GenomeNet

Database: Pfam
Entry: TGT_C1
LinkDB: TGT_C1
Original site: TGT_C1 
#=GF ID   TGT_C1
#=GF AC   PF14809.7
#=GF DE   C1 domain of tRNA-guanine transglycosylase dimerisation
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   CATH:1iq8_A_02
#=GF GA   25.30 25.30;
#=GF TC   25.90 113.00;
#=GF NC   21.90 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12054814
#=GF RT   Crystal structure of archaeosine tRNA-guanine transglycosylase. 
#=GF RA   Ishitani R, Nureki O, Fukai S, Kijimoto T, Nameki N, Watanabe M,
#=GF RA   Kondo H, Sekine M, Okada N, Nishimura S, Yokoyama S; 
#=GF RL   J Mol Biol 2002;318:665-677.
#=GF DR   INTERPRO; IPR032729;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This short region of the tRNA-guanine transglycosylase enzyme
#=GF CC   acts as the dimerisation domain of the whole protein [1].
#=GF SQ   6
#=GS ATGT_PYRFU/361-430        AC Q8TH08.1
#=GS W0I6A9_9EURY/355-424      AC W0I6A9.1
#=GS ATGT_THEON/357-426        AC B6YUR8.1
#=GS C6A0L6_THESM/361-430      AC C6A0L6.1
#=GS ATGT_THEKO/357-426        AC Q5JHC0.1
#=GS A0A075LZE9_9EURY/355-424  AC A0A075LZE9.1
ATGT_PYRFU/361-430                   PITKKSAFFKISEESLKWPIARRAKERAEKVKAKFPESIPHPIFGEIPKYLSLTYPFAQSESEEDFQIEK..
W0I6A9_9EURY/355-424                 PITKSSAFFKVSEEIMRTPTVWRAKQKAEMVKQKFPETINHPIFGEIPKYLSLSYPFAQSEGEEEFTIEK..
ATGT_THEON/357-426                   PITKASAFFKVSEESLKWPIVQRAKARAERVKAKFPETINHPIFGEIPKYLSLSYPFAQSEGEEDFTIEK..
C6A0L6_THESM/361-430                 PVTKASAFFKISEEILKTPVPLRAKIRAERVRRKFQNTLEHPIFGEIPKYLILTFPFAQSEGEEDFSIK-r.
ATGT_THEKO/357-426                   PVTKASAFFKVSEEALRWPIVERARERAERVRSKFPETISHPIFGEIPKYLSLSYPFAQSEGEEDFTVEK..
A0A075LZE9_9EURY/355-424             PITKNSALFKVSEESMKWPIVERAKARAERVRAKFPETMSHPIFGEIPKYLALTFPFAQSEGEEDFTI--pr
#=GC seq_cons                        PITKuSAFFKVSEEuLKWPIVpRAKtRAERV+uKFPETIsHPIFGEIPKYLSLoYPFAQSEGEEDFTIEK..
//
DBGET integrated database retrieval system