s........................................................................................
S7S548_GLOTA/22-342                    ..........................................EEEPPISIEQFFSLTGIKF..MD.E....................LTV...PRR..STFHRAGIQArnrrd............satsdtGEEPVIPLAEYVVAMTVDVPQLELYSHVAQDLQAWIEH.SKANFKQA....EA.EC.....AKV..T....PELFR.....EYS............RC..............S..E.ED...RP............D.................FQQ...S...LKLIKSHAHDQAKSQWYEWKL..QW..V..EQLQE..TADQGFADL....EAD.AKVLESLTRQV.QDLLPSLREEYE...QAIRELEQEQA...........EVDELER.............SD.QSYLNELK.ATIA....EQD....FALD..S...........F...........R.TEISESKAKL.ANLS...EK...LEEIE.QQKKESM.QAISDAE...RMAH.....V.QK....NS..T.KA.EVF.KLR....................D.....ELDSIQNLHY.WRPSK.IQ......................SDM..IELIY...DSR...Y.LVSIPCT-k........................................................................................
A0A066WFI4_9HOMO/1-188                 ..........................................-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...-------MRMRSKMSWYKWRH..NF..V..SEMQV..AADRETELL....QQD.LESLQAVGTQL.TEPIPSLREQHA...KLKAQLAAERA...........AVEAAKD.............CD.PEIMSELK.VGIS....EQS....AQIE..S...........Y...........K.ADIQSSTAKL.EKLK...VK...LEEAE.TDKRALQ.DQIRVHQ...EKLD.....-.-A....LH..P.TA.EIV.NLR....................E.....EFEKLQRLHL.WHAVK.LE......................EKF..IELCY...DDQ...Y.RVQMEC--va.......................................................................................
A0A178BBL0_9PLEO/727-1038              .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPALFHDt.....................eVEEKEETLDQFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RT............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..HDLKS..GLLSTLDGF....KRD.DTKLTNQEQLL.DAVLPPLVEKQA...SLSGEHKQLQQ...........RHDELNS.............CD.REELEQTR.ERLV....ATD....VELE..E...........K...........R.QLVERLQQEL.ATKD...AR...IEAAK.ERKVECI.EETKAAE...RVRE.....E.CR....GW..S.TS.EVN.DLK....................A.....KVNALEQVHG.WSITS.AS......................ATS..ITMTH...LND...L.ELYFQPT-a........................................................................................
W7LD48_GIBM7/992-1305                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDNgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLSGIDDGM....ETD.KELLNKQKSLL.DSVLPPIVARYK...SLLEERNNLEE...........IARELAD.............CD.PADLEAAR.DELV....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQYG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A093YDK9_9PEZI/1020-1335             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqIRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAKQQELL.DDVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FKIAI.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDTS-s........................................................................................
A0A1X2IPK0_9FUNG/611-919               .......................................pts---KPMTLAYFLDT-AAGF..KQ.La.................edKPI...PK-..QTNTPSTKP-.......................-SNAPATFDQQATAAASLLPELDAYRKLTEKYDQVIEK.LTDQLQQL....DD.DL.....SEN..I....PQVFA.....EYV............DA..............S..P.EV...CD............E.................MES...S...FSDLRKLVTAETEQKWYTEYM..SI..V..QDLMA..LFKGQLKDQ....LED.QQLLRQAKNRL.AQNLPQLMAEKH...KVTETLKNSQE...........MVQKYKQ.............MD.YGLLERWE.RDIK....EQE....VAIE..R...........S...........R.EEAQKVKEKD.AQTR...KE...LNLLD.EKKAALQ.TAIMKAE...ATKD.....A.HP....YV..S.YS.DFL.DAK....................D.....QFDASSALCA.WKLQD.KI......................EHT..IQFTV...YND...L.DILIDTS-k........................................................................................
A0A1E4T4T2_9ASCO/537-845               .........................................y-DYSQLPVSEFLEQVHVQF..YD.N....................IGP...FER..EFILPSGSIP......................tVVEKTADFLKYVEANT-QRPYFSYLSHLINQYKGSLHD.RRSCIEAH....EK.MI.....LDG..N....-QSIR.....EYL............DS..............D..D.SM...KP............K.................LKN...G...YQTLATFARQKATQENLKFLN..TN..I..SQLKS..EYERDHEVL....EAD.INETTEIKIHL.LKAREKLLAEKL...DLKKRIAVLKH...........HCKAFDV.............AD.QSKLDVLT.DKLN....SYN....ATRT..K...........L...........L.NVREATMEHS.DSHS...AM...LISKI.TQKSKLL.EHIATLD...SDIA.....R.HK....VP..T.TN.DII.QLK....................N.....EFAELQKMKG.LKLVS.LT......................DKK..LEVLV...MNV...I.RLSLDME-t........................................................................................
C1G2V2_PARBD/1026-1350                 .........................................p-QVEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTLAPSNEEKkaaf...............kteeEAAKGTSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YSD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..V..EGLKE..GLDRHVEEM....QND.EAILSKKESLL.DRVVPALVEKHA...KLETEARCLRQ...........AVDELES.............CD.KEELRQAR.ERLA....ALD....AEIA..A...........K...........R.KSLDQAQAEL.ENKN...DF...IQTGA.ELKNELL.FQIREAE...RITE.....E.CR....GW..N.VK.EVK.ALK....................A.....SVHAIERQTG.WSILS.ASlks...............sskhGPA..LRMRY...RDE...L.EVDFYPG-a........................................................................................
A0A098VMG4_9MICR/507-616               .........................................k---QSVDLKRFLSDAGIRF..LD.Nv..................tSNT...TRR..ETLSRCSRE-.......................--SGEFSAKRLVLHWCISMPECELYEQSCEVLELRIAD.IRAELHHI....EC.KF.....QTE..P....PHFYL.....SFY............AP..............S..S.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------gsqeecraq................................................................................
A0A1E4RTQ7_CYBJA/480-784               ..........................................EEYEPVSLDQFIGDLSIEF..FD.D....................LNI...NED..FTAEIQPLSN.......................--PKSANLLDFIIAKNVKVPWLELYSFSCDELQKNMNE.LKLLFDNL....SD.EF.....ADE..N....PRIVR.....EYY............ET..............S..S.LK...QQ............K................kLGD...H...LIQMKQYSDHQAEISWYSWRE..KL..L..DELQL..RLDKNLGSL....KSD.CDVLNDLLVQA.DELCESLKEENL...ILESNIESLET...........KKRLYES.............SE.RESLIQTR.KRLL....NEV....NELE..S...........A...........K.AEEKTLQLQL.EKLE...SG...LFDT-.---SSME.ETVNQKR...DLVA.....R.YT....ED..P.YS.RVL.RLA....................S.....NFRILGSVTG.LKLKS.LQ......................GST..LKMVT...NSK...M.ELSYNFS-t........................................................................................
H1VB46_COLHI/515-827                   ........................................qp--EERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKDg....................llGGKDDMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRISEGM....AVD.EKVLHQQQKLL.SSVLPAIASRFT...SLHQEHQNLQA...........VAEELAD.............CD.PEELEAAR.SDLA....NLE....TDVE..E...........K...........T.RRISELRRQL.EEAE...QG...IEELM.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..ISMTY...RRE...I.ELVFDMA-s........................................................................................
D5GNG7_TUBMM/1188-1502                 ..........................................EEEPKISLQEFLNMTSITF..LDgL....................TTT...KRR..QTGFPGLKKSrg...................smDDEAEACLADCIIAGACTVPMLDLFQHSCRELKKYIRE.GREVVKTI....EG.DT.....LEE..N....PLLFR.....EYM............EA..............P..P.DI...KL............I.................MDT...Q...FKNVKTHARFLAKGIWYEWRM..KL..L..EGVRA..ALEENLKGL....KGD.ETLLSEALAAG.QKLLPEIISRFE...AAKSKLDYLRE...........MKRRIEA.............DD.KAQLAIAR.ESLQ....SVQ....SKVE..Q...........T...........K.AELAQRKKDL.EKLD...AQ...LSERE.LRKQMLQ.SCIEEAE...RVKE.....M.NR....GW..S.EE.EVS.IWK....................S.....KVTALERKHG.WSIIS.AV......................DRT..MELLF...LKQ...L.RILWD---sca......................................................................................
C1H6H7_PARBA/1025-1349                 .........................................p-QVEPIQLQDFLEMTNIHF..ME.L....................TTT...KRR..HTLAPSNEEKkaaf...............kteeESAKGTSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YSD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.EAILSKKERLL.DRVVPALVEKHA...KLETEARCLRQ...........TVDELES.............CD.KEELRQAR.ERLA....ALD....AEIA..A...........K...........R.KSLDQSQAEL.ENKN...DF...IQTGA.ELKNELL.FQIREAE...RITE.....E.CR....GW..S.VK.EVK.ALK....................A.....SVHAIERQTG.WSILS.ASlks...............nskhGPS..LKMRY...RDE...L.QVEFYPG-a........................................................................................
A0A1L9RL35_ASPWE/1027-1349             .........................................s-KFPPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTIAPGSASKraa.................rlsEEIKPATFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAD..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHVEEM....KAD.DDLLSKHEALL.NSVVPAMVEKHS...SLGEQATTLQQ...........LADEMEN.............CN.QDELRNAR.DNLS....SVE....DEIA..L...........K...........K.KQLQDMQSEI.QEKS...NI...IEAGA.ELKADFT.TQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................D.....SVLKIERQTG.WSIIS.AKssp...............esfaGPL..LTMSY...RSQ...L.QLMFHPG-a........................................................................................
Q4WHU7_ASPFU/1009-1332                 .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSVSKrtar...............lsaeSKAATASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKE..GLYRHVDEM....KAD.GDLLTKYETLL.DGIVPALVEKQS...ALQEEAANLQQ...........LTDEMES.............CD.QDELRNAR.EKLS....SLE....DEIE..L...........K...........K.KQLQELQGQV.QEKT...NS...LESGA.ELKAEFL.AQIKEAE...RVKE.....E.CH....GW..S.AK.EIS.ELT....................E.....SVRKTELQTG.WSIVS.ATpsg................spaGPL..LTMSY...REQ...L.QLVFHPA-t........................................................................................
A0A231MD49_9EURO/912-1235              .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASKraar...............lsaeSKAGAASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLDRHVEDM....KTD.GDLLSKYEALL.DGVVTSLVEKQA...ARKEEATNLQQ...........LADEMEN.............CD.QDELRNAR.EKLS....SLE....DEIE..L...........K...........K.KQLQELQGQV.QEKT...NN...IESGA.ELKAEFL.AQIHEAE...RVKE.....E.CH....GW..S.AK.EIG.ELK....................G.....SVRKIELQTG.WSIVS.ATssg................spaGPL..LTMSY...REQ...L.QLVFHPA-l........................................................................................
S9VPI6_SCHCR/772-1079                  .......................................vlp----ALTLEEFLNMTEIEF..LD.N...................iTSS...KRR..ETIVSGSAES.......................---PQLTTAQLLESYYLQFPILELYKFSCQKLEEYIIE.GKDFVTKM....AE.DA.....YQN..N....PLLFY.....EYR............KA..............S..S.EM...KA............L.................MNS...Q...FRIIKTFSRLQAQGYWYEWRE..AL..L..LGIKQ..ELNENLMKL....QKN.LIQVSETRSKL.LPFFEGLRENLS...SVSSKVGTLRK...........RKEMFGQ.............YN.QKLVLQAQ.NKFE....DLQ....RELS..L...........K...........K.KALLEQQIKE.QHKR...KE...MDDLS.NRYKLLE.LQCREER...EFYN.....A.NQ....DF..E.YD.EIT.GYQ....................Q.....RMSELQRELG.WTIVS.IR......................PNE..MKLIW...NHS...L.Q-------pfhvyvll.................................................................................
V5FZ11_BYSSN/974-1299                  .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTIAPGSDKDqsks..............tentdSEDGSTSLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFR.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVQEM....NAD.DVALQKQEKLL.NSVVPSLVEKHT...VLQSEATKLQE...........FADEMDN.............CD.QDELRTAR.EKLS....SVE....AELV..E...........K...........R.KRLQEMQADL.QDKT...DT...IEAGS.ELKAEFM.DQIRQAE...RTKE.....E.CR....GW..S.VK.EVN.ALK....................A.....SVHDLEVKTG.WAIIS.ATpsp...............dspaGPM..LTMCY...RNE...L.QVLFHPG-s........................................................................................
A0A0B2WKY9_9HYPO/920-1233              .........................................v-DNERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPKRRQDgs...................sgDGEDDMSLERCVVAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....EE.ET.....FEV..N....PPLFH.....EYM............CA..............T..S.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLMTIAQGM....DAD.EKMIKEREDLL.SAVLPGVLERYE...RLEEESGNLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLD....ADID..A...........K...........K.RLIEEFREQL.ESST...SE...VEDVA.AKKQNLV.TRIQQSE...KVRE.....A.CR....GW..T.GS.EVE.NLK....................S.....RVDALEKEYG.WGVTG.LS......................GTN..LSMTY...RRE...I.EVVFDVA-s........................................................................................
A0A1J7I8X1_9PEZI/1004-1316             .........................................g-DEDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPAPQREs....................gaAEDGDVSLEKCVVAGACTVPMLELFQHSCRELKKYISE.GRRIVREI....ET.ET.....FVE..N....PPLFR.....EYI............SA..............S..P.EF...KL............I.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLIKIAEGM....TND.DELLREQEELL.ASVVPDLVKRFE...ALQQENEELEA...........VARELAD.............CD.PAELEAAR.ADLA....AVD....EEIE..E...........K...........S.KKLAAMRQEL.EESE...RS...VKDMS.SRKQQCL.DDIKAAD...QVRE.....E.CR....GW..S.SS.EIA.NLK....................G.....KVELLEKQHG.WAITG.IV......................DST..VSLTY...RRE...I.ELVLDIS-s........................................................................................
F0U9T4_AJEC8/1023-1347                 .........................................r-QVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTNDNKkats...............ktddETARGISFEDCVVAGLCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEYM....QND.DAVLSKKEEIL.NCAVPPLVEKHT...KLETEARNLQQ...........AVDELEN.............CD.QEELRQAR.ERLA....ALD....ADIV..T...........K...........K.ELLEQSQAEL.LNKN...NV...IKAGT.ELKNEFL.AQIGEAE...RVRE.....E.CR....GW..S.VK.EVK.PLK....................V.....SVHALECQTG.WSILS.ASlkp...............sskyGPS..LRMRY...RNE...L.QVDFYP--gt.......................................................................................
A0A165EZH0_9BASI/1-304                 ..........................................-------------MTSVTF..MD.G....................LTV...KRR..STVGPGVLGSvrd................qgidGKNTNRPLADYVSAAAVGIPQLEMYIWACQELKKNITT.SQETVNSF....DE.QV.....EKN..N....PLLFR.....EYM............TA..............N..E.EE...RP............L.................MEG...Q...LKIMKAHARLCAKEKWYQWRQ..GL..I..QDLQN..TVTEHLTKL....QED.HEFIQKTQAHL.GASLPELRARHT...ALAEQLALERG...........NIKELEG.............DN.PEQLKELR.EGIA....EQN....TQIE..S...........F...........R.NELAEVATKS.ERLN...SK...IADIE.DQCTQQL.AITAKAE...QHCT.....M.LR....SC..T.RS.EVF.RLK....................E.....DYESLERMHL.WTVGK.RK......................ADE..TVLVY...DSR...V.QVTLQP--gr.......................................................................................
A0A0W4ZBT3_PNEJ7/648-954               ........................................fl---SPITLTEFLKITSISF..LDgL....................TTT...KRR..ETTFFPYLAP.......................---KPPNLKELIYTASLTLPVLELYQFSCKELQKYIEE.GKEVINKI....EE.DT.....SEE..N....PLLFR.....EYI............SA..............T..H.DI...RV............I.................MDG...Q...FKLVKNYSRLYAKGIWYEWRD..KL..L..LGLKE..GLQNNLEGL....KKD.ELIINDIKPVL.NTCFPLIKLKFE...SLKEQLNHLRM...........IKEEINQ.............CD.QKELREVW.SSIS....RVN....EEIQ..R...........N...........V.EKIEDINKNI.YEID...NQ...LNKLS.EKQIILD.REIEEYK...KATE.....A.NR....CF..E.KE.EIE.NIK....................R.....TLETLKTITG.WEAKS.FS......................QDT..VVFIY...LGV...I.ETTFN---fiq......................................................................................
A0A1X7RT27_ZYMTR/762-1082              ........................................qp--MEKIGLQDFLNQANIRF..MD.L....................TTT...KRR..MTTAPTPSKArras..............nsqgvSDNEQATLENAVVAAACTTPELELYQHACHELKRYTKE.GKQMIAEL....EA.ST.....LRE..Q....PPLIQ.....AYV............HA..............T..P.ER...KI............A.................LDV...Q...MRDMKTFARLQSKELWYEWRS..QL..L..DELMV..GLQNIGEGL....IKD.DEILGQSEQIV.DQVLPALVEQHE...ALQEEADRLEA...........DVNAVTD.............EE.KEELQVAR.GRLT....DVD....ADIA..E...........K...........K.LLLETLQDQV.QEQD...EL...AEKLQ.RSNAEFT.AATHEAN...RVRE.....A.CR....GV..S.LN.EIT.ELK....................A.....SVKDLEESFG.WSIIS.ASs....................sPAT..VTMTY...KSD...L.ELHFHPQ-a........................................................................................
G9MI84_HYPVG/825-1138                  .........................................v-EENQMHLQDFLNLTSIRF..ME.L....................NTT...KRR..HTIAPRTSQSgl...................lpDGEEDRSLERRVMAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....FED..N....PPLFR.....EYI............SA..............T..P.DV...KA............L.................MDN...Q...FKNVRTHARHLSKAMWYEWRM..KL..Q..DGLNE..GLISISDGM....NSD.LKVVEEQENLL.KTVMPNLVSRYE...SLLEESNNLEE...........AARELAD.............CD.PAELQAAR.EELT....SLD....DDIA..Q...........K...........K.KLIAQLRQEF.EASE...AD...VGELT.ARKTQCL.AEIQDSE...RIRE.....E.CR....GW..T.ST.EVN.NLK....................A.....RVEAIEKQHG.WAVTG.IA......................GST..LSMTY...KRE...I.ELVLDIT-s........................................................................................
A0A0B7N5Z6_9FUNG/368-672               ........................................nt----NMPLSDFLSFVGISF..LP.E....................IPAkelRRR..STYNLDY---.......................---GAATVAQQAAAAASTLPQLELYQSSCQKLNELIRD.CKNTIASI....DE.DV.....SAA..N....PQFFS.....EYQ............ES..............S..L.AV...RS............K.................MAA...R...FVAIKNYAHSKAASDFYKRWC..GI..L..QDFAQ..LLKENHGKL....LQD.EQVSTELERRL.LDKLPELYAYQE...SLMKAHNDARI...........KETEYNL.............ID.HKALSNLE.EEIS....QQE....NSIQ..G...........F...........T.NQLKRLELEE.MTLL...EK...TAALE.KRKSELR.ATIKQSK...TILE.....T.TR....FV..T.EM.DLA.QAA....................D.....TFKKCADINK.FRLKK.AL......................DNT..IELSI...NGD...V.DVFIDQ--nk.......................................................................................
A0A165E5U7_9APHY/818-1142              .........................................d-EGPPISIEQFFAMTGIRF..MD.El..................tMPK...PRQ..SVVPPPQLRSrgrrrs..........sietsadDEEDEIPLAEFSVAMAVELPRLELYTAVANDLSAWIEE.SKKICLQV....EK.ET.....EKD..T....PELFK.....DFV............EA..............D..E.TE...KG............I.................LLH...Q...LKLIKANNYGTAKFQWYEWKM..DW..T..KRLYG..RAQQEFTNL....ETD.AQALAKVIKQA.QEMLPDLREEFA...QVMSELEQEQA...........DIAEIDN.............SD.QKFLADLK.ASVA....EQD....HELE..L...........F...........R.SDVSENRAKL.QRME...EK...QAELE.QQKQEIA.AAISQTE...HVLR.....I.QR....ES..T.SV.TVS.RLR....................D.....ELEALQNLHL.WQATR.IT......................ADL..AESIY...ASR...Y.LIRIPCK-a........................................................................................
G0VEF1_NAUCC/455-769                   .........................................d-DLERYSLRKFLGETNLGF.lLD.A....................NTI...KDD..SQVLNFSVTH......................vEGDSLLRSNNLYDILYVDIPVLEMNSFICRELIRKISQ.SQSSFENL....EN.QI.....KNA.pP....PLLMK.....EYY............AS..............G..G.EI...KK............L.................MNE...Q...LQLVKQYSKLEAKKAWYEWRK..LH..L..NGITH..VLLENLTIL....QEE.YDKIEKDLQKI.QQVNSRVKEIKN...SISHEIKLLRE...........LPANMYNqe........ptlTD.KVNIARLR.QELK....SHS....ISLG..-...........-...........-.-NLPSLKAKH.DKLK...ED...IENTT.AILSKAK.MQIKSLD...DNDS.....HlAI....IP..E.HS.NVV.KLQ....................K.....KLKYLEQLNG.VSIIS.FK......................GSI..LELGV...DQ-...-.--------lsanialdls...............................................................................
A0A1E4TZZ0_PACTA/749-1057              ..........................................DDYVPVALNTFLDTVDIKF..HD.D....................LDV...KDD..FNDSKFICKN.......................-GNENLHLSDYVVALQ-KLKFFELTDFSCKELKKNIVE.GKELFEKL....EK.EI.....LEE..N....PPLIR.....EYM............ES..............S..E.TV...QS............T.................MNQ...A...FQILKNYAREQAKSVWYGWRS..QL..I..EGVYQ..GLIKNKRAF....EDD.KLKVESKLKAL.KEQYDDLLRRKN...ETRARLEDLIK...........DKEEFAS.............CD.KEELLRVR.KEVI....AIT....DLCL..S...........K...........K.RELVSLNEEL.TQLE...EQ...LKLKT.QMLEDLS.IEVEDIA...ANIN.....Y.NK....VY..K.SE.EVD.LLE....................H.....KFKLIQSITG.FKYVA.YD......................KENcmLQMSL...DT-...I.QFEI----nlnd.....................................................................................
A0A2H3HVE7_FUSOX/988-1301              .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KKLLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A1J9QS85_9EURO/1036-1360             .........................................p-QVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTTEDKraap...............kaddETAKGASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAE..N....PPLFQ.....EYL............RA..............P..P.DL...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.EAVLSKKEELL.DRVVPPLVEKYT...KLETEAQNLQQ...........AVDELES.............CD.KEELRQAR.ERLA....AID....ADIV..A...........K...........R.KTLEQAQAEL.ENKN...NS...VKAGM.ALKEELL.AQIREAE...RITE.....E.CR....GW..S.VK.EVK.TLK....................A.....SLHALERQTG.WSILS.ASlkp...............sskyGPA..LKMRY...RDE...L.QVEFYPG-a........................................................................................
S3CNY7_GLAL2/1038-1351                 .........................................f-EDERIQLQDFLNMTNIHF..ME.L....................TAT...KRR..HTLAPKSDIDsr...................epRDVADVSLEDCIAAGAATIPMLELFQHACHELKSYISE.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............T..P.DI...RL............V.................MDN...Q...LKNVKTHARLLSKEMWYDWRM..TL..L..GTLKE..GLFRTGEGM....IED.EEVLDHQYSLL.KSILPDLVRQAE...GLEREEADLNA...........AAEDLAS.............CD.PEVLSTAR.QELV....SVD....SEIE..A...........K...........K.RMIQDLQSQL.EAKD...RE...ITSGN.ERRQICI.EEIREAE...KVRE.....E.CR....GW..T.SG.EIS.SLK....................A.....KVDTIEQEHG.WTITG.VS......................GST..TSMTY...LKD...I.ELVFDAA-s........................................................................................
A0A099NXX8_PICKU/455-788               ......................................dnhl----NVSLDVFLNDVGIQF..FD.YigpseseiqntlsllseidpTHN...P--..---------Rspsvadst.......sslstpssINTKRTNIIDYIDACS-NIPYYHYLVHLVNQYRSSIQS.ISTMVNTF....SN.DF.....LES..N....PTAIR.....EYY............QQ..............A..E.EV...KN............D.................LCT...N...YQAIAIFTRKQSKCQNLRFVA..SL..L..NQLSI..SYERSNEQL....ESD.LGVAIDWRKNV.LIERQKMIEQKV...LLDQIIQKINS...........LKSNLSI.............SN.MNKIKDAR.KQLV....EIE....QQHD..S...........T...........K.EKNQKYTSIV.EDKE...KL...IIEKQ.NIRDQLK.LEVAELK...EEIY.....R.KQ....IP..S.LG.DLK.KKK....................R.....KLESLESSKK.VKILG.AD......................PI-..-VLLI...---...-.--------sdvlqvkfipiasn...........................................................................
A0A2D3VNH4_9PEZI/755-1073              ........................................ns--LEKVGLQDFLTQAGIRF..MD.L....................TTT...KRR..MTTAPTPSKVksd................sqihDEPEEASLENMVVAAARTVPELELYQHACHELKRYTKE.GKQMISEL....EA.AT.....LQE..Q....PPMIR.....AYV............HA..............A..P.GR...KA............E.................LDL...Q...MRDMKTNARLQSKEMWYAWRS..QL..L..DELMV..GLQNIAEGL....IKD.DETLARTEVMI.DEVLPKLVEQHD...GLQQEAERLEE...........SVNAVSE.............EE.REELETVR.EQLT....KTN....LQIT..E...........K...........R.LRLEELQQQV.QEQD...KL...TEKLH.ASNAEFT.AATQEAN...RVRE.....A.CR....GV..S.LG.EIT.ELK....................D.....SVKQLEDTFG.WSIIS.ATs....................sPST..LTMTY...KGD...L.QLFLHPQ-a........................................................................................
A0A1C1D140_9EURO/1107-1427             .........................................h--EEKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPARp....................sqEGMGGSSTEASFVAAATTLPLLELYQHATRELKTYIYT.GRKIIRSI....EA.ET.....LAE..Q....PALFR.....EYV............DA..............R..P.DV...KV............I.................MDN...Q...FRHGKAHARLQSKEGWYQWRT..QL..V..DGLKT..GLQGIDEGM....KAD.LELLQQQQQTL.DDVLPVLHQERA...ELENQKSSLEQ...........SLKELDS.............VD.HEVLNDCR.RQLQ....NAD....EYFL..Q...........R...........S.ALLDSLQEQM.KEKE...EA...LRAAD.ELKSEMK.DQIAEAD...RVRE.....E.HK....GW..P.VS.DVF.ALK....................S.....RVEAIEKQTG.WRLVS.AEeevd.............eptdlGAA..LVMTY...KDE...L.RLFFYPQ-s........................................................................................
C7YIG8_NECH7/873-1186                  ..........................................DDEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTTAPGNLDNgf...................leQGEENLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....EM.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLRIDEGM....EVD.KESLDQQKSLL.DSVLPAIMARYQ...SLVEESGNLEE...........VARELAD.............CD.PADLEAAR.EELS....DLD....QDIE..L...........K...........R.KRIADLREQF.QASE...VE...IEDLV.ARKQKCL.EDIKESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDAIEKEQG.WAVTG.IS......................GTV..LSMAY...KRE...I.EIVFDMA-s........................................................................................
A6RDR6_AJECN/1023-1347                 .........................................r-QVKPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTNDNKkaaa...............ktddETARGISFEDCVVAGLCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEYM....QND.DAVLSKKEEIL.NCAVPPLVEKHT...KLEAEARNLQQ...........AVDELEN.............CD.QEELRQAR.ERLA....ALD....ADIV..T...........K...........K.KLLEQSQAEL.LNKN...NV...IKAGT.ELKNEFL.AQIGEAE...RVRE.....E.CR....GW..S.VT.EVK.PLK....................V.....SVHALECQTG.WSILS.ASlkp...............sskyGPS..LRMRY...RNE...L.QVDFYP--gt.......................................................................................
W9X3Z5_9EURO/1107-1428                 .........................................a-QGEKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAHSMPARp....................sqEGVGGSSTEASFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....EA.ET.....LAE..Q....PALFR.....EYV............DA..............R..P.DT...KV............I.................MDN...Q...FRNGKAHARLQSKEGWYQWRT..QL..V..DGLKT..GLQGIDEGM....KAD.LELLQQQQQTL.HEVLPVLHEERA...DVESQKSSLEQ...........SLKELDS.............VD.HEVLNECR.RQLQ....NAD....EYFL..Q...........R...........S.ALLDSLQEQM.REKE...EA...LRAVD.ELKSEMK.DQIAEAD...RVRE.....E.HK....GW..P.VA.DVL.ALK....................S.....RVEAIEKQTG.WRLVS.AEeevd.............eptelGAA..LVMTY...KDE...L.RLFFYPQ-a........................................................................................
M5BKI6_THACB/1-188                     ..........................................-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...-------MRMRSKMSWYKWRH..NF..V..TEMQA..AADRETELL....QQD.LESLRAIGTQL.TEPIPSLREQHA...KLKAQLAAERA...........AVEAAKD.............CD.PETMSELK.VGIA....EQS....AQIE..S...........Y...........K.TDIQSSTAKL.EKLK...AK...LEEAE.GDKRALQ.NQIRVHQ...EKLD.....-.-A....LH..P.TV.EIV.NLR....................E.....EFDKLQRLHL.WHAVK.LE......................EKF..IELRY...DEH...Y.RVQMEC--va.......................................................................................
A0A1V6PL49_9EURO/975-1300              .........................................a-DAEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSAAKkrsr..............rssemPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YED..N....PPLFR.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLHRNVKDM....KAD.DEVLSKREELL.NSAVPSLIEKHT...SLEEEANNLQQ...........LVEEMES.............CD.QDELRSAR.TQLS....GVE....DEIE..A...........K...........K.RELKQLQEEA.QERT...NT...IEAGT.QMREEFM.AQIQQAE...RVKE.....E.CR....GW..S.AR.DIS.ELK....................A.....SVQRIERQTG.WSITS.ASasd...............keptNPI..LTMSY...RSQ...L.QIKFHPG-a........................................................................................
A0A2B7XYB1_9EURO/1028-1351             .........................................p-QVEPLQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPSSDKRaaa................ktddEDTRTISLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRLIIRSI....EA.ET.....FAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.EVILSKKEALL.ERVVPQLIEKHG...KLETEAHNLQQ...........AIDELEN.............CD.KEELRQAR.ERLA....AMD....AEIA..E...........K...........R.KILDQSQAEL.EEKN...NI...IQAGA.ELKNEFL.AEIQEAE...RITE.....E.CR....GW..S.VK.EVQ.ALK....................A.....SVHALERQTG.WSILS.ASltp...............sskhGPA..LKMRY...RDE...L.QVEFYP--gt.......................................................................................
A0A2H2ZRW7_9HYPO/893-1206              ........................................ie--EHQMHLQDFLNLTSIRF..ME.L....................NTT...KRR..HTIAPRTSQSgi...................lpDGEDDRSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....FEE..N....PPLFR.....EYL............SA..............T..P.DV...KA............L.................MDN...Q...FKNVRTHARHLSKAMWYEWRM..KL..Q..DGLNE..GLVSISDGM....KND.LKVIEEQEKLL.KSVMPNLVSRYE...SLLEESSSLEE...........AAKEIAD.............CD.PAELQAAR.DELT....SLD....DDIA..Q...........K...........K.KLIAKLRQEF.EASA...AD...VEELT.ARKTQCL.AEIKESQ...RIRE.....E.CR....GW..T.ST.EVN.NLK....................A.....RVEAIEKEHG.WAVTG.IA......................GST..LSMTY...KRE...I.ELVLDIT-s........................................................................................
A0A1L9UN21_9EURO/997-1324              .........................................p-QFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLERHVQEM....KAD.GDILSKHEALL.TGVVPGLEEKHS...ALEKEATTLQQ...........LADEMEN.............CD.QDELRSAR.EKLS....GVE....AEIE..E...........K...........K.RRLQEMQDEL.QTKT...DT...IESGT.VLKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................V.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..IIMSY...RNQ...L.QLTFHPA-s........................................................................................
A9V0C0_MONBE/907-1207                  ........................................ft---------SFMQKLEVRF..AG.R....................ISS...TRR..LTQAAPAASY.......................-ERNPTAIARLIHDTAV---ELGCYNWAVDYLQTTTDGiERALPAEM....AR.II.....TSA..Q....AKLFD.....TVD............AL..............E..G.AE...LE............R.................YQA...R...ALKLKTASHATAKHSWLVWRQ..KF..E..TRISQ..GLQDEVREL....EQN.ATSVDARLQEL.RELRDTLAARRG...ELTRGRSSLQTa........lrTPEQIAA............mQDqAERVASLR.ARLS....QLR....EQVA..T...........R...........R.AALAEQEEKV.AQLD...ED...VQAKS.------A.EAAAQRA...RLES.....L.CK....EG..S.AE.ELA.RVE....................G.....LRSQLETMSG.WAIVE.LS......................EEH.rLEVLH...---...-.--------ttsgtrmtvqlqa............................................................................
A0A1B8EXG2_9PEZI/1024-1339             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqLGKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.ADALAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........E.ALVQELRSQM.EDNE...TR...FQIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
S8EGZ5_FOMPI/1-305                     .....................................mdelt-------------------..--.-....................MPK...PRQ..SVVPPQHLRTrgrrrs...........saefseAEEDPIPLAEFSVAMAAELPRLELFTAVANDLSAWIEE.SKKICAEA....ER.ET.....EKV..T....PELFR.....DFV............AA..............D..E.SE...KA............L.................LIH...Q...LKLIKAHNYGTAKSQWYDWKM..DW..T..QRLYA..RARQEFANL....ESD.AQALAKIIKQA.QVTLPDLREEYA...QVMAELEQEQA...........DIAEIEN.............SD.QDYLSELK.ATIT....EQS....SELE..V...........F...........R.TDVSESKAKL.DRLH...EK...LAEIE.EQKQEAS.VAIARAN...YNAH.....I.QK....ES..T.TS.AVF.RLK....................D.....ELEALQDLHL.WRATK.MT......................PNM..IQLIY...ASR...F.EVSIPC--ik.......................................................................................
A0A0B2UIJ6_9MICR/312-514               ....................................eeedvc-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................--R...Q...LKSLKSECRMKAKIEWYELRK..EK..E..LEFNE..MVVGNKNEI....TDE.YNRLAERVSSI.EEEIEKRKAANL...RMEKQIQRIRS...........RIDEGGD.............AR.YMKIDELK.AQMS....EQD....MVFE..G...........I...........N.KEMHDLEDLN.MKKE...IE...RKVLN.ETIAKIN.EDIKELE...KGLD.....-.VK....NV..N.EL.QLN.EIR....................Q.....EFKALCAIFG.VEFVN.VD......................LNE..MRLRV...---...-.--------mgyeiditmqe..............................................................................
G8YRI7_PICSO/689-999                   .........................................e-AYSPVTLYDFLRDISIRF..YD.Dl..................eIGT...KQV..DRISLSLTKI.......................NENEDWPFDDYVEAMN-KIPLLELYDFSCKELSKNINE.GKTMFEQF....DD.VT.....REN..N....PKLFR.....EYY............SA..............G..P.NE...QL............G.................MKS...E...FQLIKDFARQQSKEVWYSWRT..QL..V..QNLFD..QLGDKYDLL....LQD.KDILQDSLSTI.NELFDEITAKKN...LLMQRLTSFES...........FESQCDS.............IT.DDDLESMQ.KELE....SCK....EKYH..Y...........L...........K.EVEMERQLRL.EEIS...IK...IQKNK.ELISTFN.KDINEHE...KIIN.....D.NR....KY..E.KS.EIE.QLK....................T.....KYNMLQSITN.LKYNS.MK......................QNV..ISFTF...YNT...L.NIKMDFS-d........................................................................................
A0A0F9XCU9_TRIHA/921-1234              ........................................id--ESQMQLQDFLNLTSIRF..ME.L....................NTT...KRR..HTIAPRTSQSgi...................qsDGEGDRSLERRVMAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....FED..N....PPLFR.....EYI............SA..............T..P.DV...KA............L.................MDN...Q...FKNVRTHARHLSKAMWYEWRM..KL..Q..DGLNE..GLISISDGM....NGD.VKVLEEQESLL.KTVMPSLVSRYE...SLLEESNNLEE...........AAKELAD.............CD.PAELQAAR.DELT....SLD....DDIA..Q...........K...........K.KLIAQLRQEF.EASE...AD...VEELT.AQKTQCL.AEIQDSE...RIRE.....E.CR....GW..T.ST.EVN.NLK....................A.....RVEALEKQSG.WAVTG.IS......................GST..LSMTY...KRE...I.ELVLDIA-s........................................................................................
A0A067PUB3_9HOMO/959-1287              .........................................d-EGPAISIEQFLTMTGIKF..MD.E....................LTV...PRR..STIHRSALQPrdgkrrrss....sstgegaeedEEEVQIPLAEYVTAMTVDVPQLELYLLVAKDLRAWIEH.GKVNFKQA....EE.EV.....AKV..T....PELFK.....EFS............SC..............D..E.ED...RL............D.................FQQ...T...LKLIKAYAHASARSQWYDWKL..SW..V..QGLHE..KAEEGFSQL....ESD.AKVLENIIKDA.QDVIPSLQEEYD...QIMRELEKEQA...........EVEQIQN.............CD.QGHLADLK.AAIA....EQE....SILD..V...........F...........R.SDISESNAKL.ERIQ...DK...LSEIE.AQNHEAT.EAIAEGQ...RKLH.....I.QK....NG..T.QA.EVF.KLR....................D.....ELDVIDELHM.LRILK.VK......................HDL..MEFVY...AST...L.RVTVPC--vk.......................................................................................
A0A0A2VL15_BEABA/900-1213              .......................................nag---DRIDLQDFLNMISIRF..ME.L....................QTT...KRR..HTTAPGTLQDgs...................taNGEDDMSLERCVVASACTVPMLELYQHSCRELKKYIAE.GRRMVKEI....EA.DT.....LED..N....PPLFQ.....EYI............TA..............T..P.DV...KA............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRK..KL..Q..EGLRE..GLVKISSDM....DGD.YRVLQEQMDML.ESVLPELTQTYE...GLVEERENLEE...........AAKELAD.............CD.PAELDSAR.EQLS....TLD....ADID..A...........K...........K.KLIAELRLQL.RAAE...EN...SDSLS.AKKVSCL.ADIAQSQ...KIRE.....E.CR....GW..S.SA.EVN.SLK....................G.....RVDALEKQLG.WAVTG.VN......................GTS..LSMAY...KRE...I.EIVFDVT-s........................................................................................
W9XWQ8_9EURO/1038-1358                 ..........................................DEEEKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQSLAPRk....................sqDAEDHNGTEATFVAAATTLPLLELYQHATRELKSYIST.GRKIIRTI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KL............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKA..GLEGINHGI....RAD.LVLLDQQQKQL.DGVIPPLLLEQS...ELERQKSSLQQ...........RLEELDS.............VD.QEALTDYR.HQLR....DAH....DYHL..Q...........R...........S.ALLDTLQDQI.KEKD...EA...LAAAT.ELKLEMK.DQIAEAD...RVRE.....E.HK....GW..P.VA.DVL.ALK....................S.....KVEAIEKQSG.WRLLA.VEevde..............pngyGAA..LTMVY...KDQ...L.RLFFYPH-g........................................................................................
A0A094GX70_9PEZI/1021-1336             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATAQdgs.................egqLGKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.AETLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FKAAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0D1YQT7_9EURO/1052-1373             .........................................a-EQEKISLQDFLNMTNIHF..IE.L....................STT...KRR..HTLAQSMPQRe....................sqEGTTAPSTEMNFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KV............I.................MDN...Q...FRNGKANARLQSKEGWYQWRG..QL..V..DGLKA..GLQGIKKGM....AAD.LEVLQQQQRAL.DDVVPQALQEQS...QLETQANSLRQ...........SLEEIDS.............ID.HEALEDFR.QQLR....HVD....EQFL..Q...........K...........S.AHLEDLQQQM.EEKN...DA...LIAAA.DYKAELQ.DQIAESE...RVRE.....E.NR....GV..P.VA.EVL.ALK....................S.....RVETVEKKTG.WRLLT.AEedvd.............epnefGPA..LVMVY...KDE...L.RLFFHPQ-a........................................................................................
A0A1V6SII0_9EURO/1003-1329             .........................................p-EVEAIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASRrrsrr.............sgehiAQAGTITFDDCVAAGLCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLVRHVDDM....KAD.DVLLSKREELL.ANAVPPLTEKHA...SLEQEANNLRQ...........LVEEMES.............SN.QDELRGAR.QKLS....TVD....DEIE..V...........K...........K.RELEQLQAEA.QEKT...EI...IDAGT.EMRDEFL.GQIQEAE...RIKE.....E.CR....GW..S.AR.DIS.ELK....................N.....SVQRLERQTG.WSILS.AStdp...............ensaDPM..LVMSY...RNQ...L.QIRFHPG-a........................................................................................
R9P5V9_PSEHS/788-1092                  ......................................qvpv----QMPLNDFLRFVGVHF..ND.D....................MSA...SRR..KPVPPARGEQaaed...............gassEPQAPVSMMRLVKAACGTVPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PDFVR.....EIM............GL..............Q.nE.EE...RR............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVNSKKEQLqQEILPVLRVKHA...KLKADLALAKR...........RQAEIET.............CD.AEELKGLY.SSIE....EQH....EVLE..S...........M...........R.AKLMDIEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRIL-.--......................---..-----...---...-.--------dngfdp...................................................................................
A0A0J8U1N0_COCIT/995-1318              .........................................t-EFKPLQLSEFLKMTNIHF..ME.L....................NTT...KRR..HTIAPDAEKRrit................evdgQVTENISLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLDHHVEEM....NRD.SEALSKKEKLL.DDVVPELVNKHA...RLQVDAHNLEK...........AVEEMKN.............CD.QEELKQAR.ERLR....MID....LEIA..Q...........R...........K.EDLNKAQSDL.EKTS...NI...VKKGT.EQKAKLL.KDIQEAE...SILE.....E.CR....GW..S.VN.EVD.SLK....................A.....VVRNLEKSSG.WTIIS.VSsgs...............gtkyGPA..LSMRY...SNE...L.RLDFHPA-a........................................................................................
A0A0C9XUD8_9HOMO/747-1060              ..........................................EEGPPISIEQFFEMTGIRF..MD.E....................IAA...PRR..QSIHPSVLRPsr...................raSVEGQIPLAEYMVAMAVDVPQLELYTHVSKDLQAWIER.IQAIYREA....EE.EA.....LKM..T....PQLFQ.....EFV............SA..............D..E.TG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKL..QW..V..ERLHE..KASKGFENL....EKD.ANFLEEIIREA.QSILPGLQQEYD...QLVEELEQETA...........EITELEA.............CD.QDYLKELK.ASIA....EQG....MELD..N...........Y...........R.REVEEAKAKL.ERIE...EK...LKEVQ.IEKNEVS.ASIEKTE...RLIN.....V.QK....NS..T.HA.EVF.RLK....................G.....ELEMLQTLHV.VQITK.VD......................AEC..FEFVY...GSS...Y.VVSTRC--ve.......................................................................................
C4QW80_KOMPG/988-1290                  ..........................................DDYINVSLSEFLSSINVTF..YD.Dld...............vdcVPY...KNG..KTF-------.......................--DTKPSLQDFLYAFN-RLNFLQLLEFSCKELSSNIDE.GKIIFSNL....EA.EI.....LDD..N....PPLIR.....EYM............EL..............Q..H.NS...QL............Kk...............eMQR...D...FHLVKNYSRQQARGIWYNWRL..QL..L..KGIEE..SVTKKVQTS....REA.NLQLKKQLEQLtMEYDEQYKNRFV...VLKDKLTHLRR...........CKQLSEA.............VD.KTELENFR.KLFD....EVH....NEIE..V...........K...........Q.QEIKSLQSQL.DSLN...KD...IALL-.------N.ENVLKAN...KVLE.....N.KK....DI..K.EQ.QLD.KSM....................D.....RLKKICDGLD.IRFIE.LD......................QKSweLKFEM...YQA...I.NVSYSLH-q........................................................................................
A0A1L9TAZ9_9EURO/1033-1358             .........................................p-DFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSISKrtarl.............slegnGKSSASNFDECVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EN.ET.....YVD..N....PPLFR.....EYM............TA..............A..P.DI...RS............L.................MDN...Q...FRNVKTHTRLLSKATWYEWRM..KL..L..EGLKE..GLDRHLEEM....KGD.DKILSKHEALL.SDSVPALSTKHS...SLEQEATHLQQ...........LADELEN.............CD.QDELWAAR.GKLT....DIE....EEIE..S...........K...........K.KLLQELQIEV.QDKT...AT...IETGA.ELKAEFT.AHIQEAE...RVKE.....E.CR....GW..S.AK.EIR.ELK....................D.....SVHRIEQQTG.WSISS.ASsae................seaGSV..VTMSY...QHQ...L.QLKFYPG-s........................................................................................
A0A1Y1VGG9_9FUNG/1170-1477             .........................................p-EEKTVTLSRYLQLIGIQF..KD.D....................FNK...KPE..RKFGNLEINN.......................---DQFSEIEKLKSLSVYVQELEGLQYECNDIQKSIEE.CKNALDNY....EK.EY.....SNN..L....PVAFQ.....EYN............KA..............I..D.DK...RK............N.................LQK...K...FKTTQEYSRLKAKQAWYRWRT..SM..S..NGIIK..KYKKSIDLF....KMD.MEKINEFSSEI.TKYVPSMKIYYN...QLMETINLNKS...........-QEVFSE.............SF.EERMALLE.KKIH....EQK....QIIL..K...........L...........K.TEIMSYEKEK.EVSI...KK...VDELK.NTIDQLK.NVIEQYE...ERIKq...lE.SS....IY..T.KE.TLQ.KCK....................K.....EHNLVVNVSN.WNINN.LS......................PDL..ISYIY...DDI...I.LVSFNRR-n........................................................................................
W6YTC4_COCCA/765-1076                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPSAFHDv.....................eVEEKEESLDRFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RA............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKT..GLLHTMDGF....KRD.ESTLINQEQLL.DVVLPPLVEKKE...LLSTECKQLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....AELE..E...........K...........K.RLLAQLQKEL.ADKE...AR...IEAAK.SRKVECI.EEIKAAE...RMRE.....E.CR....GW..S.TS.EVS.NLK....................A.....KVAALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFVPS-a........................................................................................
B6QLK0_TALMQ/969-1291                  .........................................s-EWEPIQLQEFLNLTNIHF..ME.L....................TTT...KRR..HTTVAGNDRTadis...............gsrtVETGSVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EE.ET.....LAE..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QAD.DSLLSQQEAIL.QSVVPELVEKRS...LLDSEASRMQE...........IVDEMEN.............ID.PDELRMAR.ERLA....KAD....AEVE..R...........K...........K.RQLEQMQEDL.QNKN...DT...IEAGT.ELKTEFL.EQIREAE...RVRE.....E.CR....GW..S.IK.EVN.SLK....................D.....SVQMLEVQTG.WSIVS.AMtq.................eltGPG..MTLRY...KDE...L.EVKFYPK-l........................................................................................
A0A165I081_9PEZI/825-1141              ........................................rk---DNIQLQEFLNLTSIRF..ME.L....................TTT...KRR..DTTFARNITTgknn...............gssaNGPASQSFDDHVAAGTCTVPMLQVYQKSCNELKNKLSD.GRNTIQYI....EA.RS.....SED..N....PPLFE.....EYT............SA..............P..P.DI...KS............I.................MDN...Q...LKNMKTYARLQSKRTWYEWRM..NL..L..KPAKS..DLESTLEGL....ATD.EKAIASQEKLL.QPVLPTLFEKRT...ALEKTEQELRT...........RAEELAK.............CD.LQELRNVR.DRLV....DAQ....SDLE..E...........Q...........T.RLLEELQSQM.REVE...DT...QADLL.DRKAKVL.EDTAQAE...KTRE.....E.CR....GY..E.SS.EII.SLE....................A.....EVQALEQQHG.WSIKS.AS......................ATD..LVIAY...TNG...L.NLTL----sspn.....................................................................................
A0A1Y2GJX7_9FUNG/6-329                 ........................................mk--LPPITLSKFLNLVGVSF..LDhL....................TAS...TRR..RTIPPRVTES......................eGSKEVYRSSDLVKAMAISMQDLYSYREACRLLKQSIDT.SRAYAEEQ....ER.RM.....NKK..N....PEYFR.....EFR............ES..............D..S.EI...KE............L.................IKD...Q...FRMVKVYSKLETSAAFNNWKS..DL..L..KMEQE..TLKQHLDGL....KKD.IMNLSGLASTL.AKEKAKVIPRRD...ELRQQLEEATQ...........RQHGYEL.............VD.KEQLANLA.EAAE....EQG....AQIE..H...........Y...........E.SVKDKKAKEL.AEIR...AR...VEQLQ.LVEKTTK.ERIIEAE...KTVQ.....K.HQ....YV..R.VE.DLN.RAK....................D.....TLSIIQAIHR.WEPVQ.LQqlaqpt..........aglqrlNKP..LEFIY...DRT...L.KVTIDIT-k........................................................................................
A0A0C3QEL0_9HOMO/853-931               .........................................r-NVPKIAVTEFLDMAGIRF..HD.N....................MPV...QRR..HTMGPEALTMtfpdg............tmgplpDDDHEFSLADYYRAEAIHLGQLEMFIW-----------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------asf......................................................................................
A0A074S5S3_9HOMO/801-1111              .........................................d-DMPTISASDFLRMTRISF..MD.G....................LTV...KRR..STIGLGVLSRr....................ksDKDMVAGVADYVTAMTIGVPQLETYNYAAKELKEYISN.GKKAIKIL....EE.DL.....DAN..N....PYLFK.....EYL............AS..............G..E.ED...RR............A.................IEE...T...LGGHKEAMRMRSKMSWYKWRH..NF..V..SDMQV..AADGETELL....QQD.LDSLRAIGTRL.TEPIPSLREQHV...KLKAQLAAERA...........AVEAAKD.............CD.PEIMSELK.VGIS....EQS....AQIE..G...........Y...........K.ADIQSSTAKL.EKLK...VK...LEEAE.TDKRALQ.DQIRVHQ...EKLD.....-.-A....LH..P.TV.EIV.NLR....................E.....EFDKLQRLHL.WQAVK.LE......................EKF..IELRY...DDH...Y.RVQMEC--va.......................................................................................
A0A0D1E8A4_USTMA/798-1105              ......................................qvpv----QMPLNDFLRFVGVHF..ND.D....................MSA...SRR..KPIPPAKEDQatgd...............gtavSAQGPVSMMRLVRAACGSVPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PEFVR.....EIM............GL..............Q.nE.EE...RR............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVNTKKEQLqQEILPVLRVKHA...KLKADLALAKQ...........RQAEIDT.............CD.ADELKGLY.SSIE....EQH....EVLE..S...........M...........R.AKLMDVEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRIL-.--......................---..-----...---...-.--------dngfdptld................................................................................
U5H8B6_USTV1/706-1023                  ........................................ap--VPKLTLNDFFKATGTAN..MK.Dvia.............mtgvDLT...NRR..KSLAPASFASr....................deESGGSPSFADLAVTGGCKSLFYQMYQNDQARLQEQIMA.NVEFLTAI....NE.RL.....EHE..Q....PGLFQ.....QWQ............SA..............T..D.EQ...RA............A.................LQV...Q...FNMIKRHSHLAERIQWNECRT..TN..L..DSILD..VMEHSLQGL....RAD.NAVIEE--ACI.GSVIPDLQARRE...ALLAELHAERQ...........RDLELSA.............CN.QEELAQAH.ESLQ....EQM....GEMD..R...........L...........D.GQHTQIASQL.AGLV...SR...LNDLT.DEVTLAA.RERDRLH...RTLE.....D.GR....CF..T.KA.EVF.RLQ....................A.....EYEALQRLGG.WNLDQ.FS......................GSE..VRLTH...LDE...V.VVTLTL--gq.......................................................................................
A0A161WJC3_9PEZI/1031-1343             ........................................qa--EDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKDg....................llGGKDDMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRSIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............V.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....AAD.DKVLHQQQKLL.SSVLPDIVSRFT...ALQQEHENLQA...........VAEELAD.............CD.PEELEAAR.SDLA....DIE....NDVK..E...........K...........T.RRVAELRQQL.EEAE...QG...VEELT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IG.EIS.TLK....................A.....RVDFLEKQHG.WAVTG.VT......................GSS..ISMTY...RRE...I.ELVFDMA-s........................................................................................
A0A1Y2D890_9PEZI/974-1291              .........................................n-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQATAPLPDn....................tlQGDEDISLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFQ.....EYI............SA..............T..P.EF...KT............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLIKISEDM....DDD.DQLLLKGEELL.KSILPDLVKKFE...AMKVEHENLQA...........VVQELAD.............CD.PEDLRAAR.AELS....EVD....SDIE..V...........K...........Q.RRIEELRQVL.DETA...SA...IQDVA.QRKQECN.SAIEEAE...KVRE.....E.CR....GW..S.SK.EIN.SLK....................GtyfspKVDDLEKQHG.WAITG.IA......................GST..ISMIY...RRE...I.ELVFDIA-s........................................................................................
G2WTB0_VERDV/1002-1314                 .......................................qge---DRIHLQEFLNMTSIRF..ME.L....................TTT...KRR..HTQAPEAFKDg....................liDDEGNFPLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FED..N....PPLFR.....EYM............SA..............T..P.DI...KN............V.................LDN...Q...FKNGKSHARLESKAMWYAWRT..AL..Q..DGLKE..GLIRIAEGM....DAD.DKVLEQQQKLL.SSILPSLISRFD...VLNEERINLEA...........VAQELAD.............CD.PSELEAVR.SELT....DVD....SDME..K...........K...........T.KQIVQLRAQL.EESA...AT...VEQLT.ARKRAWQ.EEIEEAE...KIRE.....E.CR....GW..S.TS.EIS.TLK....................A.....RVDAIEKQHG.WAISG.IV......................DTT..VSMTY...QRS...I.ELVFDIS-a........................................................................................
W9XMW4_9EURO/1039-1360                 .........................................s-EQDKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQSMPSTe....................pqDGGDHNSTEATFVAAATTLPLLELYQHATRELKSYIST.GRKIIRTI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...KL............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLRA..GLEGINQGM....STD.LALLDQQRTTL.DGVIPQLLHEQS...ELERQKLSLQQ...........RLEELNS.............VD.QEALNDCR.HQLR....AAN....DYGL..K...........R...........S.ALLESLREQM.KGKD...EA...VAAAK.EMKVEML.EQIAEAD...RVRE.....E.HK....GW..P.AA.DVL.AFK....................S.....KVETIEKQTG.WRMLA.VEedad.............epsdcGPA..LTIVY...KDD...L.RLFFHPQ-a........................................................................................
M2RRQ6_CERS8/875-1197                  ..........................................EEGPPITIEQFFSMTGIRF..MD.E....................ITAp.kPRP..STIPPIQLRArsrgr............lssesaPEEDPIPLAEFSVATAVEVPQYELYTAVVNDLNAWIEE.SKKICAQA....EQ.ES.....EKF..T....PALFR.....EFA............DA..............D..E.SE...KA............I.................LLH...Q...LKLIKVNNHATAKSQWYDWKM..QW..V..EQLYG..YAEDGFASL....ETD.AEMLAKAIQDA.QAILPGLREEYA...EVMAELEHERA...........DIAASEA.............SD.PEYLKELK.NTIA....EQN....AELD..V...........F...........Q.ADIAENNAKL.QRLE...EK...SSEIE.SQKQEAV.VAIAQAE...RTIH.....I.QK....ES..T.SS.EVF.RLK....................D.....ELEALQELHL.WRVTK.MD......................ASS..FECIY...ASR...Y.HVSIPCHN.........................................................................................
R9AET8_WALI9/1067-1378                 .......................................eap---VQISLNDFLELTDMKF..LD.G...................iSTI...KRR..STVGPGGLSGe.....................nAPMHEPSSLEYLRAHAVTGPKLEMMYWCCHELKRYISE.GIEALNSY....ER.EV.....DNE..N....PPVIV.....DYL............LA..............S..E.DM...RV............R.................IEA...Q...LKIVKNNSRLNAKRVWYGWRK..EL..V..SGHAE..SLNESFNGL....EKD.ARVLQETRGAL.GENLPQLHALKD...KLETELRRERD...........IVRDIAS.............CD.KEEVEGLR.EAIA....EQA....QPLE..L...........Y...........K.AEIASNNEEL.ARLR...AR...LEAKQ.ETLAQNT.HTIDSNR...KEWD.....M.VR....CL..T.KA.EAM.KRK....................R.....EYESLQILHS.WQIVH.LS......................QST..HKFNY...ANE...L.ALSIS---qq.......................................................................................
V5F2T2_KALBG/805-1111                  ......................................qvpv----QMPLNDFLRFVGVHF..ND.D....................MSA...SRR..KPVPPANGEQaaqd...............gasaEPQGPVSMMRLVKAACGSVPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PDFVR.....EIM............GL..............Q.nE.EE...RR............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVNSKKEQLqQDILPVLRVKHA...KLKADLALAKK...........RQDEIET.............CD.ADELKGLY.SSIE....EQH....EVLE..S...........M...........R.AQVMDVEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRVL-.--......................---..-----...---...-.--------dngfdptl.................................................................................
A0A165RIA0_9HOMO/889-1209              .........................................d-DEPPISIEQFFSMTGIKF..MD.E....................LTV...PRR..STFHRAGIQArgrrd............satsetGEDATIPLAEYIVATAVDFPQLELYSHVARDLQDWIQH.SKENFKQA....EL.EC.....AKV..A....PELFR.....EYL............RC..............N..E.ED...RP............D.................FQQ...S...LKLIKSHVHDQAKSKWYEWKL..EW..I..KQLQG..TADQGFTEL....EAD.AKVLESLTRQV.QDILPSLREEYK...QALSELEQEQA...........EVDELER.............SD.QSYLNELK.ATIA....EQD....LALE..S...........F...........R.TDISENKAKL.TNFT...EK...LEEIE.QEKKELL.QAIADAE...RMAN.....I.QK....NS..T.KA.EVF.KLR....................D.....ELESIQSLHY.WRSSK.LR......................PDL..IELIY...DSC...Y.LVSIPCT-k........................................................................................
F2UCV2_SALR5/995-1287                  ........................................fa---------RFLQEIQINF..LD.N....................LSS...RRR..TTMLGAPALA.......................--PAPIDERTLAVHGTTFLPQLSQVRWSCEELTKVTHE.MKRVAGGK....ID.AA.....VNQ..N....TSLVN.....AVT............SL..............ElkD.HE...LA............L.................LQE...D...MAAMKEVCRQEAKHAWHVWRH..KL..E..TAIHE..SLQTEKTAL....DKD.AQFYDMALAKL.QGKTDKLQAALS...ALEDEEAQLDS...........QLLS-ES.............AV.DEQLQRTQ.QHG-....ALQ....EEHA..S...........L...........A.AELKVLTDSL.NTER...DT...LLSLE.VQLQQVQ.DACTTLE...EQKK.....AaAD....AV..S.EQ.QVD.AAA....................Q.....LYSDVASLCQ.WELLS.FY......................---..-----...---...-.--------kggqltvsadm..............................................................................
A0A1Y1Z644_9FUNG/684-987               ......................................kkpt----PTDVEGFLRLIEVSF..RD.H....................KL-...PEE..DGTPLE-IDD.......................---KAPSTVDYVQTSAVLFSELQLLEFCCQELKQNIMQ.GASAVQII....EG.EL.....NAE..P....SALMK.....EYY............ES..............S..E.EI...RG............E.................IAG...Q...FNVLKQHSDLTTKYMWYNWRE..KL..L..SPVIT..KLKETLESL....KTD.SKQVAQFKEQV.QGMLTKIQAYSD...SLTKKVQHEEE...........LQQSELK.............DQ.LEQLENLR.EAIA....EQN....TQLD..I...........F...........R.KEQSEIASEE.EKLL...AK...LRELE.NQKGNLV.EAIEQAK...SAFE.....D.LK....FC..S.EE.DLV.SIQ....................E.....EHSLLEALLC.WKPVH.VS......................AQN..NTFIY...DGA...L.QVSVNV--e........................................................................................
A0A1G4B5E0_9PEZI/1002-1312             ........................................dp--EERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKD......................fGGKEDMSLENCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNSKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....TVD.DKVLQQQQKSL.SSVLPTIASRFD...ALEQEHKNLRA...........IAEELAD.............CD.PEELEAAR.SDLA....ALD....IDVQ..E...........K...........T.RRVEELRQQL.EEAE...QD...VEQLT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..VSMTY...RRE...I.ELVFDMA-s........................................................................................
A0A1E4SR13_9ASCO/555-872               .........................................d-NYVPVTLNQFMQDIGIKF..YD.Dld................idVYL...TKR..ISITTNSIDE.......................---EDSKLSDYMRAYS-KLELLALYQFSCEELSKNIQE.GKKVFSEY....NA.MI.....ESN..N....PALFR.....EYY............SY..............N..F.QE...RA............G.................MNV...K...LQLIKDFTRHQSKVTWYAWRK..QL..T..VNLIQ..ELETKYNAL....LED.KVNFTQDITRV.DEIYNKALKVYA...SSKDKLKSLVR...........LKGQLNV.............LD.IQKLQELK.SNLA....KSS....TELI..Q...........L...........Q.KDIKLKTQSL.NDLE...TR...ISEND.RIRKTLA.SEILAEE...SIVN.....N.NR....KY..E.LE.EVK.VLN....................L.....KFKILQHVSR.LHFHP.AS......................DS-..LHFLF...DSS...A.--------wlkfqkrskveqsisfk........................................................................
A0A182YTM6_BIOGL/281-442               ......................................tfdd-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..--LVK..VIPKLLRQS....NKD.KENILENKQNI.YNIKEDINSKQQ...NIISIKDGLDT...........NSQN-IN.............II.KDNLENSR.QNIK....NIT....DDLN..A...........K...........K.QNIASHNDEL.NTLR...ES...VNSLE.TQLANFS.TALRQIK...EEIE.....K.GP....PI..S.CR.QIN.CTH....................N.....RVN-------.-----.--......................---..-----...---...-.--------vkllsglkvmcdtktdgggwii...................................................................
A0A1S7UMN0_ROSNE/963-1274              .........................................a-NGEHIHLQDFLNMTNIRF..ME.L....................TTT...KRR..HTQAPGTQKGa.....................lSGQEDLSLERCTVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFK.....EYM............TA..............T..P.EF...KT............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLVKISEGM....VTD.EQLLHKQQALL.DSILPRLVQQFA...SLVTEHEDLQA...........VAQELAD.............CD.PETLQSAR.TELT....DLD....SDIE..V...........K...........K.RKIEELQREL.TNVE...AN...VDTAM.QRKRNCI.DDIEEAE...KVRE.....E.CR....GW..T.SN.EIN.SLK....................A.....KVDELERQYG.WAITG.LT......................GTN..ISMSY...QRE...I.EFVFDIS-p........................................................................................
A0A0H2SF93_9HOMO/664-975               ..........................................EEVPPISIEEFFTMTGVKF..MD.Q....................LTI...PRR..STIRPSQLQQs.....................tSGDEPLRLADYVTAMNVHVPQLELYSWVAKDLQTWIDN.SKKIYREA....EE.EV.....AKV..T....PSLFR.....EYV............SA..............E..E.EG...RS............E.................LLH...Q...LKLIKANKHGASKEKWYEWKY..EW..T..ENLLR..DAERGYAEL....QRD.EQVLDDIVSQA.EGLLPSLKQQHA...QILLELERERS...........DVAEMED.............SD.PAYLEELK.VTID....EQN....ALLD..G...........Y...........R.ADIAEGNAKV.ERLQ...EK...LQELE.SQKAENE.QVINDAN...RKIT.....L.HK....NS..T.RA.EVF.RLK....................D.....ELEALQALHS.WRATK.VA......................PNV..LELLY...DNQ...F.LVSIPCT-k........................................................................................
Q6FS69_CANGA/271-579                   .......................................ths-----FSLKNFLSDIDYRL..LE.Ni.................kdIFK...QKN..TAITLNTLDY.......................SIQQNLRLGQVNSVYHIDVPTWEIKTFIINELRARINQ.SKSM-DVL....EN.DI.....SKT.lN....INSIA....lKYT............SQ..............S..E.AG...ID............T.................SLK...T...ILAVKEFSEMETQRDWYEWRL..KQ..L..DGFRE..VLTDNLEIL....NEE.YTNVKLELQKV.KELKLKISDLKD...TLQREIRILTEvs.......yeKQKNGPS.............LDdKIKFAKIK.KTLL....HHQ....IEVN..-...........-...........-.-KHDEIQRKR.QQLE...DD...INSKT.KQLIEIN.QSISKVT...SKRK.....T.IN....PM..D.IK.KER.TLL....................A.....NFNLLQALSN.IGCIR.NS......................NDI..IVL--...---...-.--------efkllggmki...............................................................................
B8PD02_POSPM/900-1129                  .........................................d-EGPPISIEQFFEMTGIRF..MD.El..................tMPK...PRQ..SIAPPPQLRArsrrrss.........aefnsdaYEDDPISLAEFSVTMAVELPQLELFAAVSNDLTAWIEE.SKKICLEA....EN.ET.....EKV..T....PELFR.....DFV............AA..............D..E.SE...QS............L.................LVH...Q...LKLIKANNYGSAKSQWYDWKT..VW..I..ERLDR..RAEEEFSHL....ESD.AQVLAKVVKQA.QGILPDLRAEYA...QVMAELEQEQA...........DIAEIET.............SD.QDYLGELK.ATIA....EQ-....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------tcv......................................................................................
A0A1L7WTX0_9HELO/1049-1358             ........................................dd----RIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKSAAKd.....................gDNCKVVSLEDCVAAGAATIPMLELFQHACHELKRYISE.GRKTVREI....ET.ET.....FEE..N....PPLFR.....EYI............SA..............S..P.DI...KI............V.................MDN...Q...LKNVKTHARLLSKGQWYDWRM..TL..L..GTLKE..GLFKTAEGM....IQD.EETFDQQQELL.DTVLPQLIEQYD...RVQREEGELQS...........AADEIAN.............CD.QEELSNAR.QRLI....TVD....ADVE..A...........K...........K.QLIADLRRQL.QGKE...AE...IQAGT.ERKQVWQ.EEIREAE...KIRE.....E.CR....GW..T.SS.EIS.VLK....................G.....KVDAIEKEHG.WTITG.VS......................GTT..TSMTY...RKE...I.ELVFDAS-s........................................................................................
A0A2C5Y6S1_9HYPO/937-1250              ........................................va--EEKIHLQDFLNLTSIRF..ME.L....................TTA...KRR..PTIAPTQASNgt...................gpDAQDELSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRHMVKEI....EN.DT.....LEE..N....PPLFR.....EYM............SA..............T..P.SV...RA............L.................MDS...Q...FKNVKTHSRLLSKAMWYEWRM..KL..Q..EGLKE..GLVSIFKGM....ERD.DELLQTQEQIL.SSQLPCLETSCE...ALMKECNSLQE...........AARELAE.............SD.PVELESAR.EQLT....FLD....ADIA..H...........K...........K.ELIGQLQREL.DEST...TE...VDKLL.AQKEQVM.TEINDAE...KIRE.....E.CR....GW..S.SK.EVD.ALK....................A.....RVDDVETKYG.WSIKE.IV......................GTR..LSMTY...RNE...I.EFV-----yflnt....................................................................................
A0A067MF32_9HOMO/6-278                 .......................................cpd-------------------..--.-....................---...---..----------.......................--EAKLPIVDYVAAMAIFSPQLESYTWGCQELEKHIVD.VQSNMEAY....EE.AV.....MDT..S....PPIFQ.....DYL............TS..............D..D.DN...RE............R.................LEQ...L...LKIIKTHSRLSTKADWYKWRH..QI..I..TDLQT..SADEHLKKL....END.NAILTELEESV.AAVLPAAREEYA...LLEAELAKELE...........SVAKLKE.............CD.QEVLAGLM.VEIT....DQN....AAIE..G...........Y...........K.SDIAEANARL.SRAQ...AK...LEEVE.AERTSTL.DAISAAR...AHCD.....A.HK....GV..T.RN.EVF.RLK....................G.....QFEALADMHK.WQILR.II......................PEK..VELQY...DTY...L.KVTVGCD-q........................................................................................
A0A0C3QQ81_9HOMO/1-249                 .........................................m-------------------..--.-....................---...---..----------.......................------------------------FIWATTEVKKQMAD.LNDELALL....EE.EI.....EDN..P....PNALL.....DFL............EA..............D..D.EV...RP............Q.................IEM...A...FKLAKAYAKRTQRGEWYRWRM..QW..T..KDLVP..HVDEEIRNL....ESH.LSFVREQREKL.HDPMGELQQMHA...SLKAELEREKA...........IVAEIDS.............SD.MEQLEGLR.AGIA....EQN....IVID..G...........Y...........K.TDIAQAAAEA.DRYN...AQ...LKERQ.SELQAAQ.DIIA-AS...KRRG.....E.QL....GT..T.AD.DVS.RKR....................A.....SWHMLQDIHG.WKGVR.VT......................PEL..MEFTY...MSS..qL.HVRMPM--in.......................................................................................
A0A0C3P769_PISTI/55-251                .........................................t-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...-HLIKVHNHEQAKSEWYDWKL..QW..V..EQLDQ..KASKGFEHL....EKD.AKFLEGVIHEA.QSILPGLQQEHD...QLVEELEKETT...........EIVELEA.............CD.QDYLKELK.ASIS....EQG....TELD..N...........Y...........R.REVEEAKAKL.SRIE...EK...LKEVQ.TEKAEVS.ASIEKTE...RLIN.....V.QK....NS..T.HA.EVF.RLK....................G.....ELETLQRLHM.VEITK.VE......................DDL..FKFAY...AST...Y.EVSATC--vr.......................................................................................
W9IJ57_FUSOX/991-1304                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A1Y1XAE5_9FUNG/189-499               .....................................sedki-----VPLSRYLQLIGIQF..KD.N....................FKK...KSE..RKIPNVDNID.......................INNDQLSEVEKLKAIAVYTQELDGLKYECDDIQKSIKE.CKNTLDEY....DK.QF.....LKE..I....PSSFK.....DYN............NA..............V..D.DE...RK............K.................LQQ...N...FKTTQEYSRLKAKQAWYRWRT..SM..C..NGMIK..KYNKSIELF....KMD.MEKINEFSSEI.SKFVPSMKLYSN...QLTETINLNKS...........-HEVLSE.............SF.EERMTLLE.KKIQ....EQK....QYIL..N...........L...........K.SETLSSEKEK.ENST...KK...IDELK.NTIEQLK.NIIEQSK...ERIKq...lE.ST....IF..T.KE.KLQ.KSK....................N.....EFNLIVSVSQ.WNIKS.LS......................PDL..ISYIY...NDV...L.QVSFNRR-n........................................................................................
A0A164XPD0_9HOMO/576-889               .........................................v-ETPAISIEDFFTMTGVKF..MD.E....................ITV...PRK..SIVRPTHLMSrr...................dsEGDSKPGLAQCIVAMNVDIPQLKMYAWVGSHMRKWIDE.SKATHRVA....EE.EV.....AKV..T....PAQFT.....AFA............EA..............D..E.QD...RK............E.................YTS...C...LKLIKACEQLRARATWYGWKQ..GW..L..AQLQG..DSEQSLRDL....DSD.ALTIKNLNREL.TELMPSLQEQHA...LIMQELDAEKE...........AVHEIEN.............SD.QEYLEELK.ATIA....EQN....GMLE..E...........Y...........Q.SKVSENRATL.ERLT...ER...LAEVT.AQQQEAT.EVIADCR...RKVG.....L.QK....NS..T.KA.GVF.RLK....................E.....ELEVIQDLHL.WETIK.VQ......................ADS..FEFIY...GSN...L.KVIIPCKN.........................................................................................
A0A0C4E3R7_MAGP6/962-1275              ..........................................DDSEAISLQDFLNLTSIRF..ME.L....................TTT...KRR..HTVVPSANKSgs...................deDGKADMSFERCVVAGACTVPMLELYQHSCRELKKYISE.GRDIVREI....EM.ET.....LED..N....PPLFR.....EYM............SA..............T..P.EF...KL............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLDRTVEGF....ESD.EQILRKQRELI.DSVLPGMVARLE...SLQREHRALDE...........AARELAD.............CD.PEELEAAR.ERLT....AAN....DDVA..V...........K...........R.RAIAALREDL.RESE...AD...VEELV.GRKVECL.AEIKEAE...RVRE.....E.CR....GW..S.SG.EIM.ALK....................A.....RVAAIEEEHG.WAVTG.CS......................GTT..VSMTY...RRE...I.ELVFDPT-c........................................................................................
A0A1M2VER2_TRAPU/845-1179              .........................................d-DGPTISIEQFFQMTGIRF..MD.El..................tMHK...PRR..STVLPGQLRPrarrrsssrdpassvgpagagagGDEEAIPLAEFAVTMAMDMPRLDLYGAVARDLTAYIQE.CKKIYREA....EE.EA.....LKV..T....PGLFK.....EFA............IV..............D..E.AE...QA............M.................LIH...Q...LKLIKANNMGTAKSQWYDWKL..QW..V..EQLYE..SAAQGFSNL....ESD.ATYLAGVIKEA.QDILPQLRDEYA...EITRLLEQEQA...........DIDEIEN.............SD.KDFLNELK.ATIA....EQS....TEIE..A...........F...........K.ADVSEAKAKL.DRLG...EK...LVEID.AQKAEAT.SAIAEAK...HIIH.....I.QK....ES..T.SV.EVF.RLK....................D.....ELEALQDLHL.WRAVK.HT......................SDL..VEFLY...ASK...Y.HVSLPCRN.........................................................................................
A0A1E3QCT2_LIPST/680-987               ........................................ds--YLPISLNEFLRMTSIQF..LE.G....................LNT...KRR..NTTFLQPSET.......................--LLEPTLSVTVLSRQLHCPMLELFEFSCRELRKNIEE.GKDLLERL....ET.SI.....MEE..N....PELFR.....QYV............CS..............S..L.DG...QA............A.................FCA...Q...FKVIKSYARLQSKGVWYKWRS..KL..L..DGIMS..SLIKNTNAL....KDD.CANLKTIEESL.RPSLSDIKSRHS...TLKSKLELLRK...........RKSEVAD.............CD.QEQLETAR.HNLA....IVE....LDVS..R...........K...........M.CTKRQIVHEN.EILS...CS...LNARL.SDIRARN.ESITISE...KTIE.....E.NK....GV..N.TA.EII.STK....................D.....ELEWIYKLFG.WTLKN.IN......................QDA..IVLCH...END...L.EIEVAL--cn.......................................................................................
A0A1J5X7T4_9MICR/225-532               ........................................es--VPEGSLKDFLDEIGVRF..LDgL....................AIF...TRR..DTLLFERMGE.......................---EQTPQERLRMATV-AATEQSVFAEGCSEILKRISA.TRAVVADL....EG.EF.....NFN..A....PQISK.....RYR............SS..............G..E.TA...RE............E.................IRA...S...LKSLKIAARTEARKVWYVWRR..TF..H..CQLYQ..EKFAALLGW....AGQcLGQINEKAKDI.ETCEEHTTRLHD...ETKAELRERRR...........RIEAYHT.............MD.WSRYRELE.SAVE....RQK....KQIA..E...........L...........E.KQVAEKENKK.TEAE...NT...FLRLE.QKAEGLE.EAVKELA...ENSK.....H.SP....EP..L.GE.LVE.KYN....................R.....NYNLLVDLCG.WRIVS.LK......................KNK..ISVLV...LGD...-.--------iplaltigf................................................................................
V2XP64_MONRO/816-1126                  ..........................................EDIPTITIEQFFEMTGIKF..MD.E....................LTA...PRK..SIHPSQLKRQ......................pRPPAEIPLAEYAVAMGIDVPQLTLYSRVSKDLEAWMEQ.SKVIFEQA....EE.EA.....AKM..T....PELFV.....EYS............RV..............D..E.EG...QQ............E.................LLH...Q...LSLIRTNTRLLAKADWYEWKH..QW..I..EGLKV..TAQESFMNL....ESD.ARVLEQLKHKA.DELVPALQQEYD...EIMRELEREQA...........EVAELEQ.............CD.HDYLNELK.TSIA....EQS....VEVD..S...........L...........K.NELKEGNDQL.KWLE...ER...LEELE.SQKREAT.SAIAEAD...RFLQ.....I.QK....NS..T.HA.EVL.RLR....................D.....ELEALENLHM.FRVCK.VN......................ANL..FEYVH...ASR...F.RVTIPCKN.........................................................................................
A0A1L9MZ48_ASPTU/995-1322              .........................................p-QFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ES.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLDRHAQEM....KAD.SDILSKHEALL.TEVVPSLEEKHS...ALEKEATTLQQ...........LADEMEN.............CD.QDELRSTR.EKLS....TVE....AEIE..E...........K...........R.RRLQEMQEEL.KTKT...DT...IESGT.ALKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..ITMSY...RNQ...L.QLTFHPA-s........................................................................................
M9MED4_PSEA3/856-1161                  ......................................qvpv----QMPLNDFLRFVGVHF..ND.D....................MSA...SRR..KPVPPAKDEAgddd...............kaaaATHQPVSMMRLVKAACGAVPQLEALREACREIKEQVDD.GREKMVEM....EQ.AF.....YDS..P....PDFVR.....EIM............GL..............Q.nE.EE...RR............D.................MEA...Q...FKLQKQAARALVSADYYGWRLdkEF..D..QEMIQ..TLQAYHGRL....QCD.LHIVETKRQQLqQEILPVLRAKHA...KLKADLALAKQ...........RQAEIET.............CD.AEELKGLY.SSIE....EQH....EVLE..S...........M...........R.AKLMDVEEQH.ERLL...VR...LEENR.EKMAAAQ.EMVDKAH...ATVD.....Q.IQ....GY..T.RG.EAG.RLL....................R.....EIRNLEKLHL.VRIL-.--......................---..-----...---...-.--------dngfdps..................................................................................
A0A167Q7L5_9PEZI/1075-1393             .........................................g-ENERIHLQDFLSMANIHF..ME.L....................ETT...KRR..ATELPGSFKDkhgr..............vstdeDGQPKDPKVESLVTSVCKVPLLEMYQHACRELKNYIEE.GRSIMREI....ET.ET.....YED..N....PPIFH.....EYT............TA..............T..P.AM...RA............Q.................MDS...Q...FKNIKIFARLQSKKQWYEWRT..KL..H..EGLQE..GMRKTLADL....EQD.QEVLRQRRTTV.DAVYPALLAECE...TLERERVRLEA...........FARQLGG.............PD.GPSLVAAR.LQKR....KLQ....NILD..E...........R...........R.RAAAESAAAL.LESK...AR...VAAMK.AEREQYL.LELEEAK...RIQE.....E.RR....SW..S.HQ.EIS.SLK....................A.....QVDLLEKKSG.WSVTG.AQ......................GTT..LSLAY...RRE...I.ELVFDVA-s........................................................................................
A0A1B8B1Z1_FUSPO/977-1290              .........................................a-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLEDgf...................ldEDEEDLSLERCVVAGACTVPMLELYRHSCRELKKYISE.GRRIVKEI....ET.DT.....FED..N....PQLFK.....EYM............AA..............T..P.DV...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKQ..GLVGIDEGM....ESD.KELLDKQKSLL.DSVLPAIVERYK...SLVEESDNLEE...........VAREIAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELRKQF.QASE...VE...VEDLN.VQKQNCV.DDIAESE...RIRE.....E.CR....GW..T.SK.EVN.SLK....................A.....RVDAIEKQHG.WTVTG.IS......................GTV..LSMSY...KRE...I.EIVFDIT-a........................................................................................
A0A0L0V7G0_9BASI/909-1238              ......................................sptl-----ISLNEFFEQAEIRF..IS.Lsq................prVRN...YDQ..QEH-----PHl....................sdAQSRMSNFAQQIFAGMVKIPRLRLLESSSRTLRQKTEI.LDFTTKEH....ES.EI.....SRNahR....YKLLQ.....DWVvlqqrqaqssqsNS..............Q..T.SQ...KH............Aed............lnqMMN...Q...LRLKKNWVEMSAKQDSHLFDI..DM..W..KTYQA..NLAQRTTKL....SQD.LERMRRLDSIV.RPATESLRDRKQ...NLTEEIRRRKQ...........KLAEIES.............CD.QGMLKALK.EEAK....DLA....AVTE..A...........N...........R.RALAESEFER.NLWL...EK...FAELE.AEKKEHV.KKIEQMK...LDPD.....Q.SQ....KC..T.VQ.ELI.RLK....................N.....ELITIQAMMG.WEMGE.FE......................DNM..MTFTF...LSI...I.GVTFHL--dp.......................................................................................
A0A1S8VUU1_9FUNG/1-170                 ........................................mq-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..----A..ALEENRKRF....NWD.KLLIDEYYKQL.SMLNASATAYRD...DLQQKTIELQA...........TNAQAVV.............EE.AARIVELT.ELET....AQS....LEIE..S...........L...........N.KELERLQHQT.EIEV...AA...IAHAE.AKLIEIS.GEISKSE...EVSK.....D.LM....VF..D.PE.DLP.HLR....................H.....EYKTTVLTHL.WRPTE.IS......................MAR..HIFVF...DNV...V.QVAFY---kq.......................................................................................
A0A017SDX4_9EURO/979-1302              .........................................q-KLEPIPLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTVPGSASRrssv..............rrsveGASKPATFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFR.....EYM............AA..............P..S.DI...RS............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHADDM....KAD.DKVLTKHESVL.NGVVPGLVEKNS...SLEKEATSLQQ...........LADEMEN.............CD.QDELRSAR.ENLS....SIE....VEIA..S...........K...........K.QELQKLQAEV.QEKT...DT...VEAGT.ELKAQFM.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIN.ELK....................Q.....SVSNIEQRTG.WSIIS.ASas.................ssgDPS..LTMSY...RNQ...L.QLSFYPR-a........................................................................................
A0A0M8PBR1_9EURO/916-1241              ..........................................QEIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrr.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLVRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLDQEATNLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEII..A...........K...........R.RELEKLQEEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.DLK....................G.....SVQRIQQQTG.WSIVS.ASsps................daeGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
I1C7V0_RHIO9/320-624                   .........................................d-DPEQITLKDFLDIFGITF..SK.E....................---...--K..PLNHIKRIVD.......................YNHGPTTIIEQVTAATFTLPQLETYQSIIQQMESSIQT.SHKVAQEI....EI.RV.....NKS..N....PSFFF.....DYS............IA..............D..V.ET...RH............E.................KES...E...YRLAKQHAEKKSLERWYEWWS..NA..L..KEHLT..VLYQHRDRL....NQD.KHTLIAAENRL.SEQLPKILDHQK...RVSKLYAVARE...........KEKEYHS.............FD.HIKLSTII.TEIE....QQR....LTIA..S...........F...........K.ADLDRLKRKK.SELL...EQ...TDRLE.KRKSELL.DLILETE...KVIE.....A.NQ....KV..T.EQ.DLI.EAQ....................K.....EYERSCLIQG.WRLMK.DE......................KNM..TELMI...GQD...V.MVSIDR--er.......................................................................................
M2XTZ2_GALSU/607-913                   .....................................rqqsh-----NAVSEFLQEAKVRF..LD.N....................VSS...RRR..QTSYGIYTTD.......................DRSTPENEESKILAVTGSYGWLKKLEELCEKLETSCTD.TETRISST....ED.TL.....NKE..P....PELLC.....TVL............KK..............D..F.PK...QQ............Lt...............rLQI...S...MKRLKNFCRLEARCSWYERRL..QF..E..NELAS..ELEYWISRF....KEE.MQSIESHIESM.QRLSSEFDDIAE...-----SQKLRL...........QPSPLPV.............EE.QRKLESII.ASLQ....EQE....SVRE..G...........F...........L.HSIQTLEKEI.MHKE...DE...KQKIQ.QEGSLLS.KRRQSLE...QYVL.....S.SS....DA..A.KT.NAR.SIQ....................E.....RFELYCFLLG.VSIRQ.IS......................KTC..IDVVI...LDR...L.NMKIGFN-n........................................................................................
G2Y9N3_BOTF4/345-661                   .........................................l-DNERIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKRSSDgpi................rnrlSDQTKVSLEDCVAAGAATIPMLELFQHACHELKKYISD.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............P..A.DM...KI............V.................MDN...Q...LKNVKTHSRLLSKGMWYDWRS..TL..L..ETVKD..ELVRSAEGM....IND.EEVLDKQQALL.DAVLPKMIKRAQ...QLQHEETNMKT...........AAEEIAS.............CD.PEELSEAR.QQLI....TVE....ADVE..A...........K...........R.NMIEELKKQL.QARE...IE...IEAGT.AKKETYL.EEIREAE...KIRE.....E.CR....GW..S.SS.EIS.SLK....................A.....KVDALEKKHG.WTITG.VS......................GTI..TSMTY...RKE...I.ELVFDAA-a........................................................................................
A0A166FSB8_9HOMO/800-1105              .........................................d-DFPAISIEQFMSLTDVSF..IQ.Di.................fvPPV...PIR..PSLAPRGSLG.......................--SGEAGAADCFVAMHEHLPQLELYGRVVEDMERWSGH.AAEVYAQA....EA.DA.....LRV..Q....PSLFR.....EFV............EA..............D..E.EI...QR............E.................LVG...H...LKRYQRHCRAKVKLQWRQWRL..GW..V..NELKE..TADKGFTSL....TSD.ATKLEALNKEA.QSLLTVLRENTA...KLEKEYEEEQA...........FADALAQ.............DD.PEYLDELK.ATIA....EQE....SVLQ..A...........F...........R.DEKTDNDAAL.ESLE...RR...IAELE.ASNQQER.DAIARLE...RPEE.....-.--....--..P.VK.DVA.ALR....................D.....ELAMLEDLTM.FKITR.IR......................PYG..WSLIY...ANR...Y.VVDA----pste.....................................................................................
A0A2H3F5P8_9HELO/1063-1372             ........................................dd----RIQLQEFLGMTSIRF..ME.L....................TTT...KRR..HTIAPRSAMKa.....................iGEDKHTSLEDCVAAGAATIPMLELFQHACQELKRYISE.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............T..P.EI...KV............V.................MDN...Q...LKNVKTHARLLSKGMWYDWRM..TL..L..GTVKE..GLFKTAEGM....IED.EEILDHQQELL.ETALPELIKRAD...QLQREEADLQY...........AAKEIAN.............CD.QEELSDAR.QQLI....AID....ADVE..A...........K...........K.RLIADLRRQL.EGKE...SE...IEAGN.ERKEVCL.EEIREAE...RIRE.....E.CR....GW..T.SS.EIS.ALK....................E.....KVDAIEKNYG.WTITG.VS......................GTT..TSMTY...LKD...I.ELVFDAS-t........................................................................................
A0A1A5ZV96_9TREE/621-931               .........................................e-QPQNISLAAFLEMTGVQF..ME.Gl..................pGLN...RRR..SSVGKGLLGQs....................ysGGDRDFALHEYSEAQVNSI-FLNMYTWAANKLRDDIRI.GQSELDLF....ES.RC.....DED..S....PPVIQ.....EYL............SA..............T..D.ED...KQ............L.................FEL...T...FKSFKTNTQLKAKELWYDWKL..QL..M..QTIKP..DVEAMMVGM....QED.NDRLTALNEET.ESILPALKARQA...ALQAELERERQ...........IVAEIAE.............CD.QQELASLK.EGIA....EQG....TQIN..V...........F...........N.SELEESTSKL.AALT...TK...LQELN.STKKECV.HAIQHAK...S---.....Q.CD....QF..T.KS.DAI.RLR....................E.....EYNSIQRLHL.WRPIK.IH......................HNL..LELEF...DNE...I.SLTLSCSN.........................................................................................
W3WLP7_PESFW/999-1311                  ........................................dg--LERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDSFRDs....................ilQREDDMSFERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFK.....EYI............SA..............S..P.DF...KL............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLKIAEEM....DED.ERVLQKEEQLL.QSILPELTAQSE...ALETEHENLQA...........IAQEIAD.............CD.PEDLLAAR.AELT....AVD....ADIE..A...........M...........A.RQIEELQHTL.QETE...AT...VVGLS.RRKEDCV.AEIAEAE...QIRE.....E.CR....GW..T.SH.EIS.SLK....................E.....KVDAIEQEHG.WNITG.IS......................GSR..ISMTY...RRD...I.ELVFDIA-s........................................................................................
K5X6I3_AGABU/793-1103                  ..........................................EDIPSISIDQFFSMTGIKF..MD.D....................LTT...PRR..SVYPHTGSRK......................sRNPTDIPLSEYYPTMGIDVPQLGLFTKVSKDLEGWMAR.SKADFAQA....EE.EA.....AKV..T....PELFV.....EYM............RA..............D..E.EG...QA............E.................LLH...Q...LNFIRTNARGQAKSDWYDWKL..KW..I..EGLQD..TAEQTFTDL....QSD.AKSLEPIMNSG.EELVFALEKECD...ELLQLLEHEQE...........EVAEIEA.............SD.QNYLNDLK.DSIA....EQN....FEVE..A...........L...........R.AELSEQTEQL.NYLR...GR...LQEIA.ISKQEEA.NAYAKAQ...HFLE.....M.KE....NS..T.RT.EVF.RLR....................G.....ELEALENFHQ.FRVTR.VD......................ESL..FEYVH...ASR...Y.KVSIPCNN.........................................................................................
J9W032_CRYNH/606-915                   .........................................e-QPQDISLAAFLEIAGVQF..ME.Gl..................sGLN...RKR..SNVAKEILGQs.....................yANERDFALHEYTEAQVNSI-FLNMYTWASNKLFQDIQT.GDEELAAV....SA.RC.....DID..S....PPVIQ.....EYL............AA..............S..D.ED...KQ............L.................FEM...T...FKSFKTNTHLKAKEMWYDWMW..QL..L..ETIKP..DVQTVLTGM....KED.KKRLTAFEEQA.VILLPQLRARKT...EVESKLAEERK...........AVIEFES.............CD.QAELAAYK.EAIA....EQS....AQIT..N...........F...........S.TEVADLKNEL.ATLT...GK...LEELN.AKKHEYE.TAIAHAK...G---.....Q.CD....QF..T.RS.DAI.RLQ....................E.....ESISLQHFHL.WRPTK.IL......................PER..MELIY...DAE...I.LLSINCTN.........................................................................................
A0A178ZQD0_9EURO/994-1315              .........................................s-EEDKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTMAQPMPASg....................sgQSTDGSDTADNFVAATTTLPLLELYQHATRELKSYISA.GRKIIRSI....EA.ET.....LAE..Q....PPLFR.....EYV............DA..............R..P.DV...KI............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKN..GLEGIDRGI....QED.LQLLQKQQQML.DTVLPQMNRERT...ELEGQKASLQQ...........SLEELDS.............VH.HESLTNLR.RDLQ....SAD....EYCL..Q...........R...........S.ALLNSLQEQM.TEKE...EA...LLAAA.ELKTEME.DQIAEAD...RVRE.....E.NK....GW..P.VA.DVL.SLR....................S.....RVDAIEKQTG.WRLIT.AEeemd.............epnefGPA..LTMMY...KDD...L.RLFFYPQ-a........................................................................................
A0A1Q2YG24_9ASCO/469-801               .......................................dnh---VNVSLDVFLDNVNVQF..YD.Ni.................gpSDN...EVN..QTLVFNSDLKsspfseispasssatststpssvSSTKRANLIEYIDACT-NIPYYHYIVHLINQYQSSIQS.ISTMVNTF....SN.DV.....LES..N....PTAIR.....EYY............QQ..............A..E.EV...KV............D.................LCT...N...YQAIATFTRKKAKCQNMRFLS..GL..L..EQLIS..SYERANQFL....ESE.LSKALDWRRGI.LVKRQKMIERKV...ELNLYIQKLDT...........LRDNWNS.............IN.IEKIKKAN.ESLR....LHG....DKKV..I...........I...........K.ASISDHSKLV.SHKT...KS...VLDKK.MTKEKLL.REVESLR...KQVS.....S.ST....VP..S.KT.HLK.ALM....................A.....RLHSLEELKS.IKL--.LP......................GAA..ITLLI...LKK...L.KAVFH---krd......................................................................................
I4Y9V7_WALMC/604-915                   .......................................eap---VQISLNDFLDLTDMKF..LD.G...................iSTI...KRR..STVGVGGLGGl....................kqQSQKDPTSLDYLRAHNVTGPKLEMMYWCCHELKRYISE.GIEALNSY....ER.EV.....DNE..N....PPVIV.....DYL............LA..............S..E.EM...RI............R.................IEA...Q...LKIVKNNSRLDAKRVWYGWRK..EL..V..HGHSE..SINDSFKSL....EKD.IGVLKETRGAL.KEKLPELRSLRE...KLEVELRRERE...........IVRDIAS.............CD.KEEVEGLR.EAIA....EQA....QPLE..L...........Y...........K.AEISSNNEEL.TRLR...TR...LEAKK.ETLSNNR.LAIENNR...NEWD.....M.VR....CL..T.KA.EAM.KRR....................R.....EYESLQSLHS.WHIQH.LS......................QSH..KKFNY...AED...I.EINI----td.......................................................................................
A0A1B9HTF3_9TREE/619-929               .........................................e-QPQNISLAAFLEMTGVQF..ME.Gl..................pGLN...RRR..SSVGKGILGQs....................ysGGERDFALHEYAEAQVNSI-FLNMYTWAANKLREDIRT.GQSELDLF....ES.RC.....DED..S....PPVIQ.....EYL............SA..............T..D.ED...KQ............L.................FEM...T...FKSFKTNTQLKAKEMWYDWKL..QL..M..QTIKP..DVEGMLEGM....QED.NDRLTALREQT.DSILPDLKARQA...ALQAELEKERQ...........IVAEIAE.............CD.QQELASLK.EGIA....EQG....AQIN..I...........F...........G.SELEESTTKL.AALS...SK...LEELN.STKRECV.NAIQHAK...S---.....Q.CD....QF..T.KS.DAI.RLR....................E.....EYNSIQHLHL.WRPIK.IH......................ANL..LELEF...DNE...I.SLTFNCSN.........................................................................................
A0A095CFF1_CRYGR/600-906               ..........................................EQLQDISLAAFLEIAGVQF..ME.Gl..................pGLN...RKR..SSVAKEILGHs.....................yANERDFALHEYTEAQVNSI-FLNMYTWASNKLFQDIQT.GDEEIAAV....SA.RC.....DID..S....PPVIQ.....EYL............AA..............S..D.ED...KQ............L.................FEM...T...FKSFKTNTHLKAKEMWYDWMW..QL..L..ETIKP..DVETVLMGM....KEV.G--L-KSVQQA.AVLLPQLRARKT...EVETKLVKERK...........AVAEIES.............CD.QAELAAYK.EAIA....EQS....AQIT..N...........F...........S.SEVADLKDEL.AALT...GK...LEELN.AKKHEYE.TAIAHAK...G---.....Q.CD....QF..T.RS.DAI.RLQ....................E.....ERISLQHLHL.WRPNK.IR......................PER..MELSY...DEE...I.LLSINCAN.........................................................................................
S8AG75_DACHA/1000-1313                 .........................................a-DVPKMAMKEFLNMVGISF..MD.Gi..................tSTR...HRR..QTGAILGLGV......................eMPDEEISIADQINGQLTIRPFLELYEHLQRELKRSNKE.GKEMFKQI....EK.MV.....LEE..N....PRLFR.....EYV............LA..............P..P.DV...RA............V.................MDL...Q...FKNIKSSSRLEARGDWYTWRR..GL..Q..ETIMA..KAQENLTAL....KED.GKVIEKQREIV.DSLEPVLTTKHK...ELTEKVETLRM...........RKEEIEG.............SD.PKELEEKR.AALV....ISK....KKLE..E...........K...........K.AELEKMLKMS.EELE...GE...VKGRE.ERRERCL.SAIEDAE...KVAE.....A.NK....GH..T.EE.EVV.GSI....................E.....RVRELQEKTG.WMLKK.AE......................SPF.fLVMVY...KKT...L.QVRFNAQ-q........................................................................................
A0A0K3C8R8_RHOTO/782-1119              .......................................lpd------SLDAFLVATGTHF..AD.Deffev..........vnsesTAA...KRR..KSMAATARTDededde...........tkqmggAKAVEPTFADMTVAAAVKSLFHQLYKSEQGGLLEGINQ.ARQMLEDS....EQ.RL.....RSG.vV....PQVFK.....DWA............NA..............T..D.EA...KA............I.................MKT...Q...FGQIKLNYLLSNKLEWKTRRI..QN..Y..DQVVD..IMAQNLQFI....QQD.RAVLTEVQSQF.EGVIPSLEARHA...ALLADLTAERS...........LDAELSL.............MS.PEDVEMRE.NMLA....DSE....EQEE..QlngnpdkgipgR...........R.PELDRIEQHL.RSYR...ET...FEKYS.TEEQHLQ.AEIADLE...ERRR.....D.KR....--..T.KT.DLV.RLQ....................A.....EFEALQHLQG.WRLEQ.FS......................TQH..LALRH...CDE...F.LVGFE---li.......................................................................................
F4PTN4_CAVFA/1005-1224                 ........................................ah----TITFNEFLYLANCRF..MD.Dystkskr......pslggllS--...---..---------Nnnnnnttvdq...smtetipatvVDDESTTLKNQLVHAYIYHRMSDVLKAGYEELKKMMAQ.TNESNREK....EE.QM.....NTT..N....PSIFA.....IIQ............RA..............T..K.DG...LL............A.................KQN...L...LKKIKINSKLNTQLQYIQWRR..DL..E..RKIGR..ELTESRDSL....SSD.LETLITRAKSF.KEVEMSLLSDGH...KLKDVERQLEA...........NQTR---.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------wsqklvdkgk...............................................................................
H6BNJ3_EXODN/1040-1361                 .........................................n-EQEKISLQEFLNMTNIHF..IE.L....................STT...KRR..HTMAQTMPPRe....................sqEGLDANPTEATFVAAATTLPLLELYQHATRELKSYIST.GRKIIRTI....EA.ET.....LAE..Q....PPLFR.....EYL............DA..............R..P.DV...RV............V.................MDN...Q...FRNGKANARLQSKEGWYQWRG..QL..V..DGLRV..GLEDINQGI....TAD.MALLDQQKEVL.DKVLPQLIHEQS...QLEKQKASLKQ...........KLEELDS.............VD.QGALNECR.RQLR....VAD....DYYL..Q...........R...........S.ALLDTLREQM.KEKD...EA...LASAK.ELKVEMN.DQIAEAD...RVRE.....E.HK....GW..R.AA.DVL.AAK....................S.....RVDDVEKRTG.WRLLT.AEeetd.............epndcGPA..LTMVY...KDV...L.RLFFYPQ-a........................................................................................
A0A1X0Q9M0_9MICR/173-377               ..................................nvdqlgds-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................--I...N...FKKLRNESRNQAKQNWYDYRI..VQ..E..ENLGN..RLEESKNKLleiiEEK.RTILEAKKE--.--ECELLENKNK...FLSEKNIKLKE..........sVIDENEE.............EL.QNKVEELR.NRLY....EHK....SLLG..L...........Y...........K.SDLSRIKNQA.EEKR...SK...EEKIA.KEIGFYK.SEIEELK...SIIT.....I.KK....-A..D.KN.TVE.ALK....................E.....EVKNYETYYG.LKFIK.IS......................SDV..LVFKY...LD-...-.--------iqiscvle.................................................................................
A0A180GZ33_PUCT1/881-1208              ........................................ll-----ISLNEFFEQAEIRF..IS.Lsq................prV--...---..RNYDQQEHPNl....................seGQHRVSSFAQQIFAGMVKIPRLRLLESSSRSLRQKTEL.LDYTTKEH....EG.EI.....SRNaqK....YKLLK.....DWV............EL..............R..Q.KQ...TQtgqshpqtaqknLed............lnqMMG...Q...LRLKKNLVEMSAKQDCHLFDI..EM..W..KTYQA..NLHQRTAKL....SHD.LEVMRKIDSVV.KPSTESLRERKQ...NLIEEIRRRKQ...........KLAEIES.............CD.QNQLKALN.EEAK....DLA....AETE..A...........N...........R.RALTESEFER.NLWL...AK...FAELE.QEKNEHL.QRIEQLK...RDPD.....Q.SQ....EC..T.VP.ELL.RLK....................N.....EFLAIQKMLG.WELVR.FE......................DDL..FVFIF...YST...I.GVNLHL--dp.......................................................................................
A0A225ASF9_9EURO/989-1312              .........................................a-NWEPIQLQDFLNLTNIHF..ME.L....................TTT...KRR..HTTVPGNDKTmdvt...............gsrePERRNITFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EE.ET.....LAE..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....KAD.DALLSQQESIL.QDVVPELVARRS...VLNSEATKLQE...........IVDEMES.............CD.PEELRMAR.ERLS....NVN....AEIA..R...........K...........R.RQLEEMQENL.QDKT...DT...IEAGT.ELKMEFM.EQIREAE...RVRE.....E.CR....GW..S.VK.EVN.ALK....................D.....SVKMLEMQTG.WSIVS.ATnkf................ertGPG..LTLKY...KEE...L.EVKFYPK-l........................................................................................
A0A0C3CWU5_HEBCY/774-1085              .........................................d-DTPAISVAQFFSMTGIKF..MD.E....................VTA...PRR..SMHPSQQPIRh.....................pRNLADIPLAEYVTAMAIDIPQLDLYSRVSKDLEAWMAK.SEIVFAQA....EE.EA.....AKL..T....PELFV.....EYA............RA..............D..E.EG...QA............E.................LLH...Q...LKLIRTHTRYLARSDWYDWKL..QW..V..EGLRV..TADDAFASL....END.ARALEEPKKLI.VDVIPELEREYE...ELMRELEKEQA...........EVKEIED.............GD.QDYLNELK.ATIA....EQN....IEIE..A...........L...........K.AELSEGTDQV.RWLQ...ER...MEEIE.AQKREAK.NTISTAE...RVLR.....M.KQ....TS..T.RS.EVF.RLK....................G.....ELEALEDLHM.FRITK.VN......................SNL..FEYVY...SSL...F.QVSIPCKN.........................................................................................
A0A0C3NQX5_PISTI/1-301                 ..........................................-------------MTGIRF..MD.E....................ITA...PRR..QSIHPSTLRPsr...................raSVDGQIPLAEYMVAMAVDVPQLELYTHVSKDLQAWIER.IQSIYREA....EE.EA.....LEM..T....PQLFQ.....EFI............SA..............D..E.TG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKL..QW..V..EQLDQ..KASKGFEHL....EKD.AKFLEGVIHEA.QSILPGLQQEHD...QLVEELEKETA...........EIVELEA.............CD.QDYLKELK.ASIS....EQG....TELD..N...........Y...........R.REVEEAKAKL.SRIE...EK...LKEVQ.TEKAEVS.TSIEKTE...RLIN.....V.QK....NS..T.HA.EVF.RLK....................G.....ELETLQRLHM.VEITK.VE......................DDL..FKFAY...AST...Y.EVSATC--tl.......................................................................................
A0A086T3C9_ACRC1/951-1264              .........................................a-EEGHIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTAAPSSFVNgt...................ltDGDEDVSLERCVVAGACTVPTLELYQHSCRELKKYISE.GRRIVREI....ET.DT.....FEE..N....PPLFR.....EYM............TA..............T..P.EV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLIKISQGM....DSD.EKLLQKQQELL.ASVMPGLVSRYE...ALLEESTNLEE...........AAREIAD.............SD.PAQLQASR.AELT....DLD....SDIA..R...........K...........K.KLIAELRQEF.EEAE...AD...VESLS.TRKQTCL.ADIRESD...KIRE.....E.CR....GW..T.SA.EIS.AFK....................E.....RVDAIEREHG.WAVTG.IS......................DTT..LSMTY...KRD...I.ELVFDAS-s........................................................................................
A0A060SMZ6_PYCCI/1092-1192             ........................................re-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....--D....TEIE..A...........F...........R.ADVSEAKAKL.ERLD...EK...LAEIE.AQKEEAT.TAIAQAK...HVIH.....I.QK....ES..T.SS.EVF.RLK....................D.....ELEALQDLHL.WQPLK.HT......................ADL..VDFVY...ASK...Y.HVSLPCR-k........................................................................................
A0A2H3FDR9_9HELO/1063-1372             ........................................dd----RIQLQEFLSMTSIRF..ME.L....................TTT...KRR..HTIAPRSATKa.....................iGEDKHISLEECVAAGAVTIPMLELFQHACQELKRYISE.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............T..P.EM...KV............V.................MDN...Q...LKNVKTHARLLSKGMWYDWRM..TL..L..GTVKE..GLFKTAEGM....IED.EEILDHQQELL.ETALPELIQRAE...QLRREEADLQY...........AAKEIAN.............CD.QEELSDAR.QQLI....AVD....ADVE..A...........K...........K.RLIADLRRQL.QGKE...SE...IEAGN.ERKQVCL.EEIREAE...RIRE.....E.CR....GW..T.SS.EIS.ALK....................E.....KVDAIEEKYG.WTITG.VS......................GTT..TSMTY...LKD...I.ELVFDAS-s........................................................................................
A0A165MEJ6_9APHY/883-1206              .........................................d-EEPPISIEQFFDMTGIRF..MD.El..................tMPK...PRQ..SVVPPAHLRArsrrrs...........saefseSEEDPIPLAEFSVAMAAELPRLELFTAVANDLSAWIEE.SKKICVEA....ER.ET.....EKV..T....PELFR.....DFV............AA..............D..E.SE...KG............L.................LIH...Q...LKLIKAHNYGAAKSQWYDWKM..DW..T..QRLHA..RARQEFTNL....ESD.AQALARIIKQA.QATLPDLREEYA...QVMAELEQEQA...........DIAEIEN.............SD.QDYLSELK.ATIA....EQS....SELE..V...........F...........R.TDVSESRAKL.DRLN...EK...LSEIE.SQKQEAT.AAIAKAR...YNVH.....I.QK....ES..T.TS.AVF.RLK....................D.....ELEALQDLHL.WRATK.IS......................PDF..IQLVY...ASR...Y.EVSIPC--ir.......................................................................................
A0A084QP57_STAC4/964-1277              .........................................t-DENRIHLQDFLDMTSIRF..ME.L....................NTT...KRR..HTVAPGSLKDgs...................lfDGQDDLSLERCVVAGACTVPMLELYQHSCRELKKYIAE.GRNMVKEI....EM.ET.....FQE..N....PHLFK.....EYM............SA..............T..P.EV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLRE..GLVKIAQGM....EED.EKLLQEQQDIL.NSVMPALTSRFE...QLFEESQLLEE...........AARELAD.............CD.PEELQANR.EELM....ALD....EDIE..Q...........K...........K.RLIEELRAEF.DVSE...AS...VKDLR.IQKEQCL.ADIEDSE...KIRE.....E.CR....GW..T.ST.EVN.TLK....................A.....RVDAFEKEHG.WSVTG.VA......................GST..LSMAY...KHE...I.ELVFDIA-s........................................................................................
E2LY56_MONPE/1-104                     ..........................................-------------MTGIKF..MD.E....................LTA...PRK..SIHPSQLKRQ......................pRPPAEIPLAEYAVAMGIDVPQLTLYSRVSKDLESWMEQ.SKVIFEQA....EE.EA.....AKM..T....PELFV.....EYS............RV..............D..E.EG...QQ............E.................LLV...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------rlpf.....................................................................................
Q754X4_ASHGO/438-746                   .........................................e-PVEPISLQMFLDTTGISF.vID.L....................DGV...QNY..DPITFTYTDR.......................--IEDISTRQIYDALYLQIPLLEIYAFIVKELHRRILD.SQRLFQEL....EE.QI.....SNN.pP....PYLFR.....NYF............ES..............S..D.EV...KQ............L.................MKE...Q...IVLIKSFARLEAKKVWFEWRC..QH..L..KGIKS..VLEENLSLV....QTE.YAEVVARLNEI.SDIKHRLQALEQ...SLRHELELLRN...........GEKPMRVt..........tlAD.RLKIEKIK.SELK....ANM....IKLN..-...........-...........-.-NTANLEEQK.EAIS...AD...INALR.SQIKDVR.EEISSLK...SLVL.....K.NK....LH..T.AH.DVS.KLR....................L.....LFSQMQLFTG.VSFRG.LS......................GSE..LQLAL...NST...I.NVSFDLTQ.........................................................................................
E7KNE7_YEASL/449-760                   ........................................pt---QDYTLXEFINEVGVGF..LD.T...................kLID...DLD..KKVNFPLNSF.......................NFVENQRIDNVFSAFYIDIPILEVEAFRCKELWRSINE.SKDKFKDF....EA.QI.....DKS.hP....PLLLQ.....EYF............SS..............D..E.KM...KQ............L.................MRD...Q...LQLVKGYSKLEAAMEWYEWRK..KQ..L..NGLEL..ILAENLNTL....KRE.YEKLNEEVEKV.NSIRGKIRKLNE...AIKEEIRSLKN...........LPSDSYKp..........tlMN.RXKIEAFK.QELM....EHS....ISLS..-...........-...........-.-SSNDFTQEM.RSLK...LA...IAKKS.NDILTLR.SEVASID...KKIE.....K.RK....LF..T.RF.DLP.KLR....................D.....TLKILESLTG.VRFLK.FS......................KAT..LSIAF...LQLd.dL.RVDINLA-n........................................................................................
A0A0G2EQW7_9EURO/1044-1367             ........................................ve---EKIHLQDFLNMTNIHF..ME.L....................NTT...KRR..HTIAPGASDHtfp.................tvgPANNSACLPECVTAATTTLPLLELYQHACRELKSYISS.GRRIIRSI....EQ.ET.....FDE..Q....PPLFR.....EYL............DA..............R..P.DV...KM............V.................MDN...Q...FRNGKVNARLQSKAGWYAWRS..QL..V..DGLKG..GLDGIKAGM....IED.STEIGKQKEML.DSILPGLEQRQS...QLESEDQHLTK...........RKDDLDN.............ED.HEALREAR.TRLA....RLS....KEMK..E...........K...........N.DILIELRAKA.NAKE...SE...LSQAA.EDRAEFE.AQIAEAE...RVQE.....E.CR....GL..S.LK.DVK.SAK....................D.....IIEDIVKRTG.WKILS.AEeded.............yveahGPA..LTMCF...QDS...L.RLFFFP--aa.......................................................................................
A0A167FY55_9ASCO/492-798               ........................................td---NNISLNEFLSMISIDF..MD.K...................fLSN...SRG..HSSFGIPEEA.......................--VEGATEEDYWVASQ-KLPLLNMYDFGSHELKNDIKN.AKEFFTQW....EE.SV.....LED..N....PVLFQ.....EYV............DA..............S..A.DT...KQ............I.................MKS...Q...FLLLKNFSRQQAKGAWYEWRR..QL..T..NGLNK..DLEKNRELL....AKD.IEILHEKRTIS.ELANREAQARHE...KLSGDIQNMKK...........QLSELAN.............YN.KEELIDRR.QQVE....SAK....KNAI..Q...........Q...........R.KTAEELRNRR.ESVI...AK...IEKLR.SEKQTLH.DHVKEAE...QVLK.....A.NK....IV..D.NK.EMH.ALE....................S.....NYKWLSQCVG.LSSSE.LK......................EDV..LSLQF...VNG...L.ALEVNI--vt.......................................................................................
L8X3M3_THACA/1259-1505                 .........................................d-------------------..--.-....................---...---..----------.......................------------------------YITAAKELKEYISN.GKKAIRIL....EE.DL.....DAN..N....PYLFK.....EYL............AS..............G..E.ED...RR............A.................LEE...T...LGGHKEAMRMRSKMSWYKWRH..NF..V..TEMQA..TADRETELL....QQD.LDSLRAVGTQL.TEPIPSLREQHA...KLKAQLAAERA...........AVEAAKD.............CD.PEIMSELK.VGIA....EQS....AQIE..S...........Y...........K.TDIQSSTVKL.EKLK...AK...LGEAE.GDKQALQ.DQIRVHQ...EKLD.....-.-A....LH..P.TV.EIV.NLR....................E.....EFEKLQRLHL.WHAVK.LE......................EKF..IELRY...DDH...Y.RVQMDC--va.......................................................................................
A0A179FNQ0_METCM/917-1230              .........................................v-DDEKIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTAAPNNFQDgs...................sgDGEDDMSLERCVVAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....EE.ET.....LEV..N....PPLFR.....EYM............SA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLRE..GLVTISRGM....DAD.ERMLTEREALL.AEVLPGVAERYH...QLEEESGNLDE...........AAKELAD.............CD.PGELQAAR.DELT....DLD....ADIE..D...........K...........K.RLIAELGKQF.ESSS...SE...ADNLS.AKKEDLM.AAIRQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................A.....RVDAIEKDHG.WAVTG.LS......................GTN..LSMAY...KRE...I.EIVFDIA-s........................................................................................
M1VIS4_CYAM1/705-1011                  ......................................navf--------KDFLYAAGVRF..LD.D....................LST...RRR..ITSFGVPSNR.......................ICVQPDSLEQHIRVACITVALLGAFQYSCEVLASENGK.LATEIAKA....EE.EF.....RTRwlF....TRLIE....lHFS............GS..............E..P.NL...LT............R.................YQL...Q...LKRLKNVGRLRARCEWYLWRA..RH..E..QRIQV..QLRAQQENL....QND.LAQLCGLAENL.RATISAATE--D...AITSGLGQLST...........DPKLVHE.............RN.LHNQNTLR.-HVE....ERD....AQIQ..E...........T...........R.SRLEQLHHEL.NRLS...EH...KAQLA.TECLALR.TRHQELQ...AKAR.....L.GD....AA..S.CSlMLA.EQQ....................D.....SFDILVSLTA.CRPIS.IS......................NDT..LCVRV...GST...V.DIR-----csfvq....................................................................................
A0A136J1V3_9PEZI/228-540               .........................................d-DGSRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPQTTRDs....................fvASKEDVSLERRVVAGACTVPMLELYQHSCRELKKYISE.GRRIIREI....ET.ET.....LEE..N....PPLFQ.....EYM............NA..............T..P.DF...KV............V.................MDN...Q...FKNVKTHARLLSKAMWYEWRS..QL..Q..DGLKE..GLIRIGEGM....DND.EKVLNKEQKLL.DAVLPGLQKQLE...SLDAEHKTLRL...........AADELAD.............CD.PEDLEAAR.DELE....GLG....EDVE..T...........K...........M.ARIEALKAQL.AQTE...TS...ISDCA.QRRAECL.ADIEASE...KVRE.....E.CR....GW..T.AG.EVS.ALK....................A.....EVDSLERTYG.WAITG.IA......................GST..VSLTY...LKE...I.ELVFDVS-a........................................................................................
A0A0E9NPH0_9ASCO/808-1115              .......................................pte---KNISLSNFLDMTGISF..LDgL....................TTT...RRR..ETIAIPQSMM.......................---KEPQDVDYIKASLVTLPMLELFQHCCKELKTSITD.GQEAVKEI....EQ.DT.....LED..N....PLLFQ.....EYL............NA..............A..S.DV...RA............I.................MDS...Q...FKLIKTNARLKAKGVWYEWRD..KL..V..QGVLE..DMQKKMESL....EQD.EKTLVHAKEEL.TPILAQLKARHA...EVKKKLENKRA...........KKQAIEE.............SN.QEELKKVR.ERIT....ELD....EEIK..E...........R...........R.AQLEAEEKEK.EEAD...RK...LAKVE.EQTADAK.RRITAAE...KTIE.....E.NR....GL..D.AN.EIE.DLK....................E.....QVTGLEQQSG.WKVTL.IR......................SNT..IAIEH...VEE...L.RCHIHMK-d........................................................................................
A0A1G4JDW3_9SACH/465-774               .........................................s--QNPISLLQFLTASGMAFrpFE.D....................-LS...AEK..FAVKFEYISP.......................-ESKQPTLATYISLHA-QMPILEIYAFCCKELLRRTAQ.SKKAFDEL....EE.HF.....KSN.tV....PLLFT.....SLI............NS..............S..D.AR...RT............G.................MLE...K...MKLVQQASKLQARKVWFEWRA..QH..L..KGIKS..VLDENLFTL....KEE.LKEVDRIKDKT.SNVRHRLGLLKR...ALMREFQVSRK...........-SREFRDgr........pslEK.RLEIERIK.KEFE....RHS....IQVH..-...........-...........-.-DGPMFSGDK.KLLG...DN...INSLS.TKLSKIK.EEINVLR...RNRE.....P.NE....VS..K.TN.DLA.RLN....................L.....LFDLIEKLSG.FKLVN.WS......................DKT..ISVRS...LQC..gI.TFNFN---lek......................................................................................
A0A067NTX7_PLEOS/773-1081              .........................................d-NLPSISIAEFFQLTGIKF..ME.E....................LTA...PRR..SMSQPGRPER.......................-QTADIPLAEYAIATTVDLPQLSLYTRVASDLDAWMKK.SKVVMQET....EE.EA.....AKV..V....PELFA.....EYL............SA..............D..E.EG...KD............Q.................LRH...Q...LNLIRTNVREMAKGEWYNWKL..QW..I..EGLKE..IASSGLEDL....QAD.AEVLGQITSRA.EEMLPSLEQEYE...KIMAELEQEQA...........EVDEILA.............SD.QGYLNELK.ASIA....EQE....VEVD..A...........L...........R.AELSENKQQL.ARLQ...ER...YAETQ.KEQRESE.SAISTAK...RLLH.....V.QE....SS..T.LS.EIM.RLK....................D.....ELEAMEDLHM.FHATK.VS......................HNL..FEYVY...ASR...Y.QISIPCNN.........................................................................................
A0A135L887_PENPA/964-1290              .........................................v-EIESIKLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrr.............sgesiPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVDEM....KAD.DDLLSEREGLL.NRNVPLLVEKHA...SLEQEATNLQQ...........LVDEMEN.............CD.QDELRSTR.NKLS....EVE....SEIA..T...........K...........R.QELEQLQKEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQQTG.WSIVS.AStps...............dapkGPL..LKMGY...RDQ...L.QLEFYPG-a........................................................................................
A0A166AWE7_9HOMO/1-296                 ..........................................-------------MTGIRF..MD.E....................IVA...PRR..QSMAHPARPS.......................-SDTEADLAAYVVAMAIDVPQLELYTYVARDLEAWIVR.SRDIFAEA....EV.EA.....ARD..M....PELFR.....EFV............GA..............P..E.DG...QA............E.................LLH...Q...LKLIKANTQASARGEWYDWKL..QW..V..EQLFG..KADKAFADL....TAD.AEALEKINGQG.QMLLPQLREEYE...QVMRELEAEQA...........CVAEIES.............CD.QKYLSELK.AEIA....VQD....AQLE..A...........F...........Q.GEVDDGNAKL.GRLQ...EK...LDELA.SEKQEAT.AAIERAE...RLIH.....I.QK....NS..T.NA.DVF.RLK....................D.....ELESLQNLHL.WHAVK.IQ......................SDL..LELIY...AST...Y.RVSIPC--mk.......................................................................................
K1VDD9_TRIAC/882-1186                  .......................................aas---GPVSLSEFLETVGVRF..LD.Dln................phVHQ...PRR..SSVAPRGTLS.......................--AGEDTLSSFTVANA-ETIYVNMYDYGIDRMSSELAK.SQEEIASS....TR.VC.....DAD..N....PAVMR.....EYY............DS..............P..P.EE...RA............L.................YES...T...LRNFKAKALLQAQGEWYSWRL..DV..I..ERILP..DFTAIHTAM....AEE.VEQHAVNHEVA.DTLLPDLAERHA...SLTVELEENKK...........QVAEILE.............SD.PTELADLK.AAVV....EQG....EEIT..R...........F...........E.SELAQKSAQL.GELE...KE...VAELE.RQEQEHT.AALAVAK...GMCD.....-.--....EY..T.SS.DIR.RLQ....................S.....ELSAMQALHG.WRIVK.TQ......................--P..FEAVY...ANE...L.LLKLD---ge.......................................................................................
A0A0J8RFL7_COCIT/132-455               .........................................t-EFKPLQLSEFLKMTNIHF..ME.L....................NTT...KRR..HTIAPDAEKRrit................evdgQVTENISLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLDHHVEEM....NRD.SEALSKKEKLL.DDVVPELVNKHA...RLQVDAHNLEK...........AVEEMKN.............CD.QEELKQAR.ERLR....MID....LEIA..Q...........R...........K.EDLNKAQSDL.EKTS...NI...VKKGT.EQKAKLL.KDIQEAE...SILE.....E.CR....GW..S.VN.EVD.SLK....................A.....VVRNLEKSSG.WTIIS.VSsgs...............gtkyGPA..LSMRY...SNE...L.RLDFHPA-a........................................................................................
A0A284RB98_9AGAR/734-1045              .........................................d-EGPPISIQQFFEMTNIKF..MD.D....................LTA...PRR..SMHPSQLASRq.....................pRNPADIRQAEYTIAVAIDIPQLLLYSRVSSDLQAWMQQ.SKSVFVEA....EE.EA.....AKM..T....PELFI.....EFS............RA..............D..E.EG...QA............E.................LLH...Q...LNLIRTNTRAQAKSDWYEWKL..QW..I..EGLRV..TAEQALSEL....ETD.AKTLAGLRAHA.DDIVPALQQEYD...SIMRELQQEQA...........EVAEIEQ.............CD.QEYLNELK.SSIA....EQN....LEVD..A...........L...........K.TEVSEGNEQL.KWLG...ER...LEEIE.LQRRQAN.TAISEAN...RILH.....M.QT....HS..T.EA.EVF.RLR....................S.....ELEALEDMHM.LHVAK.VD......................SQL..FEYVY...ASQ...F.RVSIPCV-n........................................................................................
W7HNE2_9PEZI/975-1288                  .......................................att---PNLAMKDFLGMIGISF..MD.Gi..................tSTR...HRR..QTGAILGLGM......................eLPDEDIPIADQINGQLTIRPFLELYEHLQRELKRSNKE.GKEMFKQI....EK.MV.....LEE..N....PRLFR.....EYV............LA..............P..P.DV...RS............V.................MDL...Q...FKNIKTSSRLEARRDWYTWRQ..GL..Q..ETLKA..KTEENLAAL....KED.ERILEKQRQIV.DTLQPTLTARHR...ELEERAETLKA...........RKEDIES.............CD.PKELDEKR.ETLR....ASK....KKLE..E...........K...........K.KELEEATKAA.EQLE...TE...VSARE.ARKAKCL.SAIESAE...KVAE.....A.NK....GY..T.EE.EVM.ASI....................E.....RVRKLEEKTG.WMLKH.AE......................SPF.yLDMSY...KGA...V.EVRFNAH-d........................................................................................
A0A0D2I3V8_9EURO/1066-1387             .........................................n-EREKISLQQFLNMTNIHF..IE.L....................STT...KRR..HTIAQSLPIKe....................svEGAHSNGTKANFVAAATTLPLLELYQHATRELKSYIST.GRKIIRSI....EV.ET.....LAE..Q....PPLFR.....EYV............DA..............R..P.DV...KM............V.................MDN...Q...FRNGKANARLQSKEGWYQWRA..QL..V..EGLKT..GLEGINQGM....NAD.LDLLQKQQHLL.DDVMPKLLHEHS...ALQHQSASLQQ...........SLAELDS.............VD.HEALNHCR.RQLQ....KAD....EYYL..Q...........R...........S.ALLDMLQQQI.NEKD...EA...LVAAA.ELKTEMK.DQIAEAD...RVRE.....E.NK....GW..P.VA.DVL.VLK....................S.....KVKGIEEQTG.WQLVT.AEgavd.............ehdefGPA..LTMSY...KGD...L.RLFFYPQ-a........................................................................................
A0A074WLP9_9PEZI/669-982               .......................................ppa---RRVQLNEFLDLAGIKF..MD.L....................TAS...KRR..HTVAPTPSEPhg...................adGEDQSIDLEGAVVAGACTMPMLDLFQHACRELKKYISE.GKSFLKTL....EA.EV.....YDD..P....PPFFQ.....AYM............NA..............T..S.ER...KS............Q.................LDG...N...MRDAKTNARMKSKEIWYDWRS..KL..L..DGLSD..GLDRIQTGL....DAD.AEVLGQKQESL.DSVLPDLLQHYE...GLLKQAEQLEQ...........AAAAISE.............EE.KEELRASR.ARLV....EVD....EQIE..E...........R...........K.RMLASLQRDV.DEQD...KL...AEAYE.ESKIESL.AAIQEAE...RVKE.....S.CR....GF..T.ID.EVQ.SLK....................A.....SVAQLEKQSG.WAIAS.AS......................GTN..LTMSY...ANT...L.QLYFNTT-s........................................................................................
J4H1T4_9APHY/865-1189                  .........................................d-EGPPISIEQFFAMTGIRF..MD.El..................tMPK...PRQ..SIAPPPQLRSrsrrrs..........stelsteLEDDPVPLAEFAVTMAVDLPRLELFTAVANDLGAWIED.SKKICLQA....EK.ET.....DKV..T....PELFR.....DFV............SA..............D..D.SE...KA............L.................LIH...Q...LKLIKANNYGTAKSQWYDWKM..DW..T..ERLYG..RAQQAFSNL....ESD.AQTLAKIVKQA.QENLPDLRQEYA...QVMAELEREQA...........NIAEIEN.............SD.QDYLNELK.ATIS....EQS....TELE..I...........Y...........R.TDVSEGRLKL.ERME...EK...LAEIE.EQKRETS.HAIAQAQ...HVIH.....I.QK....ES..T.SV.EVF.RLK....................D.....ELEALQALHL.WQITT.IT......................ADV..IVLFY...NAS...Y.EVTVPC--vk.......................................................................................
A0A0S7DXD7_9EURO/1009-1298             .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASKraar...............lsaeSKAATASFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLYRHVDEM....KTD.GDLLTKYETLL.DGVVPSLVEKQS...ALQEEAANLQQ...........LTDEMES.............CD.QDELRNAR.EKLS....SLE....DEIE..L...........K...........K.KQLQELQGQV.QEKT...NS...LESGA.ELKAEFL.AQIQEAE...RVKE.....E.CH....GW..S.AK.EIS.ELK....................G.....K---------.-----.--......................---..-----...---...-.--------atrsfnim.................................................................................
A0A0D0BJ50_9HOMO/781-1094              ..........................................EDGPQISIEQFFEMTGIRF..MD.E....................IAA...PRR..STVHPSALRPsr...................rqSTESEIPLSEYVVAMAVDVPQLELYTHVSKDLQLWIER.IKGIYKEA....ED.EA.....LKM..T....PELFQ.....EFV............LA..............D..E.EG...QN............E.................LLH...Q...LKLIKVNKHAQAKSEWYDWKM..QW..V..EQLYE..KANQGFRDL....EAD.AKVLENIIRQT.QEVVPALNEEYE...SLLHELEQEQA...........DVAELES.............CD.QDYLNELK.TTIQ....EQS....VALE..A...........F...........R.ADVDEGKAKL.NRLQ...EK...LEEIE.AQKLETT.NAIQVAE...RQVQ.....V.QK....NS..T.HA.EVF.RLK....................D.....ELEAFQSLHM.LQVTK.VL......................PEL..FEFRY...ASS...Y.DVSVPCEN.........................................................................................
A0A2A9P666_9HYPO/968-1281              .........................................v-EEDKIHLQDFLNMISIRF..ME.L....................NTT...KRR..HTMAPGSGADgs...................taQGQDALSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....ED.ET.....LKE..N....PPLFR.....EYM............SA..............G..P.DV...KA............L.................MDH...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLVGVAEGM....KTD.DRVFKEQQDMV.ASVLPGLVSHYE...SLREESKKLQE...........AARELAD.............CD.PAELASAR.EELM....SLD....ADVA..T...........K...........K.QQIAQLRKQL.EDSS...TE...VHELG.SRKAECV.QAIEACE...RTKE.....R.YR....GW..T.GR.EVK.ALK....................A.....RVEAMEKKHG.WAISG.LS......................GSN..LSMTF...RRE...I.ELLIDV--gs.......................................................................................
C5GWX4_AJEDR/1038-1362                 .........................................p-QVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTLAPSSDNKkats...............krddEAVKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.DAVLSKKEDLL.DRVVPPLVEKHA...RLETEAQNLQR...........AVDELEN.............CD.KEELRQAR.ERLA....ALD....AEIS..A...........K...........R.KSLEQSQAEL.ENKK...SI...IKAGA.GLKDELL.AQIGEAE...RVTE.....E.CR....GW..S.IK.EVK.TLK....................A.....SVRELERQTG.WSILS.ASlkp...............sseyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A2B7X0W8_9EURO/1031-1355             .........................................p-QAEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTSENKkats...............kredEAVKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.DAVLSKKEDLL.DRVVPLLIEKHT...KLETEAQNLQR...........AVDELES.............CD.KEELRQAR.ERLA....TLD....AEIS..A...........K...........R.KLLEQSQAEL.ETKN...NI...IKTGA.GLKDELL.AHIDEAE...RVTE.....E.CR....GW..S.VK.EVK.TLK....................A.....SVRELERQTG.WSILS.ASlkp...............nskyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A135TMB5_9PEZI/1007-1337             .........................................d-AEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKD......................fGGKEDLSLENCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....AVD.DKVLQQQQKLL.SSVLPAIVSRFE...VLEQEHKNLRA...........VAEELAD.............CD.PEELETAR.FDLI....ALE....NDVQ..E...........K...........T.RRVEELRKQL.QEAE...QD...VEQLA.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALKgkffllypkkfdptktdmsaA.....RVDSLEKQHG.WAVTG.VS......................GST..VSMTY...RRE...I.ELVFDMA-s........................................................................................
A0A010S3F6_9PEZI/1008-1318             .........................................d-AEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFKD......................fGGKEDLSLENCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLRE..GLVRIAEGM....AVD.DKVLQQQQKLL.SSVLPAIVSRFE...VLEQEHKNLRA...........VAEELAD.............CD.PEELETAR.FDLA....ALD....NDVQ..E...........K...........T.RRVEELRQQL.QEAE...QD...VEQLA.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IS.EIS.ALK....................A.....RVDSLEKQHG.WAVTG.VS......................GST..VSMTY...RRE...I.ELVFDMA-s........................................................................................
A0A0C9YBS8_9AGAR/781-1092              .........................................d-DLPVISITQFFSMTGIKF..MD.E....................LTA...PRR..STHPSQQPTRq.....................aRNSSDIPLSEYVTAMAIDIPQLVLYSRVSKDLEAWMEK.SKTVFAQA....ED.EA.....SKV..T....PELFV.....EFS............RA..............D..E.DG...QA............E.................LLH...Q...LNLIRTNTRGLAKSDWYDWKL..QW..V..EGLRL..TGEKAFKAL....ESD.ARALEGLNALA.DDLVPVLEEEYE...AIMKDLEKEQV...........EVAEIEA.............CD.QDYLNELK.AEIA....EQN....IEVE..A...........L...........K.AEVIEGNDQH.AWLQ...QR...LKEAE.VDKQETL.AAIATAE...RLLH.....I.QK....NS..T.RS.EVF.RLK....................D.....ELEALEDLHM.FQITK.VK......................ANL..FEYVY...AST...F.HVSIPCRN.........................................................................................
A0A1V8UPS9_9PEZI/854-1170              ........................................qp--KQPVHLQEFLDAAGIRF..MD.L....................TTT...KRR..MTAMPTPSKNrk..................stdVLQPEVTLAAAVIAAACTEPEKELFSHACHELKRYIHE.GKGAIKEL....EA.ET.....FRE..T....PPLLQ.....AYM............SA..............G..S.SR...GA............V.................IDA...Q...LRDIKTHARLRSKEMWYGWRG..QL..L..EELMH..VLHGIAEGL....LRD.DEVLLEKEEII.AEVLPGLLEQRD...GLEVEAARLQE...........AANAVSP.............EE.KEELDAAR.ERLV....EID....DELE..A...........K...........R.LLLQSLEEES.QALA...IT...EETLI.DARTEYT.AAIASAD...KVRD.....S.CR....SI..S.LD.EIT.ISQ....................S.....HIETLETTHH.WSITS.ASp....................hPTT..LTMTY...AST...L.QLFFHPT-a........................................................................................
B8MW87_ASPFN/203-526                   .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSAAKrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLNRHVEEM....RGD.DELLSKHETLL.SGVVPALVEKHT...SLEEQATSLQQ...........LADEIEN.............CD.QDELRDAR.GKLS....SIE....EEIA..S...........K...........Q.KLLEELQAEA.QEKT...NI...IEAGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKIERQTG.WSIIS.ATsps...............sssaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
A0A1V6XRF1_PENNA/964-1290              .........................................v-EIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrl.............sgenmPKPGSITFGDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLLRHVEEM....KAD.DDLLAGREELL.NRNVPLLVEKHA...SLKQEATNLQQ...........LVDEMEN.............CD.QDELRSTR.AKLS....EVD....SEIA..A...........K...........R.RELEQLQEEV.KEKT...TF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CH....GW..S.AR.EIN.ELK....................A.....SVQRIQQQSG.WSIVS.AStps...............daskGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
M2SEL6_COCSN/754-1065                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPSAFHDv.....................eVEEKEESLDRFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RV............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKS..GLLHTMDGF....KRD.ESTLINQEQLL.DVVLPPLVEKKE...LLSTECKRLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....AELE..E...........K...........K.RLLAQLQKEL.ADKE...VR...IEAAK.SRKVECI.EEIKAAE...RMRE.....E.CR....GW..S.TS.EVS.NLK....................I.....QVAALEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYF----vpfa.....................................................................................
A0A1S8VVD9_9FUNG/815-924               ....................................pvkkit------TLKDFLMRTGIEY..MD.N...................lTTR...LRR..DTNAFQSN--.......................--NEGPTIHEYLKATCLYFPELEIYEFACHELTQSIGD.GKITMDAI....EE.DA.....AKN..T....PIIFF.....EFE............HG..............S..Q.EE...RD............E.................M--...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------ivi......................................................................................
W9CEY4_9HELO/1043-1358                 ........................................kd---ESIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKRVSDgpi................rnrlSDQTKVSLEDCVAAGAATIPMLELFQHACHELKKYISD.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............P..A.DM...KL............V.................MDN...Q...LKNVKTHSRLLSKGMWYEWRS..TL..L..ETVKD..ELVRSAEGM....IND.EEILDKQQALL.ESVLPKMIKQAQ...QLQHEEANLKT...........AAEEIAS.............CD.PEELNEAR.EQLI....SVE....ADVD..A...........K...........R.HMIEELQKQL.QARE...AE...IEVGT.ANKETYL.EEIREAE...KIRE.....E.CR....GW..S.SS.EIS.TLK....................A.....KVDAIEKKHG.WTITG.VS......................GTT..TSMTY...RKE...I.ELVFDAS-t........................................................................................
A0A0G4PVX5_PENCA/965-1290              ..........................................EEIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrp.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFN.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHVEEM....KAD.DDLLSEREELL.NRNVPLLVEKHG...SLEQEATNLQQ...........LVEEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..T...........K...........R.RELEKLQKEV.QEKT...TF...IETGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.DLK....................G.....SVQRIQQQTG.WSIVS.ASsps................daeGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
A0A0F8BQ91_CERFI/801-1108              .......................................egg---DRIHLHDFLNMTSIRF..ME.L....................NTT...KRR..HTIAPTKMDGs....................vmDFKADMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFR.....EYM............SA..............T..P.EF...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..YGIKE..GLLRIREGM....DDD.QALVEKQEGLV.ASVLPAAVEKQE...TLTKEKDNIEA...........FVKEISA.............CD.PQELQTAR.DDLA....NTT....DRIA..A...........K...........R.KEIENLKREL.EETE...AD...IASSI.EYKKECQ.EAIVEAE...RIRE.....E.CR....GW..S.TV.EIN.ALK....................A.....RVERLEKKHG.WAVSA.IT......................AA-..-----...---...-.--------wdkcravcddlri............................................................................
A0A1B9IL92_9TREE/602-912               .........................................e-QPQTISLASFLEMAGVQF..LE.Gl..................pGLN...RRR..SSVAKGILGQs....................ysGGDREFALHEYAEAQVNSI-FLNMYTWAANKLRDDIRN.GQTELDQC....EA.RC.....DED..S....PPVIQ.....EYI............SA..............S..D.ED...KQ............L.................FEL...A...FKSFKTNTQLKAKERWYDWKL..QL..M..QTIKP..DVEGMLQDM....QDD.NDRLTALQEQT.ESILPDLKARQA...ALQAELEKERE...........IVAEIAA.............CD.QQELAALK.EGIT....EQE....TQIN..V...........F...........S.SELEESTVKL.TALT...NK...LEELN.NTKTECV.TAIQHAK...S---.....Q.CD....QF..T.RS.DAI.RLK....................E.....EYNSLQHIHL.WRPTK.IS......................STL..LELEF...DNE...I.SLSFQCK-d........................................................................................
G4U802_NEUT9/944-1256                  .........................................d-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPGASRDs....................tsAEDKDVTFESCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVRDI....ET.ET.....FVE..N....PPLFK.....EYI............SA..............T..P.EL...KL............L.................MDN...Q...FKNVKSHARLLSKAMWYEWRM..KL..Q..EGLKE..GLFKISEGM....DKD.DELLRKQQELL.SSVLPSLTKRYG...ALERELENLEA...........VEKELED.............CD.PEDLEAAR.AELT....ELD....KTIA..E...........K...........S.KKIEELRQQV.EEHQ...TG...VQSLA.DQKQQCL.DDITAAD...KIRE.....E.CR....GW..S.LT.EIS.SLK....................A.....RVDELEEKSG.WAINK.IE......................ASV..MFMAY...KRE...I.ELAFDLA-s........................................................................................
C5FFX2_ARTOC/976-1298                  ........................................pp--VEAIKLSDFLGMTNIHF..ME.L....................TTT...KRR..HTIAPGSPDKrgi.................etlDGRKVFSLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............MA..............T..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHVDEM....KQD.DILLSKKEKIL.ARVVPGLVEKHA...KLEIDSQNLQK...........VVEEIEN.............CD.QEELRDVR.KKLL....DVK....TELS..G...........Q...........K.NKYEHARNRL.NEKG...SV...LEKDQ.ARKDELL.QQIRDAE...NIKE.....E.CR....GW..D.MK.EVR.ILQ....................A.....SVHGLEKQTG.WAVIS.AKpgk...............gavkGAT..LSMRY...SGE...L.RLDFDPE-h........................................................................................
A0A0B1PFS1_UNCNE/1070-1381             .........................................s-EDDRIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTILPKANSQn....................ngTGEKQISWEDCVATGAATIPMLELFQHACHELKRYISE.GRKTVREI....ET.ET.....WEE..N....PPLFR.....EYI............SA..............T..P.DL...KF............L.................MDN...Q...LKNVKTHSRLLSKGQWYDWRM..TL..H..GTLKE..GLAKSAEGM....VCD.EEILNHQQMLL.DSVLPSAILNAK...SLEEKINELQV...........AAQEIAN.............CN.KEELSAAR.QRLI....TVD....ENYE..Y...........K...........K.IRLVELQKQL.QKIE...TD...IVEKH.QYKQKLQ.KKIYDAE...KIKE.....E.CR....GW..T.VS.EIQ.IIK....................R.....RVEVIEELFG.WAITA.IS......................GSR..ISMTL...LKE...I.RLVFNI--l........................................................................................
S7ZNJ4_PENO1/979-1305                  .........................................e-SVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKrlsra.............sleskAKQGAITFDDRVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ES.ET.....YAD..N....PPLFR.....EYM............NA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..DGLKE..GLHRHVKDM....KAD.DEILSKRETLL.NGTVPPLVEKHA...SLQGEAESLQQ...........RIEEMEN.............CD.QDELQGAR.ETLL....SVE....EEIA..A...........K...........K.RELEELQAEA.QEKS...TI...IEDGN.ERRNQYL.AQIQEAE...RVKE.....E.CR....GW..I.AR.DIR.ELK....................A.....SVQKMEQQTG.WSILS.ASasa...............ksiiASR..LSMVY...RQQ...L.NLEFCPS-v........................................................................................
A0A197KGC1_9FUNG/799-1125              .........................................s-ELPPISLSQFLGLVGISF..LD.Q...................lYTS...TRR..RTIPHQSSS-.......................--SESYRSADLIKAKAIFTQELNSYREACRLLKQSIEK.TRAFCVEQ....EK.KV.....MES..N....PDYFR.....EFR............ES..............N..A.DT...KE............F.................MKD...R...LKLVKSHAKLDTSVQFSGLKS..EL..L..ERQQA..SLEEHLDKL....KKD.IANLGQLASEL.SKEKAKVTPRHA...ELKRIVEQATA...........RRRAYAQ.............CD.KEQLRMLT.EAVD....EQG....TQIE..H...........F...........K.SVNERKEKEL.AEVR...AR...VAQLR.LSEQTSK.ERVAAAE...KTIQ.....D.NQ....YV..R.PE.DVS.QAK....................A.....RLSIIQATHR.WEPLR.SSseslssaas...gsafmmakagSGI..LEFLY...DRA...V.VVVIDPS-k........................................................................................
A0A1S3HL39_LINUN/484-771               ........................................dg----KITVEDLMMMCGVTF..C-.-....................TKS...TRR..STMAPVSMAP.......................----PESLQEYLELGMIVQPELETMDWACNWLTQHIEK.LRSTVAQV....EE.RL.....NKN..N....PEIFE.....EVR............VA..............S..K.EE...MK............E.................LKS...K...IRALVLACRKNSKAKFKQWKG..KA..V..KTILE..ALQEEEDSI....QSC.LSELEEACTSL.DEQRVKLNEVDA...YITEQLRASENlq.......lpDEQDIQQ............yVDiVGNLNVEK.QVLE....EKQ....MEVN..E...........I...........T.KKKDALELEY.DVMH...KE...LGRIR.LEKKEMM.VPCSTSE...DLLA.....K.SQ....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------cldrmqrlnewiiediddyrakfswlyds............................................................
A0A250X5U7_9CHLO/652-985               ........................................ps--MPQISFQEFLQVVEVRF..LD.Dmrrras........llqpplV-D...---..---------Leqasst...........qdstqsLHTTTQSSAELLEALHVSGPRAVLSRKMVELLAERVEE.VQARVTQA....EA.AM.....AKS..N....PEVFA.....TVQ............RA..............D..T.SD...LA............R.................LRD...Q...MKLLKRVCRLRTMMSWKQQRI..QF..E..QELGL..AHRGGMSFL....QTE.LEVMEASLQTS.QKLEEDLQSLHF...TLAMQAQQQMS...........RRKALQD.............LK.HKHAAQMR.QLLE....LQA....SNKE..R...........S...........M.RKLA-VEEKL.KELR...AR...YESSL.QDK----.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------likqrhlqslqsqevlqltpsrgsrqapavvhtlmtqlmqqqehlqvlqgllgvqidargmrggrgfqlrimdqfsiqvdp........
S2JFU6_MUCC1/305-611                   .......................................din---QNMALSDFLSIVGIMF..PA.Ea.................paKAL...RRR..STYNVDYGVA.......................-----TDAEQGT-AAASTLPQLELYDTFCQKLNQFIRE.CKERIDQI....DE.DV.....STA..N....PQIFQ.....EYN............EG..............S..V.TA...RS............A.................MGV...K...LSAMKKYAWKKAASEFYKIWC..GT..L..KAFTE..ILHANHSKL....VQD.DEMLAQFQQDV.SIKMLDISAYLEsviQLRKEADLKEE...........---AYNR.............ID.HEALARSE.KEMA....QLK....TSIE..G...........F...........R.KQCNQLQDQE.SQLV...EK...IASLE.TRKQELV.DAIRLAD...RAVA.....N.NQ....CV..T.DR.DLA.YAS....................D.....KYERCSKINK.FRLAK.AP......................DNT..LEMSI...NGD...V.NIVID---qgk......................................................................................
W0TE42_KLUMD/385-694                   .........................................s-QVEPIALETFFEETGVKF..-D.V....................ENT...IDE..LKIKFSSTEE.......................--IETVPSNILHQALYYNIPILEIQAFTAKELNRRIIQ.SKMLLKSL....QD.QI.....ASN.aP....PRLIK.....EYF............DS..............D..K.EI...RN............I.................ADK...K...LQLVTIMSRLQSEKVWFEWRS..QH..L..KGIKT..VLEENMAIL....LDE.NAQIMKYMNEI.NDIKMRVSDIKH...VLLKEIDILGK...........HNESFDEtn.........eqVSvLLKVNKLK.EDLK....ENM....LKIA..-...........-...........-.-DLSKLTAKK.DQLT...DR...IQTIR.EQINKVN.EETHELQ...KELR.....H.NK....VC..T.SY.EVE.KLK....................R.....NFSLYQNISG.IKFKS.IR......................GSI..LTTSL...YNS..kI.TVSIYLS-k........................................................................................
A0A0C9US15_9HOMO/1-293                 ..........................................-------------------..MD.D....................LTC...PRR..STVHPSMMQRr.....................dSAEESYPLSAYAVAMSVDLAQLETMSWISNDIRSAIEK.YKAQYRET....EE.DA.....SKD..I....PLLFR.....EYI............TA..............S..E.EV...RD............E.................ILY...V...LKHIKANTILSAKGSWYEWKC..GW..V..KDLQQ..NAERTLENL....AAD.EQQLDDIAKRA.GKILPGLRQEYE...EIMRELQQEQA...........AVAEIEN.............CD.QAYLEELK.STIA....EQR....EALD..T...........F...........L.NEVADGETKL.VRLQ...ET...LEDLE.EQAGEAK.KAINSAQ...RQME.....V.QK....TS..T.RA.EVF.RLR....................D.....ELDTLQDIHL.WKATQ.LD......................QDL..VEFIY...DSK...Y.KVTIPCR-r........................................................................................
A0A0G2FYH0_9PEZI/691-916               ....................................ghqgsp-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....--E..N....PPLFR.....EYI............TA..............S..P.EF...KN............L.................MDN...Q...FKNVKTNARLLSKAMWYDWRM..KL..Q..DGLRE..GLAKIAEGM....TAD.EQLLDKQQKLL.SSILPAMMKQLD...TLTRECENLDA...........VASELED.............CD.PRELESAR.ADLT....AVE....DDIE..E...........K...........T.KEIARLREQF.KSSE...ER...VGQLV.EQKQRYN.ADIKEAE...KIRE.....E.CR....GW..S.ST.EIS.ALK....................A.....KVNAIEKQHG.WAITG.VV......................GTS..VSLSY...RHE...I.ELVFDT--am.......................................................................................
C5M8M1_CANTT/704-1003                  .........................................a-NYVPVTLSDFFNDIGVQF..YD.Dle................ldITS...ITR..SSMTGTTEV-.......................-----PTMEDYIKSRP-QLGLLELYEFCCQELNKNIIN.GREIYGDF....EK.NI.....EIN..N....PALFK.....KYY............KL..............D..E.KD...KL............L.................TNI...K...LQLIRDYARLQSKKTWYSWRS..QL..I..ESLIS..QLDVDIENM....ESD.KKRLTSAIEQV.NEMYDMARQNLI...QLQKKFNELIS...........SPTEGDS.............VP.VAELRKLK.DEVS....RAK....QDIL..N...........F...........N.IDRTEKEEEL.SDVK...GS...WNTSI.DSKSELQ.SNLQELQ...TFQE.....-.--....-V..D.NQ.ELR.NIF....................E.....KYKTIQELSE.LTH--.-D......................GSK..ITFMF...DKS...L.LVEFDFA-y........................................................................................
F9FXI3_FUSOF/988-1301                  .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................A.....RVDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A093Y7L9_9PEZI/1078-1393             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqIRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAQQQELL.DNVVPELVQKYE...TLLRQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FKIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0A1ML81_9FUNG/117-425               ..........................................EDSEQTTLADFLEMAGITF..PR.Q....................IPL...NDI..MPI---SIVD.......................VDYESPTIAEQAAAAAFTLPQIDMYDSISKQMHSLIDT.SQDVIQKV....ED.RV.....NRT..S....TEFFS.....DYL............RA..............N..A.ST...RI............T.................MEP...E...YRLTKQYAELKSLERWYEWCV..NI..F..VEHLG..TLKGHVNTL....TQD.RQTLASLEDEL.RGQLPKIVEYQQ...GISQLLAEAHE...........IEKEYRR.............FD.HKKLSRMR.DEIE....HQR....QTIE..L...........F...........N.KDLENLGAEE.AELF...ER...IDMLE.HRKSRLI.KDTVDAR...EISS.....M.NH....II..T.EN.DLN.LVR....................Q.....LYERSCNVGG.LRLLK.DNe....................dDDT..LEILV...AKC...L.VLTIHR--nd.......................................................................................
A0A0J6YH77_COCIT/995-1318              .........................................t-EFKPLQLSEFLKMTNIHF..ME.L....................NTT...KRR..HTIAPDAEKRrit................evdgQVTENISLEDCVAAGFCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLDHHVEEM....NRD.SEALSKKEKLL.DDVVPELVNKHA...RLQVDAHNLEK...........AVEEMKN.............CD.QEELKQAR.ERLR....MID....LEIA..Q...........R...........K.EDLNKAQSDL.EKTS...NI...VKKGT.EQKAKLL.KDIQEAE...SILE.....E.CR....GW..S.VN.EVD.SLK....................A.....VVRNLEKSSG.WTIIS.VSsgs...............gtkyGPA..LSMRY...SNE...L.RLDFHPA-a........................................................................................
A0A2H3IQE3_9EURO/963-1286              .........................................s-EWEPIQLQDFLNLTNIHF..ME.L....................TTT...KRR..HTTVAGNDRMadva...............gsraVQKGSVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....EE.ET.....LAD..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....HAD.DSLLSEQEAIL.HSVVPELVEKHA...LLDSEASRMQE...........IVDEMEN.............ID.PNELRMAR.ERLA....KVD....AEIE..T...........K...........K.RQLEEMQEDL.QNKN...DT...IEAGT.ELKAEFL.EQIREAE...RVRE.....E.CR....GW..S.IK.EVN.ALK....................D.....SVQMLEMQTG.WSIVS.AVntq................epsGPG..MTLRY...KDE...L.EVKFYPK-l........................................................................................
A0A194XUC1_9HELO/1048-1357             ........................................dd----RIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKAAAKe.....................gDSTKSVSLEDCVAAGAATIPMLELFQHACHELKRYISE.GRKTVREI....ET.ET.....FEE..N....PPLFR.....EYI............SA..............S..P.DI...KI............V.................MDN...Q...LKNVKTHARLLSKGQWYDWRM..TL..L..ATLKE..GLFKTAEGM....IQD.EETLDQQQELL.DTVLPHLIRQFE...QLQREEGELQY...........AADEIAN.............CD.QEELSNAR.QHLI....TLD....AEVE..A...........K...........K.QLIADLRRQV.QGKE...AE...IEAGT.ERKQAWE.EEIREAE...KIRE.....E.CR....GW..T.SS.EIS.ILK....................G.....KVDAIEKEHG.WTITG.VS......................GTT..TSMTY...QKE...I.ELVFDAS-s........................................................................................
A0A177UDN1_9BASI/360-533               ........................slapefeqtlretaaaeg-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----KNKNLR.DDWLPKLRALHA...QLKAKAQKESA...........RTEAIKS.............CD.PDELAGLH.QAIE....EQS....AFLS..E...........F...........R.QQKKRAAEQF.QRVQ...SR...LDEVL.DQKQTLV.DAISGAR...EVYQ.....S.IQ....GC..T.RG.EAA.RLL....................Q.....EVGHVQRLHL.WTVVR.LPeg.................kqrNGR..VELVY...DSA...L.ILQADL--ve.......................................................................................
I0Z2G3_COCSC/869-1150                  ......................................spmq--------QDFLKEVDLQF..LD.H....................M--...RRG..TSINFADLAS.......................-DPPPANLQDAYKLLFLTAPAVGEMEESIRTLRETIAS.AKETIADK....EA.LI.....GKH..N....PRLFQ.....TLQ............TS..............D..A.AE...VE............G.................IKA...G...VAVLKRVCRQRTTVAWKDWRH..SV..E..EQKRV..ALQDHQARL....KED.LAFLASALQQA.RQLKQAAATAAA...EALAAAQTHTA...........A-HRAEA.............ER.RQRLSALM.GSLQ....ALQ....LDNQ..G...........R...........A.ARKAASEQRL.SSLQ...AE...LRALR.EQRAALE.AARAADA...A---.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------aqagqsadnlseasaeaflskveemdilsgcvgwq......................................................
A0A094DA95_9PEZI/1020-1335             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqIRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAKQQELL.DDVVSELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FKIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A1V6S3H2_9EURO/967-1293              .........................................v-EIESIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrr.............sgenmPKPGSITFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFN.....EYI............TA..............P..P.DI...RV............I.................MDN...Q...FRNAKTHARLLSKATWYEWRM..KL..L..EGLKE..GLVRHVDEM....KAD.DDLLSEREEIL.NRNVPPLVEKHA...SLEQEATDLQQ...........LVDEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..T...........K...........K.RELERLQKEV.QEKS...SF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQKTG.WSIIS.AStap...............dsskGPL..LKMAY...RDQ...L.QLEFYP--va.......................................................................................
A0A0D1WXQ6_9EURO/1048-1369             ..........................................EEQERISLQDFLNMTNIHF..IE.L....................STT...KRR..QTMARISTVGq....................sdEGSHRDGMEAAFIAATTTLPLLELYQHATRELKSYIST.GRKIVRSI....EA.ET.....LAE..Q....PLLFR.....EYV............DA..............R..P.DV...KV............I.................MDN...Q...FRNGKANARLQSKEGWYQWRT..QL..V..QGLQT..GLEGISRNM....KDD.LESLCVQEQTL.DRVVPLILEHEE...ELEKQKQLLDQ...........TVKELDN.............VD.HEILDRAR.RDLR....AAD....AYHL..Q...........R...........A.ALLDSLRKDV.EEKE...EA...LASAA.ELKVEMM.EQIAEAD...RVTE.....E.HK....GW..P.AA.VVT.EFK....................T.....RIDSIENESG.WRLLT.AEedvd.............ecndfGVA..LTMVH...KGQ...L.RLFFYPQ-a........................................................................................
A0A1E3BTE7_9EURO/979-1302              .........................................q-KFEPIPLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSASRrssv..............rrsdeGASKPATFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYM............AA..............P..S.DI...RS............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLNRHADEM....KAD.DEVLAKHEAVL.NGVVPGLVEKHS...SLEQEATSLQQ...........LADEMEN.............CD.QDELRSAR.EKLA....SIE....DEIA..F...........K...........K.QELQELQTEV.QEKT...DT...VEAGT.ELKAQFM.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIN.ELK....................Q.....SVSNIEQQTG.WSIIS.AGas.................ssgDPS..LTMSY...RNQ...L.QLSFHPR-a........................................................................................
G0T0V2_RHOT2/782-1119                  .......................................lpd------SLDAFLVATGTHF..AD.Deffev..........vnsesTAA...KRR..KSMAATARTDededde...........tkqmggAKAVEPTFADMTVAAAVKSLFHQLYKSEQGGLLEGINQ.ARQMLEDS....EQ.RL.....RSG.vV....PQVFK.....DWA............NA..............T..D.EA...KA............I.................MKT...Q...FGQIKLNYLLSNKLEWKTRRI..QN..Y..DQVVD..IMAQNLQFI....QQD.RAVLTEVQSQF.EGVIPSLEARHA...ALLADLTAERS...........LDAELSL.............MS.PEDVEMRE.NMLA....DSE....EQEE..QlngnpdkgipgR...........R.PELDRIEQHL.RSYR...ET...FEKYS.TEEQHLQ.AEIADLE...ERRR.....D.KR....--..T.KT.DLV.RLQ....................A.....EFEALQHLQG.WRLEQ.FS......................TQH..LALRH...CDE...F.LVGFE---li.......................................................................................
G7E8S5_MIXOS/651-961                   .........................................e-QQPVLTVDDFFEITGVQF..MS.Dm..................iVPA...SRK..SAASPNRPRE.......................-SFGSSLLAEQIKAAASSVFFLDTYKHMVMKLGEQLKE.NRAAREEI....DE.VI.....ELS..Q....PRIFS.....EWL............RA..............D..D.DK...RA............A.................IES...E...LKLVKTWCRLDVRSDWYSFRT..QL..F..LQVCD..SLQINLAQL....RQD.QAQVASWGANV.TELLPDLRSEYG...RLKEELVREQA...........RQRELDA.............SD.KDELHSLH.LAIA....EQG....AALE..E...........I...........Q.KDHAEVQGQL.ERLE...SK...SADID.AEMSHME.STIAKST...SYCD.....R.VR....RF..T.QT.EVR.RLK....................D.....DYEALERITG.CKIVG.LR......................SGQ..IKLCL...CDE...L.QVTLDIS-s........................................................................................
F2PY88_TRIEC/956-1278                  ........................................tp--VEPIKLSDFLEMTNIHF..ME.L....................TTT...KRR..HTIAPGSPEKcgt.................eslEGAKEFGLEDRVAAGFCTLPMLELYQHSCRELKSYISE.GRRIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............T..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKEMWYEWRM..KL..L..EGLKQ..GLDRHVDEM....KQD.DAILSRKENIL.ANVVPGLIERHD...KLETDSQNLQK...........VIDEIEN.............CD.QEELRDAR.KKLL....AVE....TELS..G...........Y...........K.DKCTQTQSRL.EAKS...DL...LERAQ.ARREELL.QEIREAE...GIKE.....E.CR....GW..D.GK.EVR.VLQ....................D.....SVHSLENQTG.WTIIS.AKpsm...............dvvkGTT..LSMRY...SGE...L.QLDCNPS-d........................................................................................
A0A0D9N3K8_ASPFA/1008-1331             .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSAAKrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLNRHVEEM....RGD.DELLSKHETLL.SGVVPALVEKHT...SLEEQATSLQQ...........LADEIEN.............CD.QDELRDAR.GKLS....SIE....EEIA..S...........K...........Q.KLLEELQAEA.QEKT...NI...IEAGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKIERQTG.WSIIS.ATsps...............sssaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
M7TGG7_BOTF1/1045-1361                 .........................................l-DNERIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPKRSSDgpi................rnrlSDQTKVSLEDCVAAGAATIPMLELFQHACHELKKYISD.GRKTVREI....ES.ET.....FEE..N....PPLFR.....EYI............SA..............P..A.DM...KI............V.................MDN...Q...LKNVKTHSRLLSKGMWYDWRS..TL..L..ETVKD..ELVRSAEGM....IND.EEVLDKQQALL.DAVLPKMIKRAQ...QLQHEETNMKT...........AAEEIAS.............CD.PEELSEAR.QQLI....TVE....ADVE..A...........K...........R.NMIEELKKQL.QARE...IE...IEAGT.AKKETYL.EEIREAE...KIRE.....E.CR....GW..S.SS.EIS.SLK....................A.....KVDALEKKHG.WTITG.VS......................GTI..TSMTY...RKE...I.ELVFDAA-a........................................................................................
G3JDQ8_CORMM/820-1124                  .........................................n-EGNRIDLQDFLNMISIRF..ME.L....................QTT...KRR..HTTAPGTLQDgt...................taDGEDDMSLERCVVASACTVPMLELYQHSCR--------.-RRMVKEI....EA.DT.....LED..N....PPLFQ.....EYI............SA..............A..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLRE..GLVKISTDM....DVD.YRALQEQMVML.DSVLPELTASYA...GLEEEREALEE...........AAQEIAD.............CD.PAELNSAR.QELV....CLD....ADIE..A...........K...........K.KLISGLRLQF.EAAQ...TS...SESLS.AKKLSCL.ADIAQSE...KVRE.....N.CR....GW..S.SA.EVN.SLK....................G.....RVDALEKKLG.WAVTG.VH......................GTT..LSMAY...KRE...I.EIVFDVT-s........................................................................................
A0A1G4M9G7_LACFM/481-791               .........................................d-AIEPISLQKFLTETGVNF.tLE.N....................DIS...ENL..KTVKFDYLGD.......................--RDQCSASKVYDSLYADMPMLEIYAFCCKELIRRIRE.SKKLFKEL....ER.QV.....SES.iP....PLLFT.....EYF............KS..............G..S.SV...RK............L.................MNE...Q...IHLVKSYSRLEAKKVWYEWRS..QH..L..RGIKS..VLKENAMIL....KEE.EDSITKHIKEA.TKVKNHVSEIKQ...ALLREVSVAKEa........psCKSNVSN.............LQtRLRLEKMK.EELK....KNN....INAE..-...........-...........-.-NVDVLKTEY.EKLK...ET...ISELS.RKIADVK.SDISAQS...TNIK.....K.HK....LY..T.EH.DYQ.KLQ....................R.....TFATLEKLCG.IQLLK.FT......................GTK..LTIDI...LVA..kV.QFEFDL--tr.......................................................................................
L8G0F9_PSED2/1021-1336                 .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqLRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.ADALAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EENE...TR...FKVAT.ERKQACL.DEIGEAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADSLEEKYG.WTITG.IS......................GTT..LSLSL...HSD...L.ELVFDAS-s........................................................................................
G8B4Z3_CANPC/579-889                   .........................................a-NYKPVSLSTFLQDIHMKF..DT.D....................IGT...LAA..SSIGTDSNES.......................TLHQQPSIYELISAIPFKEG-NALNDFIVQELQNYIRD.GEQLFQDF....SK.QI.....GDD..N....LAIMK.....EFY............TT.............nD..A.KD...RE............I.................MII...C...LNNVRYLSKLESRSTWFKWRS..TL..T..QHVID..EMDNQIELL....KQC.QKDLEDYLQRL.DEQWVKAGEYKS...EVMNKLYRLRT...........AKKTMGN.............LS.QEQVDDMR.NAFN....QSK....SQLK..D...........L...........A.EKIDQARYKL.AHLD...QS...LVESR.NQKRDLL.NQAKDID...FELE.....K.RK....SY..T.KN.EKI.EIK....................K.....RYDQLTSLTH.LKYIR.TE.....................dVSS..MVFLY...YGM...I.NVKFDFD-k........................................................................................
A0A0U5GRI4_9EURO/973-1051              .........................................p-EFEPIQLQQFLDMTNIHF..ME.L....................TTT...KRR..HTTAPDSISKrtarl.............slegdSKSSASNFEDCVAAGFCTVPMLELYQHVS---------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------vs.......................................................................................
A0A1Z5T815_HORWE/814-1136              ........................................ks--AEKVRLQSFLDEAGIRF..MD.L....................TAT...KRR..LTTAPTPSKArrtss............tigiaeDSEPRVTLENAVVAAACTQPEHDMFQHACNELKRYISD.GKKVIKQL....EA.ET.....YRE..T....PPLIQ.....AYL............NA..............S..P.ER...KA............T.................LDA...Q...MRDMKTHARLRSKEMWYAWRS..QL..L..EDLMK..GLSGIGEGL....LKD.DEVLQRAEEVL.DQVLPGMEERHV...ALQQEAERLEN...........EVQSTSE.............EE.KEELEHAR.SRVV....EVD....AAVE..E...........K...........R.KVLEELERET.EEHD...RM...ASHLE.ESKVEFA.AAIKEAE...RVRE.....A.CR....GV..S.LQ.EIA.DLK....................E.....SIKNLKETYG.WSITS.SSa....................sPPT..ITMTY...KSQ...L.QLFFHP--la.......................................................................................
H6QRP7_PUCGT/768-900                   ................................ssqkhvedle-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............Q.................IMN...Q...LRLKKNWAEMSAKKDCHLFDI..EM..W..KTYQA..HLHDRTAKL....SHD.LKMMRKMDSIV.KPATESLSERKQ...SLIEEIRRRKQ...........KLAEIES.............CD.QNLLKALK.EEAK....DLA....AVTE..A...........N...........R.RELAESEF--.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------ernl.....................................................................................
A8N175_COPC7/743-1054                  ..........................................EDIPAISIAQFFELTGIKF..MD.E....................IAA...PRR..SIHPGQQLSRr.....................pRPKEDIGLAEYAVAMAIDIPQLELYTRVSRDLEAWMEK.SKIAFAEA....EE.EA.....AKV..T....PELFV.....EYS............RA..............D..E.EG...QA............E.................LLH...Q...LNFIKTNARGSAKSDWYDWKL..KW..V..EGLKS..TADRAFEDL....QSD.AKKLEALDAAA.KELIPDLEKEYE...EIMAELEREQA...........EVADIEA.............SD.QDYLTELK.TSIA....DQN....FEIE..A...........L...........K.GEVDEHKQQL.TWLN...ER...LRETE.QQKQEVS.SAIAKAE...RVLQ.....I.QK....SS..T.RA.EVF.QLK....................D.....ELDALEDLHL.TRIIK.VN......................AQV..FEFIY...DST...Y.RVSIPCTN.........................................................................................
A0A1B8GRT0_9PEZI/1023-1338             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNATAQdgs.................egqLGKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDN...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....SSD.AETLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.AFVQELRSQM.EDNE...TR...FKAAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A0M9ETZ1_FUSLA/974-1287              .........................................a-DGEKIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLENgf...................ldEGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FED..N....PQLFK.....EYM............AA..............A..P.DV...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKQ..GLVGIDEGM....EAD.KELLDKQKSLL.DSVLPAIVDRYK...SLVEESDNLEE...........VARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLA.IQKQNCI.DDIAESE...RIRE.....E.CR....GW..T.SK.EVN.SLK....................A.....RVDAIEKQHG.WTVTG.IS......................GTV..LSMSY...KRE...I.EIVFDIA-a........................................................................................
E2LY56_MONPE/114-317                   .......................................mga-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................LKH...Q...LSLIRTNTRLLAKADWYEWKH..QW..I..EGLKV..TAQESFTDL....ESD.ARVLEQLKHNA.DELVPALQQEYD...EIMQELEQEQA...........EVAELEQ.............CD.QDYLNELK.TSIA....EQS....VEVD..S...........L...........K.NELKEGNDQL.KWLE...ER...LEELE.SQKREAT.SAIADAD...RFLQ.....I.QK....NS..T.HA.EVL.RLR....................D.....ELEALENLHM.FHACK.VN......................ADL..FEYIH...ASR...F.RVTIPCKN.........................................................................................
A0A177VWA5_9BASI/302-481               ...............................qlsraelaqtl-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....-RD.NAVAEGKNKNMrEDWLPRLRALHA...QLRAKAQKESA...........RTEAIKT.............CD.PDELAGLH.QAID....EQS....AFLS..D...........S...........R.QKKKRAAEQF.QRVR...SR...LDDVL.DQKHALV.DAISTAR...EVYQ.....S.IQ....GC..T.RG.EAA.RLL....................Q.....ETTQVQRLHL.WTVVR.LP......................AE-..-----...---...-.--------srkqqqqrnttrvvelvydaavvlqael.............................................................
A0A1V6TWA4_9EURO/961-1287              .........................................v-EIEPIQLQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSATKkltrl.............sgenmPKPGSITFGDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLLRHVEDM....KAD.DDLLSEREELL.NRNVPLLVEKHA...SLEQEATNLRQ...........FVDEMEN.............CD.QDELRSTR.SKLS....EVD....SEIA..D...........K...........R.RELEQLQEEV.KEKT...TF...IEAGA.EMRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.EIN.ELK....................A.....SVQRIQQQTG.WSIVS.AStps...............daskGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
F4RH85_MELLP/864-1146                  .......................................psl---PSISLEEFFEQAELRF..IN.L....................AQP...RVR..QDQPIQPNTE.......................--GETASFSGQIYAGMVKIPKLRALEIAARTLRSKTES.LDSMTAEH....SK.EL.....ETNsrR....SEVLM.....RWF............EL..............R..N.NG...NQ............Tdgr...........lssLLD...Q...LRIEKTCAELRAKKGAIEFDL..KN..R..EEYRN..ELASRRSKL....DRD.VEMVRRVGEVI.APSMDELRTKKQ...NLVEEIQKRRA...........KIEEIEK.............CD.KGLLRVLK.EETK....DLG....MAVE..V...........M...........R.GTLAESEFEK.TLWK...EK...VEEMA.SEKKELL.AQIGQWK...KKGN....gK.GL....EC..T.TQ.ELV.RLK....................T.....S---------.-----.--......................---..-----...---...-.--------hl.......................................................................................
A0A175W8I8_9PEZI/952-1265              .........................................d-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPGAARDsi...................aaGGKDDMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............TA..............S..P.EF...KV............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLKTAEGM....DHD.DRLLNKQQELL.SSVLPDMVKRFE...ALELEHSNLEA...........VARELAD.............CD.PKDLEDAR.AELT....AVD....QSIA..E...........K...........A.RKVEELRQQL.DESV...ES...IESWT.KQKQQCL.DEIREAD...KIRE.....E.CR....GW..S.SA.EIS.KLK....................A.....RTDALEKQHG.WSITA.IR......................GTA..ISMRY...KRE...I.ELVFDTQ-k........................................................................................
A0A0D9P0Y2_METAN/920-1233              .........................................a-DNERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..LTVAPKTLHDgs...................sgDGEDDMSLERCVIAGACTVPMLELYHHSCRELKNYIAE.GRRMVKEI....ED.ET.....YEI..N....PPLFR.....EYM............CA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLISISEGM....DAD.EQMLKEREELL.AAVLPGALERHE...QLEEESENLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLE....ADIE..A...........K...........K.RLIGELRGQL.ESST...SE...AEELA.AEKQSLM.TSIQQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................S.....HVDALEEEHG.WAVTG.LS......................GTS..LSMAY...KRE...I.EVVFDVA-s........................................................................................
Q6C895_YARLI/993-1298                  .......................................psd----SLTMTRFLQMIDMQF..MD.D....................FLL...PGK..RQPNPD----.......................--VSKCSLAQYLVNSY-LHPHVQLYSWAVEHLRKDIEV.RSANFAQL....DQ.ET.....LND..V....PPIFV.....DYT............SA..............D..S.GV...KL............L.................LNK...Q...FALDKQYYRVEARKSWYEWRK..SI..S..IDLYK..RLATNRDLL....RSD.LKVIDQESETV.STEVADLKQSLD...VSNSQLTQLKN...........LSTDVE-.............--.--LKRQVC.SELQ....LVQ....QQLM..P...........L...........V.DKLEQVNLTV.VELE...SE...VAKEV.QKQDEIK.TQLMEQQ...KRLL.....D.NR....HI..D.FR.EIE.QLQ....................E.....QLKKTEQKKG.LKLAR.FEpng...............davfE--..-----...---...-.--------srdlcmtvsrnsnlvvaisak....................................................................
A0A2B4SNA4_STYPI/1266-1573             ........................................st--QNAITLKEFLDIIEIAF..IT.E....................V--...NMR..RSVAPSAVVE.......................---APQTLKDRMISTLVSKPKAICYEEAIPTVESGIKA.MKEKVEQQ....EM.EL.....NVS..N....PRIFM.....EVQ............TA..............S..K.EE...LL............A.................LQS...K...VRRLRSVCEKTSKREWKEGKG..QL..N..KKVLS..KLTENHAAL....AKD.VLTVEESVDMV.DDCLSILDTINK...DFDEKMKNIHS...........SLAENEK.............-K.IQEQANMV.EELA....TIS....EALG..M...........R...........E.QALADLESTR.SRLQ...SE...KHELA.KNKEQLD.GKILETEetiRLVK.....R.KD....PR..S.NK.ATR.EMS....................Q.....KLDILVSLQD.WSVEE.WN......................KER..AKFAF...LKN..tL.EIVV----vfap.....................................................................................
A0A0C9ZID4_9HOMO/39-352                ..........................................EEGPPISIEQFFEMTGIRF..MD.E....................IAA...PRR..QSIHPSVLRPsr...................raSVEGQIPLAEYMVAMAVDVPQLELYTHVSKDLQAWIER.IQAIYREA....EE.EA.....LKM..T....PQLFQ.....EFV............SA..............D..E.TG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKL..QW..V..ERLHE..KASKGFEHL....EKD.ANFLEEIIREA.QSILPGLQQEYD...QLVEELEQETA...........EITELEA.............CD.QDYLKELK.ASIA....EQG....MELD..N...........Y...........R.RGVEEGKAKL.GRIE...EK...LKEIQ.TEKNEVS.ASIEKTE...RLIN.....I.QK....NS..T.HA.EVF.RLK....................G.....ELEMLQTLHM.VQITK.VD......................AER..FEFVY...GSS...Y.VVSTRC--ve.......................................................................................
R1H2E4_BOTPV/170-491                   ..........................................EQAPQIQLQEFLELTKIRF..MD.L....................TTT...KRR..HTGYPGAQNGfgrsa.............smgaaEIEGKDDLETCVVAAACTEPEYLMYQHACHELKRYIAE.GKNLVRQI....EE.ET.....YEE..N....PALFR.....EYL............SA..............P..T.DQ...RQ............V.................MDN...Q...FKNMKTNARLKTKEAWYGWRS..NL..L..HDIKA..GLMRTADGF....NDD.DMALKKQEEIV.DSTLPVLQQHHD...KLETECQQLQR...........RAEELNG.............AD.REELDAAR.EQLV....AAE....TAIA..E...........K...........R.RKVEALQKEL.AEKE...AG...IEAVK.ERKVECV.EEIKAAE...RVRE.....E.CR....GW..S.VD.EVS.TLK....................A.....RVSALESEHG.WLITS.ASm....................dPKT..VTMSY...RSD...L.QLFFHPS-a........................................................................................
A0A075AYJ2_9FUNG/796-1053              .......................................len---------------GIHF..LD.D...................mATD...IRR..ETLIFPNSEN.......................--KISNDKSNLLNFC-ISVPELEVFEFGCNELENYVSE.SKKSFSTL....QE.AF.....EDK..P....LPSFN.....S--............--..............-..-.--...--............-.................--S...F...LTRLKNYSRAHAKNQWYSWKH..NL..L..SPIHS..VLNDHLEHL....KRD.SFYLNQFSSTL.KDSRNLLNLKLS...SIKSLHQNLLQ...........KESLSLS.............LN.VSKINQLK.DLLK....DQT....DLLS..K...........L...........K.LKSIPIQSEI.SQTQ...ES...LDNLS.LTKIKLL.NDIASIK...ESIL.....K.FQ....SC..S.LK.NID.TLK....................S.....KHSVIT----.-----.--......................---..-----...---...-.--------kfklns...................................................................................
A0A146F1W6_9EURO/978-1305              .........................................p-QFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKramrl.............steseTKSSASDFEACVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLQSKATWYEWRM..KL..L..EGLKD..GLDRHVQEM....KAD.GDTLSKHEALL.TGVVPGLEEKHS...ALEKEATTLQQ...........LADEMEN.............CD.QDELRSTR.EKLS....SVE....AEIE..A...........K...........K.RRLQEMQEEL.KTKT...DT...IESGT.ALKAEYT.AQIEEAE...RIKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVRNLERQTG.WSIIS.ATsppe..............gssaGPA..ITMSY...RNQ...L.QLTFHPA-s........................................................................................
A0A0F4ZK12_9PEZI/1059-1371             .........................................a-EGKRIHLHDFLNMTSIRF..ME.L....................NTT...KRR..HTIAPTRTDGs....................alDLASDLTLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFR.....EYM............SA..............T..P.EF...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGIKE..GLVRIGEGM....DED.QAVIEKQEKLI.ASVLPAAVAKKD...LLIKERDNLAV...........FAQEIAA.............CD.PGELRAAR.NELA....DVT....QRID..V...........K...........R.QEIKDLERQL.AETE...AG...IVEAT.KQRAECQ.AAITQAE...KIRE.....E.CR....GW..S.IA.EVS.ALQ....................D.....RVVALEAKHG.WKLVG.IS......................GTV..LSMTY...RDD...I.RVSFDAA-a........................................................................................
A0A0D7A6F7_9AGAR/1-289                 ..........................................-------------------..MT.E....................LTA...PRR..SLHPQARPQA.......................RPADKIPLAEIVVALGIDIPQLELYTRVSKDLQNWIAE.SKRVFREA....EG.EA.....EKV..T....PELFV.....EYC............RA..............Q..P.ED...QA............E.................IKH...Q...LDVTKTNARMQAKSDWYEWKL..QW..V..EGLCA..TAERELAQL....EED.SHTIQEMLALA.DE-NGVLEQEYQ...DLVKTLEAEQA...........EIAEIEA.............CD.QEYLEELK.GEVE....EQR....RFIE..D...........V...........E.REISQVKSEI.ELKE...TR...LREAE.AEKQEIA.TAILLAK...S-RA.....E.MH....DR..S.EV.ELF.QLK....................S.....ELEALQEIHQ.LAVTK.VS......................PDV..FEYVY...ASQ...F.KVSIPCRQ.........................................................................................
R7YL22_CONA1/759-1077                  .........................................a-NEERIELQDFLNMTKIRF..MD.L....................TTS...KRR..HTAFPSAAHDgkal..............saldqTEGAAPDLESCVVAAVCTVPQLEMFQHSCHELKKYISE.GKDVVRQI....EA.DT.....YGE..N....PPLFR.....DYL............AA..............P..L.DQ...RH............L.................IDN...Q...LKNLRTNMRLQSKEIWYGWRS..NL..L..ENLKT..GLMRTEEDL....AND.DLTLKQQEALL.ETLMPVLTSKHE...RLQAECTQLHE...........RAEELQG.............CD.KEELDEAR.ERLV....AAD....ADIG..E...........K...........K.RLIEALQQEL.IEKE...RS...IEAAK.ERKLECA.EEIKAAE...RVRE.....E.CR....GW..S.AS.EVA.ALK....................S.....KVQTLEMSHG.WALTA.AT......................DQT..VTLTY...RTH...L.QLYFHPS-s........................................................................................
B8MGZ6_TALSN/973-1296                  .........................................l-EWEPIQLQDFLNLTNIHF..ME.L....................TTT...KRR..HTTVAGNDRMtdfr...............gtrqTDKRVVSLEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIHSI....EE.ET.....FAD..N....PPLFR.....EYV............TA..............R..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QAD.DALLSQQEAIL.QSVVPGLVEKRS...LLDSEASRIQE...........IVDEMEN.............ID.PNELRMAR.ERLA....KVD....TEIE..R...........K...........K.KQLEQMQEDL.QNKN...DT...IEAGA.ELKAEFL.KQIREAE...RVQE.....E.CR....GW..S.IK.EVN.ALK....................D.....SVHALEIQTG.WSIVS.AIdgq................eptGPG..MTLRY...KGE...L.EVKVYPK-l........................................................................................
L2G7U2_COLGN/1139-1449                 .........................................e-SEERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPDMFRE......................mGGKEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ES.ET.....FEE..N....PPLFR.....EYM............SA..............S..P.DF...KN............I.................LDN...Q...FKNGKTHARLESKAMWYEWRM..KL..Q..EGLKE..GLIRIAEGM....KTD.EKVLQQQQKLL.ASTLPAIVSRFT...ELEQEYSNLQA...........VANELAD.............CD.PEELETAR.ADLA....EVE....SDVQ..E...........K...........T.QLIAELRQEL.EDAE...RG...VEALT.QEKQQCH.EDIKEAE...KIRE.....E.CR....GW..S.IG.EIS.ALK....................G.....RVDALEKQHG.WAVTG.VS......................GSQ..ISMTY...LRE...I.EIVFDIA-s........................................................................................
A0A0D2XAT6_FUSO4/901-1212              .........................................q-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLDSgf...................ldDGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.DT.....FEE..N....PPLFK.....EYM............AA..............T..P.EI...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKE..GLLGIDDGM....ETD.KELLDKQKSLL.DSVLPAIVARYK...SLLEESNNLEE...........IARELAD.............CD.PADLEAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLI.TQKQNCV.DEIAESE...KIRE.....E.CR....GW..T.ST.EVN.SLK....................-.....-VDSIEKQCG.WSVTG.IS......................GTV..LSMAY...RRE...I.EIVFDIA-a........................................................................................
A0A084G4G4_9PEZI/935-1243              .......................................dag---DRIHLQEFLNMISVSF..ME.L....................TTS...KRR..QTQAPAALRD.......................-NDDDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....ET.ET.....LQD..N....PPLFR.....EYM............SA..............S..P.DF...KL............L.................MDN...Q...FKNGKTHARLLSKAMWYEWRM..KL..Q..HGLRE..GLIRIDQGM....EED.SVSLKKQQRLL.SSVLPGMASHYE...ALAKEHNNLET...........YAKELAD.............CD.PEELQSAR.NEFL....QVE....SDIE..A...........K...........K.REIFELRSQL.QAAE...SE...IEEVT.RQKNQGL.EDIKEAE...RVRE.....E.CR....GW..T.VK.EIN.VYK....................D.....RVDALEKDHG.WAVTG.IS......................STQ..VSMAY...KRE...I.ELVFDVS-s........................................................................................
A0A177WP16_BATDE/552-856               .....................................vgqik------TLKEFLLATGIEF..MGsL....................TTR...LRR..DTNAFQSNS-.......................---ECPTIHEYLKATCLYFPELEIYEFACRELTQSIND.GNLTLQDI....EE.SA.....TKN..P....PLIFF.....EYE............HA..............S..H.EE...RD............D.................MIN...S...LRLSKSYARLEAKQSWYSWRG..QL..I..DPMQA..ALGENCKRF....SWD.KLLMDEYVKQF.SILNESATTYRD...TLRQKTIEMQT...........AQAKAIE.............IE.TARVAELT.KLQA....EQI....AELE..H...........L...........T.RELEDLRLQS.QEET...AS...IAQAN.VLIAELV.QDIAKYE...EVSK.....D.LM....VF..D.PE.ELP.HLR....................H.....EYKTIVLTHL.WRPLE.IS......................MAR..HIFVF...DDV...V.EVAFY---kq.......................................................................................
A0A061HHV9_BLUGR/1253-1564             ..........................................EEYNQIQLQDFLDMTRIRF..ME.L....................TTT...KRR..HTTAPKSASMk.....................qENEKQDSLEDCIVAGATQIPMIELFQHACHELKRYISD.GRKTVREI....EK.ET.....WEE..N....PPLFQ.....EYL............LA..............T..P.DL...KL............L.................MDN...Q...LKNVRTHARLLAKGLWYEWRM..TL..L..NTLEG..GLVKTIQDM....KID.ENTLDRQQLLL.APVMPNLTQTVR...DLEHEESQINA...........ASQELAN.............CD.QDKLNEAR.HRLV....TID....TENK..T...........K...........I.LLISQLQNEL.RAKE...KE...IELSI.ARKKAWK.EEINEHE...KIKE.....E.FR....GW..T.CT.EVN.SMK....................S.....RVCRMEEEYG.WTITH.IS......................GTL..ISMIF...RRE...L.ELTFDAS-s........................................................................................
A0A1Q5UQQ1_9EURO/974-1300              ..........................................EDVEPIELQDFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSASKrlsra.............ssehvAKPGVITFDDCVTAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YEE..N....PPLFR.....EYV............TA..............P..P.EI...RV............I.................MDN...Q...FRNAKTHARLLSKATWYEWRM..KL..L..EGLKE..GLHRHVADM....KAD.DELLSKREELL.GNVVPPLVEKHV...SLEQEAANLQQ...........LVEEMEN.............CD.QEELRGAR.KKLS....SVE....DEIE..A...........R...........K.RELGQLQAEV.LEKT...NI...IEAGS.ELRDEFL.AQIQEAE...RVKE.....E.CR....GW..S.AR.DIR.ELK....................S.....SVQKIEHQTG.WSIKS.AStpa...............eesvSPM..LTMTY...RDQ...L.QIKFHPG-a........................................................................................
A0A0M8MZ14_9HYPO/1-300                 ..........................................-------------MTSIRF..ME.L....................TTT...KRR..PTMMPGAFQQg....................elGDEDDMSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRKIVKEI....ET.ET.....FEE..N....PMLFQ.....EYM............AA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARHLSKAMWYEWRM..KL..Q..DGLKE..GLMSIAEGM....EGD.EKLLAQQEELL.ASVMPGLTSRHE...ALQKESRRLEQ...........IAKEMAE.............SD.PAELQAAR.DELV....ALD....DDIA..Q...........K...........Q.ALIEKLRKGL.EESD...AE...VEELA.AQKQQCL.GDIKEAE...SIRE.....E.CR....GW..T.CT.EVN.SFK....................D.....RVDAIERKHG.WTVTG.IS......................GSI..LSMTY...KRE...I.ELVLDAA-s........................................................................................
F9XAQ6_ZYMTI/642-962                   ........................................qp--MEKIGLQDFLNQANIRF..MD.L....................TTT...KRR..MTTAPTPSKArras..............nsqgvSDNEQATLENAVVAAACTTPELELYQHACHELKRYTKE.GKQMIAEL....EA.ST.....LRE..Q....PPLIQ.....AYV............HA..............T..P.ER...KI............A.................LDV...Q...MRDMKTFARLQSKELWYEWRS..QL..L..DELMV..GLQNIGEGL....IKD.DEILGQSEQIV.DQVLPALVEQHE...ALQEEADRLEA...........DVNAVTD.............EE.KEELQVAR.GRLT....DVD....ADIA..E...........K...........K.LLLETLQDQV.QEQD...EL...AEKLQ.RSNAEFT.AATHEAN...RVRE.....A.CR....GV..S.LN.EIT.ELK....................A.....SVKDLEESFG.WSIIS.ASs....................sPAT..VTMTY...KSD...L.ELHFHPQ-a........................................................................................
A7TEA3_VANPO/372-687                   .........................................k-EFQSYSIKEFLKEINISF.kID.N...................eVGN...SDE..STLNFTLIDP.......................AQITGIRINQLYNTYYVDIPILEMNTFISKELLRRISQ.SKVLFEDL....EE.RV.....IKE.sP....PLLFR.....EYF............SS..............E..A.EI...KN............I.................AKS...Q...LQLVKKYSSLEAKKAWYEWRI..QH..L..VGIKN..VLIENLSIL....KEE.FEKVNTDLENI.QEIKNKVESLKD...RIRQEIKLIRElp.......pdYYQNHPN.............LKdKLRLEQLK.QELV....SHS....VKIG..-...........-...........-.-QIKELQNKR.NDVL...TK...ISKTK.ESLSQTK.LELENSN...RAQR.....L.DS....HF..S.EF.ELN.RLK....................N.....RFSMFQTLSG.IEFVS.LK......................KST..LIVKS...PIE..eFpEIVIDL--sk.......................................................................................
C3Z3N5_BRAFL/1232-1539                 ........................................pq--QGRLSVSQFLTYCNIVF..QD.Q....................-GK...DRR..SIMPLIKSDP.......................----PETLYDHLEILSSLLPQAHVYEWSCNKLQEHIGS.TRQLVKQQ....EE.RL.....DQS..N....PVLFL.....EAQ............KM..............L..Q.DG...RL............Kev.............dqLKK...D...MESLRSCCKKQAKTEWHQWNY..KM..S..GTIVE..SLKEEHADM....KAG.VEELDASLQKI.DQSLAALDNVEK...DLEDAIINLEG...........MELP-SE.............ED.IQRLKKQQ.AELL....QKE....EELA..A...........S...........Q.QEQEHLKSTC.VSLQ...QE...REALE.LQVDQLQ.LQQAELG...LQQE.....G.ED....GP..A.AQ.ALQ.EQV....................R.....ALNRLQGLVE.WDLEE.LS......................AAQ..LRVTF...LQK..sL.QLTV----vya......................................................................................
A0A151WDA9_HYPMA/787-1098              .........................................n-DEPPISIKQFFSMTGIKF..MD.E....................LTA...PRR..SIHPSQQGVRq.....................aRNEEDILLAEYVIAMGLDVPQLVLYSRVSKDLEAWIEK.SKADFDQA....ED.EA.....AKI..T....PELFT.....EYS............RA..............D..E.EG...QA............E.................LLH...Q...LQLIRTNTRAQAKSDWYDWKL..QW..L..EGLRV..TADKTFKSL....EED.AKTLEGIRATA.DEVIPALEQEYE...EITRELEKEKA...........EVAEIEA.............SD.QDYLNELK.ASIA....EQN....IEVE..A...........L...........K.AEVAESKAQL.VWLQ...ER...FEEVE.SQKREAT.TAISNAQ...RVLH.....I.QK....NS..T.RA.EVF.KLK....................D.....ELEALEDLHM.FRTTK.VH......................GDL..FEYVY...ASR...F.RVSIPCKN.........................................................................................
J5JZN6_BEAB2/900-1213                  .......................................nag---DRIDLQDFLNMISIRF..ME.L....................QTT...KRR..HTTAPGTLQDgs...................taNGEDDMSLERCVVASACTVPMLELYQHSCRELKKYIAE.GRRMVKEI....EA.DT.....LED..N....PPLFQ.....EYI............TA..............T..P.DV...KA............L.................MDN...Q...FRNVKTHARLLSKAMWYEWRK..KL..Q..EGLRE..GLVKISSDM....DGD.YRVLQEQMDML.ESVLPELTQTYE...GLVEERENLEE...........AAKELAD.............CD.PAELDSAR.EQLS....TLD....ADID..A...........K...........K.ELIAELRLQL.RTAE...EN...SDSLS.AKKVSCL.ADIALSE...KIRE.....E.CR....GW..S.SA.EVN.SLK....................G.....RVDALEKQLG.WAVTG.VN......................GTS..LSMAY...KRE...I.EIVFDVT-s........................................................................................
A0A1L9SI78_9EURO/1007-1333             ........................................dt--MEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPGSTRRslrl...............sgdaARFAIANFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PPLFR.....EYV............TA..............A..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLDRHVEEM....KTD.DEYLSKHEELL.KDVVPELIEKHA...SLEQEASTLQQ...........LADEIEN.............CD.QDELRSAR.EKLL....SVE....AEIV..L...........K...........K.RQLAEMQEEI.QDKV...DT...IEAGA.ELKAEAL.GQIERAE...KVKE.....E.CR....GW..S.AK.EIN.GLK....................V.....SVHNLEHQTG.WCIVA.AStsss.............kesslGPS..LTMRY...RDQ...L.ELTLHPK-a........................................................................................
A0A0H1BLA2_9EURO/1043-1367             .........................................p-QVEPIQLQDFLDMTNIHF..ME.L....................TTT...KRR..HTLAPTSDNKkvts...............krddEAVKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHAEEI....QND.DAVLSKKEDLL.DRVVPPLVEKHA...KLETEAQNLQR...........AVDELEN.............CD.KEELRQAR.ERLA....TLD....AEIS..A...........K...........R.KSLEQSQTEL.ENKN...AI...IKTGT.GLKDELL.AQIGEAE...RVTE.....A.CR....GW..S.VK.EVK.TLK....................A.....SVRALERQTG.WSILS.ASlkp...............sskyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A094K5P6_9PEZI/1019-1334             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPNAAAQdgs.................edqLRKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLDKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........AAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRSQM.EDNE...TR...FNIAT.ERKQTCL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RGD...L.ELVFDAS-s........................................................................................
C5DZX8_ZYGRC/321-627                   .......................................pls-----YSLKKFLDAVGVSF..LI.D...................tNFI...KSQ..EAVEFPLTKL.......................--PVSLHSHQILSKLYVDMPVLEMNEFVCRELWRRVDQ.SSVQFQDL....EN.QI.....SSS.vP....PLLFR.....EYF............QS..............S..E.DM...RR............L.................MNQ...Q...LQLVKSFAKLESRKAWYDWRI..QH..F..KGLQD..VLLENLGLL....QEE.KTKLDKDLQRA.QKNKEETFSLLQ...VLRKEVELVRDlp......sqvYKKESKL.............AD.KLQLEKFR.QELK....AHK....IAFN..D...........S...........Q.NLRLQRRSLV.AEIE...SK...CKELG.ELKGKLH.Q-LQ---...--QK.....N.KT....QV..T.DY.DMT.KLR....................R.....KLEFLSVLSG.IQFKG.IN......................NSQ..LLVKC...FDL...I.ELSIDLS-l........................................................................................
A5DJQ1_PICGU/365-674                   ..........................................EDYESVSLTHFMKDIGIRF..YD.Dl..................dIGT...SSI..SRISISLPKV......................iDGSNDYSLQDYVNATN-KLPLLELLYFSCEEMRKNIED.GKKLFEQF....NN.TT.....LAS..N....PKLFK.....QYY............YS..............P..L.EK...QL............G.................MQS...E...FQLIKDYCRKQAMDAWYTWRT..TM..I..RNLLD..STLLKYEQV....QED.ERLLNEKLAAA.ESLFVESKDKLN...RLKLIMAQLSD...........ISD-PQI.............HD.SSEFSSLR.NELV....YLY....SKIT..A...........S...........R.SKISLLKDEV.NAVD...IA...IADNE.SKIAELR.GSLAELE...TILN.....K.NR....TY..G.TS.EIS.TLE....................A.....KCNLLQKLTG.FNFEA.VE......................GNS..IRFSY...QRT...Y.SVHL----sst......................................................................................
Q2UPR4_ASPOR/1008-1331                 .........................................p-EVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSAAKrra................rlssEKSSASKFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....ET.ET.....YAE..N....PPLFR.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKD..GLNRHVEEM....RGD.DELLSKHETLL.SGVVPALVEKHT...SLEEQATSLQQ...........LADEIEN.............CD.QDELRDAR.GKLS....SIE....EEIA..S...........K...........Q.KLLEELQAEA.QEKT...NI...IEAGA.ELKAEYL.GQIQEAE...RVKE.....E.CR....GW..S.AK.EIS.ELK....................E.....SVHKIERQTG.WSIIS.ATsps...............sssaGPL..VTMSY...RNQ...L.QLSFHPG-a........................................................................................
I1RAX8_GIBZE/977-1290                  .........................................a-DGDRIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTQAPGTLENgf...................ldEGEEDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVKEI....EN.DT.....FED..N....PQLFK.....EYM............AA..............T..P.DV...KT............L.................MDK...Q...FMNVKNHARLLSKAMWYEWRM..KL..Q..EGLKQ..GLLSIDEGM....EAD.KELLDKQKTLL.DSVLPAIMDRYK...SLVEESDNLEE...........VARELAD.............CD.PADLDAAR.DELA....SLD....EDVE..Y...........K...........K.KRIAELREQF.QASE...VE...VEDLN.EQKQNYI.DDIAESE...RIRE.....E.CR....GW..T.SK.EVN.SLK....................A.....RVDTIEKQHG.WAVTG.IS......................GTV..LSMSY...KRE...I.EIVFDIT-a........................................................................................
B8PD02_POSPM/1145-1245                 .......................................tpf-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....--S....NELE..A...........F...........R.TDVSESRAKL.ERFE...EK...LAEIE.SQKQEAS.SAIAYSQ...HSIH.....I.KK....EG..T.SV.EVI.KLR....................D.....ELEALQDLHL.WRTTK.LA......................ADV..VEFIY...ASR...Y.QVTIPC--i........................................................................................
A0A074X772_AURPU/1036-1349             .......................................ppa---KKVQLNEFLDLAGIKF..MD.L....................TAS...KRR..HTVAPTPSEPhg...................adREDQNIDLEGAVVAGACTMPMLDLFQHACRELKRYISE.GKSFLKTL....EA.EV.....YEE..P....PPFFQ.....AYM............DA..............T..P.DR...KA............Q.................LDI...N...MRDAKTNARMRSKEIWYDWRS..KL..L..DGLLD..GLNRIKTGL....EAD.AEILGRKQESL.DSELPDLLQHYE...DLLKEAEQLEQ...........AAAATSE.............EE.KEELRASR.ARLV....EVD....EQIE..E...........R...........K.RMLADLQRDI.DEQD...NL...AEAYE.EGKAESL.AAIQEAE...RVKE.....S.CR....GF..T.VE.EVQ.SLK....................A.....SVAQLEKQTG.WAVAS.AS......................GAN..LTMTY...KNT...L.QLYFNTT-s........................................................................................
A0A0C3K0Z9_PISTI/718-887               ..........................................EDGPPISIQQFFEMTGIRF..MD.E....................ITA...PRR..QSIHPSTLRPsr...................raSVDGQIPLAEYMVAMAVDVPQLELYTHVSKDLQAWIER.IQSIHREA....EE.EA.....LEM..T....PQLFQ.....EFI............SA..............D..E.TG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKL..QW..V..EQLDQ..KASKGFEHL....EKD.AKFLEGVIH--.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------eaq......................................................................................
A0A094BHH9_9PEZI/1023-1338             .......................................dve---DRIQLQDFLNLTSIRF..ME.L....................TTT...KRR..HTIAPTAAAQdgs.................ddqLKKDDGSLENCVVSAACTLPMLELFQHSCRELKKYISE.GRKMVREI....ET.ET.....FDE..N....PPLFQ.....EYI............SA..............T..P.DV...KK............L.................MDS...Q...FRNIKTHSRLVSKGMWYEWRM..KL..L..DGLRD..GLITIAEGM....TSD.ADVLAKQQELL.DNVVPELVQKYE...TLLQQEADLQT...........SAEEIAN.............CN.QEDLAEAR.ECLV....ALD....ADIE..S...........K...........K.ALVQELRGQM.EDSE...TR...FNIAT.ERKQACL.DEIREAD...KIRE.....E.CR....GW..T.GS.EIA.ALK....................A.....KADALEEKYG.WTITG.IS......................GTT..LSLSL...RSD...L.ELVFDAS-s........................................................................................
A0A179V6E8_BLAGS/1038-1362             .........................................p-QVEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTLAPSSDNKkats...............krddEAVKGISFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....QND.DAVLSKKEDLL.DRVVPPLVEKHA...RLETEAQNLQR...........AVDELEN.............CD.KEELRQAR.ERLA....ALD....AEIS..A...........K...........R.KSLEQSQAEL.ENKK...SI...IKAGA.GLKDELL.AQIGEAE...RVTE.....E.CR....GW..S.IK.EVK.TLK....................A.....SVRELERQTG.WSILS.ASlkp...............sseyGPA..LRMRY...RNE...L.QVDFYPG-a........................................................................................
A0A0C3H278_9PEZI/1017-1329             ........................................sd---DRIQLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIVPKEPNQrd...................smQGEAAYSLEDCVAAGAATVPMLELFQHACYELKNYISE.GRKTVREI....ET.ET.....FEE..N....PPLFR.....EYI............SA..............S..P.DV...KV............I.................MDN...Q...LKNVKTHARLLSKGMWYEWRM..TL..L..ATLKD..GLVKTADGM....RQD.GKILDRQLALL.DTVLPNFVRQAQ...QLENEEADLRS...........AADELAN.............CD.QAELSEAR.QKLI....AVD....ADID..A...........K...........Q.NMIDELRKQL.QGKE...AE...IATST.ERKNFCL.NEIREAE...KIRE.....D.CR....GW..S.SM.EIS.LLK....................E.....KADKLEREHG.WAITG.VS......................GTT..TSMTY...RRE...I.ELVFDAA-s........................................................................................
A0A1B9GFG8_9TREE/612-922               .........................................e-QPQTISLASFLEMAGVQF..ME.Gl..................pGLD...RRR..SSVAKGILGQs....................ysGGEREFALHEYSEAQVNSI-FLNMYTWAANKLREDIRT.GQAELDLC....EA.RC.....DED..S....PPVIQ.....EYL............SA..............T..D.ED...KQ............L.................FEL...T...FKSFKTNTQLKAKEMWYDWKL..QL..M..QTIKP..DVEGMLQGM....QED.NDRLNALQEQT.DAILPDLKARQA...ALQAELEKERE...........IVADIAA.............CD.QQELISLK.EGIT....EQG....TQIN..M...........F...........N.SELEESTAKL.TALT...SK...LEELI.STKRECV.AAIQYAK...SQ--.....-.CD....QF..T.RS.DAV.RLQ....................E.....EYNSIQHIHL.WRPTK.IT......................SDR..LELEF...DNE...I.SLTFACR-d........................................................................................
A0A1B7NIV9_9HOMO/1-301                 ..........................................-------------MTGIRF..MD.E....................IAA...PRR..SMVHSSALRPsr...................rqSTESEIPLSEYVVAMAVDVPQLELYTHVSKDLQVWIER.IKGIYKEA....EE.EA.....LKI..T....PELFQ.....EFV............MA..............D..E.EG...QN............E.................LLH...Q...LKLIKVHKHAQAKSEWYDWKM..QW..V..DQLYQ..KADQGFRDL....EAD.AKVLEDIINQA.QEVVPALNEEYE...NIIRELKQEQA...........DVAELEN.............CD.QGYLHELK.TTIQ....EQS....VALE..A...........F...........R.ADVDEGEAKL.DRLQ...EK...LDEIE.AHKLETT.NAIQVAE...RQVQ.....V.QK....NS..T.HA.EVF.RLK....................D.....ELEALQNLHM.LHVAK.VL......................PNL..FEFRY...ASS...Y.DVSVPCE-d........................................................................................
Q6CMN2_KLULA/359-668                   .........................................s-QSGPISLQTFFDAANIKF..NV.D....................-TQ...INE..FQIDLKSTNN.......................--IEHVPSNIIYQALYCKIPILEIQAFTAKELTRRILQ.SRNLLKSL....RE.QI.....ASN.eP....PRLIK.....EYF............EA..............D..T.DT...RY............A.................INE...K...LELVTIMARLQSEKVWFEWRS..QH..L..KGIKT..VLEENIAIL....VDE.NAQIMKYMNEI.NDVKIRVSDIKQ...VLMKELDVLRQhn.......dvFSNKKEN.............ITtLLKVNKLK.GDLR....ENM....LKVS..-...........-...........-.-DLNQLTTKK.DQLT...QK...IQDAK.LEMSKVN.EEIAQLR...QDLK.....Q.SK....VC..T.EY.DVA.KLK....................L.....VHQLYQSISG.IKFRK.LV......................GPV..LSVSL...HDD..kV.IVTADLS-k........................................................................................
G8BYU6_TETPH/375-689                   .........................................l-ESNRHSIKDFLRELNLDFdqYN.T....................VSG...EEK..QDIIFKLSQL.......................SETNGVPINQLYNFFYIDTPIFEMNTFIITELLKKISN.SKSILDDL....DN.QT.....ISN..P....PPIIA.....EYY............AS..............D..L.SH...KQ............S.................ISQ...K...MLTIKNYSGLLAQRGWYEWRI..QH..L..LGLQN..VLQENITIL....NEE.LEKISEDLENV.KNIKNRTDSIRA...SIRREIRLLKElp......aakYNKESTL.............ND.KINIENLK.QELM....ANG....IKLE..-...........-...........-.-EYTTLKTKK.EGLL...LY...VKEMN.DKITSVR.KEISALA...ADTM.....K.GK....VF..T.TY.DIS.RLK....................M.....KFSLLQNITN.VKFVS.MV......................NST..LQIKL...NIK...M.--------fpvinvemrn...............................................................................
W4YQ16_STRPU/177-477                   ......................................fgas------SVEDFLQMF-FKF..ND.L....................-PI...GKR..SIMCPSKINE.......................----PTTLSSQLENACLVKPKADMYEWAIKFFTPAVEE.LRNSVRSQ....DT.EQ.....LKE..G....APIIK.....EMQ............SA..............D..P.KR...CA............E.................ILK...K...GKSLQKYCTASSKAKMKEWRL..QM..I..NNTKA..AMEDSSRHL....ENK.LAKLTSSICTI.DEQLQQLASVDS...ALDDAINSLEQ...........IKLPTEE.............EK.SEWVAN-S.QRLE....SME....TKLR..E...........E...........E.RTVQETESER.KRLE...AE...INSIE.ASTTKLE.AEQEELS...KLGT.....-.GI....SQ..T.DL.ELK.DMK....................S.....DIVLLHSFQE.WRLQA.FL......................ENN..YKFSF...LNK..sI.LLNIQ---fgd......................................................................................
A0A1U7LQ09_9ASCO/622-916               ....mikvmtpkrtertplmevnllkrtrdvddepspiqkkr-------------------..--.-....................---...---..----------.......................---------------RITLPTLELYQHSCRELKNYITE.GTNMCAQI....EH.DI.....FEE..Q....PEMFR.....EYI............RA..............D..L.ET...RS............I.................MDA...Q...FRLIKNYTRAQARGVWYVWRE..KL..L..EGLLV..GLRDGLKNL....VED.ESILKDEKDKV.NGVMPEIREHHS...ELKVRLAEAKR...........RKVAFME.............MD.KEEMDRIA.VRIK....VAE....TEAF..T...........R...........K.EEAMSIQQEV.ASIT...EK...VKAVE.TQIQQAQ.NEIVSAE...KVCE.....E.NR....PV..D.FS.QVI.LLR....................G.....KLEWIERCTG.WKVLK.AS......................TGI..LVLKF...KDE...V.KVVFS---hgr......................................................................................
A0A0D2ALJ7_9PEZI/657-977               ..........................................EEGEKISLQDFLNMTNIRF..MD.L....................TTT...KRR..HTGYPGADRKltsg..............ldnevEEHEAPSLENIIAAAAGTLPVLSMYQHMCNEMKNYISG.GREELEIL....AA.EV.....YEN..Q....PPLFR.....EYL............SA..............P..P.EE...RN............I.................MDN...Q...FKNMKTNARLQSKAGWHGWRA..QL..L..GELKK..GLEQTVWEF....SKD.AEILTKQEAVL.ADELPPLEERFE...DLSAQAQLLQQ...........RADEEAS.............YD.REELEQAR.ERLV....ETD....KDIS..A...........K...........K.KLLAQLQADL.AETT...SR...IEAVS.ERKAECL.EEIKAAE...RVLE.....E.FR....GW..E.AE.EVA.QLK....................A.....KVDKLEREHG.WSIVS.ASs....................mPNT..VTLRY...MSD...L.ELFLHPD-s........................................................................................
E9EMZ7_METRA/920-1233                  .........................................a-DNERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..LTVAPKSLHDgs...................sgDGEDDMSLERCVIAGACTVPMLELYQHSCRELKNYIAE.GRRMVKEI....ED.ET.....YEI..N....PPLFR.....EYM............CA..............T..P.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..EGLKE..GLISISEGM....DAD.EQMLKEREELL.AAVLPGALERHE...QLEEESENLDE...........AAKELAD.............CD.PAELQAAR.DELT....DLE....ADIE..A...........K...........K.RLIGELRGQL.ESST...SE...AEELA.AEKQSLM.TSIQQSE...KIRE.....A.CR....GW..T.GS.EVE.SLK....................S.....HVDALEEEHG.WAVTG.LS......................GTS..LSMAY...KRE...I.EVVFDVA-s........................................................................................
A0A0D2Q3C6_9AGAR/791-1099              ...................................eeqeedv----------FLSMTGIKF..MD.E....................LTA...PRR..SVHPSQQPLRq.....................pRNPADIALAEYVAAMAIDIPQLELYTRVSMDLQAWIAK.SKIVFAEA....EE.EA.....AKV..T....PELFV.....EYA............RA..............D..E.EG...QA............E.................LLH...Q...LNLIRTHTRYLARSDWYDWKL..QW..V..EGLRV..TADEAFTSL....END.ARMLEEPKKIA.AEIIPDLEKEYE...DLIRELEQEQA...........EVAEIEG.............GD.QDYLNELK.ATIA....EQN....IEIE..A...........L...........K.AELAEGSDQV.RWLQ...ER...AKELD.FQAREAK.NTITTAE...RALR.....L.KQ....TS..T.RS.EVF.RLK....................D.....ELEALEDLHM.CRITK.VS......................ADL..FEYVY...SSL...F.QVSIPCKN.........................................................................................
G8YQ26_PICSO/630-940                   .........................................e-AYSPVTLYDFLRDISIRF..YD.Dl..................eIGT...KQV..DRISLSLTKI.......................NENEDWPFNDYVEAMN-KIPLLELYDFSCKELSKNINE.GKTMFEQF....DE.VT.....REN..N....PKLFR.....EYY............SA..............G..P.NE...QL............G.................MKS...E...FQLIKDYARQQSKEVWYSWRT..QL..V..HNLFD..QLMDRCDLL....LQD.KDILQDSLATI.NEMFDEITAKKN...MLMQRLTSFES...........FESQCDS.............IT.DDDLDSMQ.KELE....SCK....EKYH..Y...........L...........K.EVEMERQLRL.EEIS...VK...IQKNK.ELISTFN.KEINEHE...KIIN.....D.NR....KY..E.KS.EID.QLK....................T.....KYNMLQSITN.LKYNS.MK......................QNV..ISFTF...HNT...L.NIKMDFS-d........................................................................................
Q3ADU7_CARHZ/25-171                    ....................................rivgnt-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..--NAAVEEL....RSD.VNGLKSDVNGI.KSDVSNLKSDIN...ELKSDVSNLKS...........DINELKSd...........vSNlKSDVNELK.SDVS....NLK....SDVN..E...........L...........K.SDVSNLKSDV.NELK...SD...VNELK.ISNQQIK.EEIAEIK...MTLK.....E.HG....EK..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------ldyallklinhdvklhnlk......................................................................
H8ZAX4_NEMS1/343-551                   ....................................tglssi-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.-D...RN............A.................LLS...K...LRQMKSDARKEGKAHWHKKRL..TV..E..KEFLN..ETERIFNDF....EKE.KGSLLEKIERL.KEGVKKID--LS...GLENKEKSMKK...........VLQTIGS.............LS.QEEVNGFM.KEVE....TNK....EEEV..I...........L...........K.EKLNGLTSTL.CSLK...EK...NDEIT.EIIEREK.AEIQNIQ...ESLL.....-.VE....EV..Q.KD.DLE.QVK....................S.....AVQRMEVILG.VKILE.IS......................HSR..LLFSI...CDL...-.--------vitviydgtn...............................................................................
A0A2C9JB98_BIOGL/301-462               ......................................tfdd-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..--LVK..VIPKLLRQS....NKD.KENILENKQNI.YNIKEDINSKQQ...NIISIKDGLDT...........NSQN-IN.............II.KDNLENSR.QNIK....NIT....DDLN..A...........K...........K.QNIASHNDEL.NTLR...ES...VNSLE.TQLANFS.TALRQIK...EEIE.....K.GP....PI..S.CR.QIN.CTH....................N.....RVN-------.-----.--......................---..-----...---...-.--------vkllsglkvmcdtktdgggwii...................................................................
F7VXL3_SORMK/922-1234                  .........................................d-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPGASRNs....................tsAEDKDVTFESCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVRDI....ET.ET.....FVE..N....PPLFK.....EYI............SA..............T..P.EL...KL............L.................MDN...Q...FKNVKSHARLLSKAMWYEWRM..KL..Q..EGLKE..GLFKISEGM....DKD.DELLGKQQELL.SSVLPGLTKRYG...ALERELENLED...........VERELED.............CD.PEDLAAAR.AELS....ELG....KTIA..E...........K...........S.KRVEELRQQV.EEYQ...TG...VQSLA.DQKHQCL.EEITAAD...KIRE.....E.CR....GW..S.ST.EIS.SLK....................A.....RVDELEQKSG.WAINK.IE......................GSV..MFMTY...KQE...I.ELAFDLT-s........................................................................................
G2R2Z2_THITE/944-1232                  .........................................d-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVMPGASRDgt...................aaDGKDDLSLERCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVREI....ET.ET.....FEE..N....PPLFR.....EYM............TA..............S..P.EF...KV............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLLKTAEGM....DDD.DRVLAKEQEHL.SSVLPDLVKRLE...ALETEHENLEA...........LAQELAD.............CD.PQDLEDAR.AELA....AVD....KSIA..E...........K...........T.KKLEELRREL.DESA...ES...VEALA.QQKQQCL.EDIRQAD...KIRE.....E.CR....GW..S.AE.EIK.KLK....................G.....RAGLLKR---.-----.--......................---..-----...---...-.--------tadar....................................................................................
W4KQB8_9HOMO/732-1046                  .........................................n-NEPPISIEQFFAMTGVRF..MD.E....................LAA...PRR..STVFPSQLQGrr..................rssLSEANIPLADYFAAMTVDVPQLELYSHVAKDLQAWIDH.SKDIYQQA....EE.EA.....AKI..T....PALFR.....EYS............QA..............D..E.DV...KE............E.................LLH...Q...LKLIKSNNQATARSQWYDWRL..QW..V..EQLQA..AADSGFSNL....QKD.AESLENVISEA.QDMLPAMRAEHA...KLMQELQEEQA...........IADEIDN.............SD.QDYLNELK.NTIS....DQA....LALE..A...........F...........R.ADVAETQAKH.DRLQ...EK...LDEIE.AEKKEAM.KAIEESK...RLID.....I.QN....NS..T.EA.EAF.RLK....................A.....ELDALEQINL.WRVAK.VS......................PQL..FDLVY...ASL...F.RVTVPCE-k........................................................................................
B0CP32_LACBS/763-1074                  .........................................d-DLPVISISQFFSMTGIKF..MD.E....................LTA...PRR..STHPSQQPTRq.....................aRNSSDIPLSEYVTAMAIDIPQLVLYSRVSKDLEAWMEK.SKIVFAQA....ED.EA.....SKV..T....PELFV.....EFS............RA..............D..E.DG...QA............E.................LLH...Q...LNLIRTNTRGLAKSDWYDWKL..QW..V..EGLRL..TGEKAFKAL....ESD.ARALEGLNALA.DDLVPVLEKEYE...AIMKELEKEQA...........EVAEIEA.............CD.QDYLNELK.AEIA....EQN....IEVE..A...........L...........K.AEVIEGNGQH.VWLQ...QR...LKEAE.VDKQETL.AAIATTE...RLLH.....I.QK....NS..T.RS.EVF.RLK....................D.....ELEALENLHM.FRVTT.VK......................ANM..FEYVH...AST...F.RVSIPCRN.........................................................................................
A0A1E3HN69_9TREE/573-882               .........................................e-EPQAISLGAFLEMTGVQF..ME.Gl..................pGMN...RRK..SSAARGVLGQp.....................yGGDREFALHEYTEAQVNHV-FLNMYNWAANKLRDDINT.GNEELLAV....EA.RC.....EED..S....PPVIQ.....EYL............SA..............S..E.ED...RQ............L.................FEM...T...FKSFKTNTHLKAREMWYDWKR..QL..L..ETIEP..EVAGALQGM....QED.AIRLEAINGEL.KDLLPLMRKRKQ...ELEEELVRERE...........AVKEIAQ.............CD.QAELAGYR.EGIA....EQS....AQIT..V...........F...........S.TELNDAQTKL.SALA...SK...LDELL.TKKLECE.AAIAHAK...S---.....Q.CD....QF..T.RS.DAV.RLQ....................E.....EYTSLQHLHL.WRPLK.TL......................PNH..LSLSY...DNE...I.SVSFSCL-n........................................................................................
Q5K7X6_CRYNJ/607-916                   .........................................e-QPQDISLAAFLEIAGVQF..ME.Gl..................pGLN...RKR..SSVAKEILGQs.....................yANERDFALHEYTEAQVNSI-FLNMYTWASNKLFQDIQT.GDEELTAV....AA.RC.....DID..S....PPVIQ.....EYL............AA..............S..D.ED...KQ............L.................FEM...T...FKSFKTNTHLKAKEMWYDWMW..QL..L..ETIKP..DVETVLMGM....KED.KKRLTAFEEQA.VVLLPQLRARKI...EVESKLVEERK...........AVVEIES.............CD.QAELAAYK.EAIA....EQS....AQIT..N...........F...........S.TEVADLKDEL.ATLT...GK...LEELN.AKKHEYE.TAIAHAK...G---.....Q.CD....QF..T.RS.DAI.RLQ....................E.....ESISLQHLHM.WHPTK.IL......................PER..MELTY...DAE...I.LLSINCSN.........................................................................................
E1Z4S1_CHLVA/978-1259                  ........................................mp---PPMTFQDFAKLTEVQF..LD.N....................L--...RRG..ASINYADLQP.......................-NPVPQNLAEAYRLLTIISPQVTTLENGIRILQEEVQA.RRVSAADA....EQ.LV.....GQL..N....PAAFQ.....KAQ............AA..............D..E.DG...LE............V.................LRG...H...VGLLKKVCRQKAVYCLKDVRR..QM..E..ESRGS..RLRHNLEVL....QAD.LAFAQASREQL.EEVARAAQQYVA...EQHSRMAEEEQ...........AHRD-EA.............ER.RSAVLGMR.RSIE....EET....AANE..E...........R...........R.RRLQEAQERV.AQLR...EE...HAVLS.REREALR.SRTDALQ...MTLM.....Q.SQ....G-..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------regvgressplailqkledldvlka................................................................
K9FMP0_PEND2/839-1165                  .........................................v-EVESIQLQEFLKMTNIHF..ME.L....................TTT...KRR..HTTAPGSAIKkltrp.............sseniPKLGSITFEDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQVIRSI....EA.ET.....YAE..N....PALFK.....EYV............TA..............P..P.DI...RV............I.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..EGLKE..GLIRHAEEM....KAD.DNLLSEREDLL.NRNVPLLVEKHA...SLEQEATTLQQ...........LVEEMDN.............CD.QDELRSAR.SKLS....EVD....SEIA..A...........K...........R.RELERLQAEV.QEKT...TF...IEAGA.EMRHEYL.AQIQEAE...RMKE.....E.CR....GW..S.AR.EIN.ELK....................T.....SVQRIQQQTG.WSIVS.AStps...............daseGPL..LKMAY...RDQ...L.QLEFYPG-a........................................................................................
A0A1E5LD70_9BACI/4-176                 ....................................ehflml-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..--LNN..ALDQKLDPI....KND.ISELKTDVSEL.KTEVSNLKNDVS...ELKTEVSNLKT...........DVSELKTe...........vSNlKTDVSELK.TEVS....NLK....NDVS..E...........L...........K.TEVSNLKNDV.SDLS...ED...VIIMK.ADISSLK.TNID---...-RLQ.....H.DM....VI..V.KS.EIA.SLH....................E.....KVTVVDSEQK.SHFKH.I-......................---..-----...---...-.--------ehilstdqrvierisfki.......................................................................
A0A1Y1YX26_9PLEO/62-373                ..........................................EDVERISLQEFLDMTKIRF..MD.L....................STT...KRR..HTAAPQAFHDk.....................eIDETEDSLDRYVVAAACTLPEFELYQHACHEMKKFISD.GRHFVRTM....EA.NV.....MEE..N....PLLFS.....EYL............TA..............P..P.DQ...RI............I.................MDN...Q...FKNLKTSARLEARGEWYGWRS..TL..L..RDLKA..GLLGTMSGF....NRD.ESVLAEQEKLI.DAVLPGLAEQHG...QLDTQCKQLQQ...........RHDELNS.............CD.REELEQAR.EQLL....TTD....AELE..E...........K...........R.QLVARLQEEL.ATKE...AR...IEAVK.DRKIECV.HEIKAAE...RVRE.....E.CR....GW..S.TS.EVN.DLK....................A.....KVTALEQAHG.WSITT.AS......................SSA..ITMTH...LSD...L.ELYFQPA-a........................................................................................
Q0CRL4_ASPTN/979-1302                  .........................................p-EFEPIQLQDFLNMTNIHF..ME.L....................TTT...KRR..HTTAPDSATKraar..............lsgenSKTSAANFDDCVAAGFCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ET.ET.....YAD..N....PPLFK.....EYM............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKATWYEWRM..KL..L..DGLKE..GLNRHVEEM....NAD.EALLAKHEALL.NGAVPALVEKHA...SLEQEATNLQQ...........LADEMEN.............CD.QDELRSAR.EKLV....SVE....EEIA..A...........K...........K.RQLQELQNEV.QDKT...DT...IETGA.ELKAEFM.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIN.ELK....................A.....SVDKIERQTG.WSIVS.ATan.................sttGPL..VTMSY...RNQ...L.QLSFSPR-s........................................................................................
E9DCB7_COCPS/995-1318                  .........................................t-EFKPLQLSEFLKMTNIHF..ME.L....................NTT...KRR..HTIAPDAEKRrit................evdgQVTESISLEDCVAAGCCTIPMLELYQHSCRELKSYISE.GRQIIRSI....EA.ET.....YAE..N....PPLFQ.....EYI............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKQ..GLDHHVEEM....NRD.SEALSKKEKLL.DDVVPELVNKHA...RLQVDAHNLEK...........AVEEMKN.............CD.QEELKQAR.ERLR....MID....LEIA..Q...........R...........K.EDLNKAQSDL.EKTS...NI...VNKGT.EQKAKLL.KDIQEAE...SILE.....E.CR....GW..S.VN.EVD.SLK....................A.....VVRNLEKSSG.WTIIS.VSsgs...............gtkyGPA..LSMRY...SNE...L.RLDFHPA-a........................................................................................
A0A0U5GP06_9EURO/1-207                 ..........................................-------------------..--.-....................---...---..----------.......................--------------------------------------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................MDN...Q...FRNVKTHTRLLSKATWYEWRM..KL..L..EGLKD..GLDRHMEEM....KGD.DNLLSKHEALL.NDAVPALAAKHS...SLREEATRLQQ...........LADELEN.............CD.QGELQSAR.SRLS....SIE....DEIA..A...........K...........K.KMLEELQSEV.QDKT...DT...IETGI.ELKAELT.AQIQEAE...RVKE.....E.CR....GW..S.AK.EIR.ELK....................D.....SVYRIEQSTG.WSISS.ASpse................saaGPV..LTMSY...RHQ...L.ELKFHPG-s........................................................................................
SP105_YEAST/450-761                    ........................................pt---QDYTLREFINEVGVGF..LD.T...................kLID...DLD..KKVNFPLNSF.......................NFVENQRIDNVFSAFYIDIPILEVEAFRCKELWRSINE.SKDKFKDF....EA.QI.....DKS.hP....PLLLQ.....EYF............SS..............D..E.KM...KQ............L.................MRD...Q...LQLVKGYSKLEAAMEWYEWRK..KQ..L..NGLEL..ILAENLNTL....KRE.YEKLNEEVEKV.NSIRGKIRKLNE...AIKEEIRSLKN...........LPSDSYKp..........tlMN.RIKIEAFK.QELM....EHS....ISLS..-...........-...........-.-SSNDFTQEM.RSLK...LA...IAKKS.NDILTLR.SEVASID...KKIE.....K.RK....LF..T.RF.DLP.KLR....................D.....TLKILESLTG.VRFLK.FS......................KAT..LSIAF...LQLd.dL.RVDINLA-n........................................................................................
A0A2B7Z4E0_9EURO/981-1304              .........................................p-EHNSIHLQEFLDMTNIHF..ME.L....................TTT...KRR..HTLAPDSNKIrvv................hsgdGIAKEISLEDCVAAGVCTVPMLELYQHSCRELKSYISE.GRQIIRSI....ED.ET.....YAD..N....PPLFQ.....EYA............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKTHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEEM....KHD.EAVLAKREELL.TSVVPDLVEKHS...KLEVEARNLQQ...........LADEMES.............CD.QEELRRTR.ETLA....AVD....AEIA..T...........K...........Q.KRLEEAQEQL.QGST...NV...IDAGA.ELKTEFL.AQIGEAE...RVRE.....E.CR....GW..S.VK.EVQ.SLK....................A.....SVHNLECQTG.WTILS.VKcgq...............nskyGPI..VSMKY...RDE...L.QLDFHPG-a........................................................................................
W6ZF36_COCMI/756-1067                  .........................................s-EVERISLQDFLDMTKIRF..MD.L....................STT...KRR..HTAAPSAFHDv.....................eVEEKEESLDRFVVAGACTLPEYELYQHACHEMKKYISD.GRHFVRTM....EA.NV.....LEE..N....PLLFS.....EYL............TA..............P..P.DQ...RA............V.................MDN...Q...FKNLKTNARLEARGEWYTWRS..TL..L..QDLKT..GLLHTMDGF....KRD.ESALINQEQLL.DVVLPPLVEKKE...LLSTECKRLQQ...........RHDELNS.............CD.REELEQTR.EKLT....ATD....AELE..E...........K...........K.RLLAQLQKEL.ADKE...AR...IEAAK.SRKVECI.EEIKAAE...RMRE.....E.CR....GW..S.TS.EVS.NLK....................A.....QVAAMEQAHG.WSITS.AS......................STS..ITMTH...LND...L.ELYFVPS-a........................................................................................
C1N444_MICPC/1049-1310                 .......................................ggv-----VELETFLHACEVSF..ME.A....................-RN...LRR..KSLAMESLSN.......................-APPPSNVYEGLKLVCLTAPMIEALEPMHEHLSDALAS.DAKDIDRL....KL.DV.....ERA..Q....PPLLR.....LAS............SD..............D..P.AH...VA............A.................LQR...A...GKMLKKECQLAAKDDFTSHRL..LT..E..RAVAE..SLVVAAAAL....QRT.ETSLTHSREIA.AEACAAADAHEA...DLRERIDACGD...........AAAS---.............--.RDRLLTTR.RGLLaalaQRR....RLVD..D...........A...........K.RKLRETNDDV.VAMT...RR...GGVVQ.AEHSRFS.AQLEEAR...AVAA.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------qkgvelped................................................................................
A0A060SMZ6_PYCCI/896-1096              .........................................d-DGPAISIEQFFQMTGIRF..MD.El..................tMPK...PRR..STVLPGQLRPrarrrsstath.dlavssgsamgEGEEAIPLAEFAVSMAVDMPRLDLYAAVTRDLTAYIQE.CKKIYREA....EE.EA.....LKV..T....PSLFK.....EFA............SV..............D..E.TE...QS............M.................LIH...Q...LKLIKANNIGTAKSQWYDWKL..QW..V..EQLYE..SAAQGFSNL....ESD.ATYLAGVIKEA.QDILPALRED--...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------te.......................................................................................
A0A0C3D2Y8_9HOMO/700-1013              ..........................................EEGPQISIEQFFEITSIRF..MD.E....................IAA...PRR..SIAYPSVLRPpr...................rtSNEVQIPLAEYVVAMAVDVPQLELYTHVSKDLQAWIER.IQGIFREA....EE.EA.....LKM..T....PQLFQ.....EFV............ST..............D..E.SG...QA............E.................LIH...Q...LKLIKVHNHEQAKSEWYDWKM..KW..V..EQLYQ..KASEGFQDL....EGD.AKFLEEIIHRA.QDIIPSLQQEYD...QLMEELEREKA...........DVAELEA.............CD.QDYLNELK.GSIA....EQS....AELE..T...........Y...........R.RDVEEAKGKL.ERLQ...EK...LEEVQ.IQRADVS.SAIEGTE...RHIH.....V.QK....NS..T.GA.EVF.RLK....................D.....ELEAVQNLHM.MAITK.VQ......................PNL..FEFVY...ASC...Y.RVSVPCAQ.........................................................................................
A0A0L0NBI9_9HYPO/955-1268              .........................................v-DEEKIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTVAPGSLQDgt...................taDGQDALSLDRCVVAGACTVPMLELYQHSCRELKKYISE.GRRMVKEI....EN.DT.....FEE..N....PPLFR.....EYM............SA..............T..A.DV...KA............L.................MDN...Q...FKNVKTHARLLSKAMWYEWRM..KL..Q..DGLKE..GLVSIAEGM....ESD.HSVLQEQQELL.ASVLPAVVERYE...ALEEEINNLKE...........AARELAD.............CD.PTELRSVR.EELT....GLD....ADIA..N...........K...........K.QMIAELRKQL.QEST...VD...VEALT.AKKQGYL.EDIEKSE...KVRE.....E.CR....GW..T.SR.EVN.ALK....................A.....RVDAIENQHG.WAVTG.LS......................KTT..LSMAY...KRE...I.ELVFDIA-s........................................................................................
M5BLY7_THACB/109-180                   ..........................................DDVPTISASEFLKMTRISF..MD.G....................LTV...KRR..STIGLGILSRrr...................sgEKELVPGVADYVTAMTIGIPQLETYNYV----------.--------....--.--.....---..-....-----.....---............--..............-..-.--...--............-.................---...-...---------------------..--..-..-----..---------....---.-----------.------------...-----------...........-------.............--.--------.----....---....----..-...........-...........-.----------.----...--...-----.-------.-------...----.....-.--....--..-.--.---.---....................-.....----------.-----.--......................---..-----...---...-.--------sy.......................................................................................
Q7SFZ1_NEUCR/945-1257                  .........................................d-DGERIHLQDFLNMTSIRF..ME.L....................TTT...KRR..HTIAPGASRDs....................tsAEDKDVTFESCVVAGACTVPMLELYQHSCRELKKYISE.GRRIVRDI....ET.ET.....FVE..N....PPLFK.....EYI............SA..............T..P.EL...KL............L.................MDN...Q...FKNVKSHARLLSKAMWYEWRM..KL..Q..EGLKE..GLFKISEGM....DKD.DELLRKQQELL.SSVLPSLTKRYG...ALERELENLEA...........VEKELED.............CD.PEDLEAAR.AELT....ELD....KTIA..E...........K...........S.KKIEELRQQV.EEHQ...TG...VQSLA.DQKQQCL.DDITAAD...KIRE.....E.CR....GW..S.LT.EIS.SLK....................A.....RVDELEEKSG.WAINK.IE......................ASV..MFMTY...KRE...I.ELAFDLA-s........................................................................................
C6H8N0_AJECH/1023-1347                 .........................................r-QVEPIQLQEFLNMTNIHF..ME.L....................TTT...KRR..HTLAPTNDNKkats...............ktddETARGISFEDCVVAGLCTVPMLELYQHSCRELKSYISE.GRRIIRSI....ET.ET.....YAD..N....PPLFQ.....EYV............TA..............P..P.DI...RL............L.................MDN...Q...FRNVKAHARLLSKSMWYEWRM..KL..L..EGLKE..GLDRHVEYM....QND.DAVLSKKEEIL.NCAVPPLVEKHT...KLETEARNLQQ...........AVDELEN.............CD.QEELRQAR.ERLA....ALD....ADIV..T...........K...........K.ELLEQSQAEL.LNKN...NV...IKAGT.QLKNEFL.AQIGEAE...RVRE.....E.CR....GW..S.VK.EVK.PLK....................V.....SVHALECQTG.WSILS.ASlkp...............sskyGPS..LRMRY...RNE...L.QVDFYP--gt.......................................................................................
W1QBC7_OGAPD/427-731                   ..........................................DDYVHVTLPQFLNQVQVQF..YD.N....................IGP...SER..ELTVTSEG--.......................--SGSQALHKYVDAVT-EFPNFDYFYHLIAQRKSGIDR.SQRSINDF....SE.AI.....INN..N....PTSVR.....EFY............ES..............T..D.EV...QK............D.................LKV...N...YQALASLARTIAEHGNLVFMT..NS..L..EGLLK..SYENRKASV....NSQ.VADMEEIRAAF.TSEYQKSVKRKA...DLTKTLALLQD...........RQKNFAN.............VD.LDKLELLK.SRVE....AAQ....EQNA..R...........L...........R.EAKAKLQKEI.AEKE...EI...FKLVS.TQLLEAQ.EEDKRLK...KRVM.....E.LK....LP..S.QN.ELD.LLQ....................Q.....QFVDLQRTTQ.VELLV.LN......................EKE..FKVQI...MKE...L.QISVDLS-t........................................................................................
A0A0H5C7N5_CYBJA/480-784               ..........................................EEYEPVSLDQFIGDLSIEF..FD.D....................LNI...NED..FTAEIQPLSN.......................--PKSANLLDFIIAKNVKVPWLELYSFSCDELQKNMNE.LKLLFDNL....SD.EF.....ADE..N....PRIVR.....EYY............ET..............S..S.LK...QQ............K................kLGD...H...LIQMKQYSDHQAEISWYSWRE..KL..L..DELQL..RLDKNLGSL....KSD.CDVLNDLLVQA.DELCESLKEENL...ILESNIESLET...........KKRLYES.............SE.RESLIQTR.KRLL....NEV....NELE..S...........A...........K.AEEKTLQLQL.EKLE...SG...LFDT-.---SSME.ETVNQKR...DLVA.....R.YT....ED..P.YS.RVL.RLA....................S.....NFRILGSVTG.LKLKS.LQ......................GST..LKMVT...NSK...M.ELSYNFS-t........................................................................................
A0A1Z5SWG2_HORWE/923-1245              .......................................kaa---DKVRLQGFLEEAGIRF..MD.L....................TAT...KRR..LTTAPTPSKArrtss............sigiaeDSEPRVTLENAVVAAACTQPEHDMFQHACNELKRYISD.GKKVIKQL....ET.ET.....YRE..T....PPLIQ.....AYL............NA..............S..P.ER...KS............T.................LDA...Q...MRDMKTHARLRSKEMWYAWRS..QL..L..EDLMK..GLSGIGEGL....LKD.DEVLQRAKEIL.DQVIPGMEEKHI...ALQQEAERLEN...........EVQSTSE.............EE.KEELEQAR.SRIV....EVD....SAVE..E...........K...........R.RVLEELERET.EEQD...RM...ANHLE.ESKVEFA.AAIKEAE...RVRE.....A.CR....GV..S.LQ.EIA.DLK....................E.....SIKNLEETYG.WSITS.SSa....................sPPT..ITMTY...KSQ...L.QLFFHP--la.......................................................................................
M5FU62_DACPD/637-952                   ........................................pv---RQLSINEFLEMTGVTF..MD.G....................LAV...KRR..STVGPGILGSvrd................ealdNRGASRAVAEYVSAAAVGIPQLEMYIWACQELKKNIAA.SQETVHNF....DD.QV.....EKS..N....PLLFQ.....DYM............AA..............N..E.EE...RP............L.................MEG...Q...LKIMKAHARLCAKEKWYQWRQ..GL..V..QDLQN..TVTENLTKL....QAD.YEYIQQVQSEL.SISLPELRARHA...ALTEQLGMERR...........NIQEVEG.............DN.AEQVKELR.EGIA....EQN....AQIM..S...........F...........R.SDLAEVAVKT.ERLD...GK...LADIE.EQRRQQL.SVITRAE...QHCQ.....M.LR....SC..T.RS.EVF.RLK....................E.....DYHALERMHL.WQVVK.FK......................AAE..KVFVY...DSR...I.QVTLSP--gk.......................................................................................
#=GC seq_cons                          .............................................p.IpLp-FLshTsI+F..M-.h....................sos...+RR..pThsssshpp.......................ttppshshpchlsAussslPhLELYp+uC+EL+paIs-.G+phlcpl....Es.-s.....hpc..s....PsLFp.....EYh............sA..............s..s.-h...+h............h.................h-s...Q...h+slKsauRL.uKshWY-WRh..pL..l..-sLcp..sLtcthcsh....ppD.tphLpcppphl.ssllPsLhpchp...pLppEhppLpp...........hspElps.............sD.p-cLpphR.ppLs....phc....tclp..t...........p...........+.pplpclpppl.pphp...sp...lcphp.ppKpphh.ppIpcA-...+lp-.....p.s+....sa..o.tp.Elt.pLK....................s.....clctlcp.pG.Wplhs.hs......................ssh..lphta...ppp...l.pl.h..t.s........................................................................................
//
DBGET integrated database retrieval system