GenomeNet

Database: Pfam
Entry: XRN_N
LinkDB: XRN_N
Original site: XRN_N 
#=GF ID   XRN_N
#=GF AC   PF03159.20
#=GF DE   XRN 5'-3' exonuclease N-terminus
#=GF PI   DUF251; 
#=GF AU   Mifsud W;0000-0002-9805-6461
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_2349 (release 6.5)
#=GF GA   22.90 22.90;
#=GF TC   22.90 22.90;
#=GF NC   22.80 22.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF CL   CL0280
#=GF RN   [1]
#=GF RM   8781170
#=GF RT   Requirement of S. pombe exonuclease II, a homologue of S.
#=GF RT   cerevisiae Sep1, for normal mitotic growth and viability. 
#=GF RA   Szankasi P, Smith GR; 
#=GF RL   Curr Genet 1996;30:284-293.
#=GF RN   [2]
#=GF RM   10349620
#=GF RT   Identification and developmental expression of a 5'-3'
#=GF RT   exoribonuclease from Drosophila melanogaster. 
#=GF RA   Till DD, Linz B, Seago JE, Elgar SJ, Marujo PE, Elias ML,
#=GF RA   Arraiano CM, McClellan JA, McCarthy JE, Newbury SF; 
#=GF RL   Mech Dev 1998;79:51-55.
#=GF RN   [3]
#=GF RM   11106401
#=GF RT   Novel features of the XRN-family in Arabidopsis: evidence that
#=GF RT   AtXRN4, one of several orthologs of nuclear Xrn2p/Rat1p,
#=GF RT   functions in the cytoplasm. 
#=GF RA   Kastenmayer JP, Green PJ; 
#=GF RL   Proc Natl Acad Sci U S A 2000;97:13985-13990.
#=GF DR   INTERPRO; IPR004859;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family aligns residues towards the N-terminus of several
#=GF CC   proteins with multiple functions. The members of this family all
#=GF CC   appear to possess 5'-3' exonuclease activity EC:3.1.11.-. Thus,
#=GF CC   the aligned region may be necessary for 5' to 3' exonuclease
#=GF CC   function. The family also contains several Xrn1 and Xrn2
#=GF CC   proteins. The 5'-3' exoribonucleases Xrn1p and Xrn2p/Rat1p
#=GF CC   function in the degradation and processing of several classes of
#=GF CC   RNA in Saccharomyces cerevisiae. Xrn1p is the main enzyme
#=GF CC   catalysing cytoplasmic mRNA degradation in multiple decay
#=GF CC   pathways, whereas Xrn2p/Rat1p functions in the processing of
#=GF CC   rRNAs and small nucleolar RNAs (snoRNAs) in the nucleus [3].
#=GF SQ   4456
#=GS A0A1Y2C8V8_9FUNG/1-177      AC A0A1Y2C8V8.1
#=GS A0A673C7Z9_9TELE/1-227      AC A0A673C7Z9.1
#=GS A0A026VVA8_OOCBI/1-255      AC A0A026VVA8.1
#=GS A0A493U3T8_ANAPP/1-227      AC A0A493U3T8.1
#=GS A0A0L7QSP1_9HYME/1-226      AC A0A0L7QSP1.1
#=GS A0A428TB95_9HYPO/1-228      AC A0A428TB95.1
#=GS A0A2Y9I4D0_NEOSC/1-254      AC A0A2Y9I4D0.1
#=GS A0A4W4G9L5_ELEEL/1-107      AC A0A4W4G9L5.1
#=GS B9R871_RICCO/1-254          AC B9R871.1
#=GS A0A2I0RIT6_9PEZI/1-263      AC A0A2I0RIT6.1
#=GS A0A0C3BBY3_PILCF/1-109      AC A0A0C3BBY3.1
#=GS A0A2G5CMU8_AQUCA/14-269     AC A0A2G5CMU8.1
#=GS K7ILW6_NASVI/1-227          AC K7ILW6.1
#=GS A0A1S2Y4K7_CICAR/1-254      AC A0A1S2Y4K7.1
#=GS A0A383W1T1_TETOB/1-224      AC A0A383W1T1.1
#=GS A0A1S8W4B0_9FUNG/1-255      AC A0A1S8W4B0.1
#=GS A0A6A6MC68_HEVBR/1-254      AC A0A6A6MC68.1
#=GS A0A2C5XDE6_9HYPO/1-104      AC A0A2C5XDE6.1
#=GS G1SGA9_RABIT/1-227          AC G1SGA9.3
#=GS A0A1Y1Y0N8_9FUNG/11-229     AC A0A1Y1Y0N8.1
#=GS C1N8M8_MICPC/71-315         AC C1N8M8.1
#=GS A0A2C5ZEF6_9HYPO/1-222      AC A0A2C5ZEF6.1
#=GS A0A6P9E6Q2_JUGRE/1-254      AC A0A6P9E6Q2.1
#=GS A0A367JYG0_RHIAZ/1-254      AC A0A367JYG0.1
#=GS A0A669CGX0_ORENI/1-254      AC A0A669CGX0.1
#=GS S8A7I2_DACHA/3-228          AC S8A7I2.1
#=GS A0A1J1H2Q3_PLARL/22-284     AC A0A1J1H2Q3.1
#=GS A0A1L8GAL1_XENLA/1-227      AC A0A1L8GAL1.1
#=GS A0A2P8YJ30_BLAGE/1-131      AC A0A2P8YJ30.1
#=GS A0A559M6Q3_9HELO/1-227      AC A0A559M6Q3.1
#=GS G9MDR0_HYPVG/1-170          AC G9MDR0.1
#=GS A0A673CHZ9_9TELE/1-227      AC A0A673CHZ9.1
#=GS D2VA46_NAEGR/1-277          AC D2VA46.1
#=GS A0A2B7XT24_9EURO/1-227      AC A0A2B7XT24.1
#=GS A0A2I4GWW7_JUGRE/1-248      AC A0A2I4GWW7.1
#=GS A0A1D6JAP9_MAIZE/1-231      AC A0A1D6JAP9.1
#=GS A0A067HAI5_CITSI/1-254      AC A0A067HAI5.1
#=GS V7BMD8_PHAVU/1-248          AC V7BMD8.1
#=GS A0A0M9G179_9TRYP/1-251      AC A0A0M9G179.1
#=GS A0A1M2VSK3_TRAPU/1-260      AC A0A1M2VSK3.1
#=GS A0A2P6UZ56_9CHLO/344-447    AC A0A2P6UZ56.1
#=GS A0A663E2T5_AQUCH/1-227      AC A0A663E2T5.1
#=GS A0A195EHK9_9HYME/1-226      AC A0A195EHK9.1
#=GS A0A2Y9JH29_ENHLU/1-227      AC A0A2Y9JH29.1
#=GS A0A2K5JHP2_COLAP/1-227      AC A0A2K5JHP2.1
#=GS A0A545VTQ3_9HYPO/1-228      AC A0A545VTQ3.1
#=GS A0A5D2WM57_GOSMU/1-89       AC A0A5D2WM57.1
#=GS A0A2U1MB98_ARTAN/1-202      AC A0A2U1MB98.1
#=GS XRN1_SCHPO/1-226            AC P40383.1
#=GS XRN2_USTMA/1-261            AC Q4P149.3
#=GS A0A0A1UAI0_ENTIV/116-220    AC A0A0A1UAI0.1
#=GS A0A2R6RBF7_ACTCC/67-116     AC A0A2R6RBF7.1
#=GS B4LVQ4_DROVI/1-256          AC B4LVQ4.2
#=GS A0A699ZN34_HAELA/1-109      AC A0A699ZN34.1
#=GS Q6FL64_CANGA/1-228          AC Q6FL64.1
#=GS A0A507C155_9FUNG/1-227      AC A0A507C155.1
#=GS A0A0N0VDQ4_9TRYP/1-344      AC A0A0N0VDQ4.1
#=GS A0A4Q7KAK4_METCM/1-260      AC A0A4Q7KAK4.1
#=GS A0A401KU98_ASPAW/1-259      AC A0A401KU98.1
#=GS A0A2K6U3J3_SAIBB/1-227      AC A0A2K6U3J3.1
#=GS A0A287SKG8_HORVV/66-260     AC A0A287SKG8.1
#=GS A0A4W3JP83_CALMI/1-254      AC A0A4W3JP83.1
#=GS K2NUF7_TRYCR/1-228          AC K2NUF7.1
#=GS A0A091LJ28_CATAU/3-233      AC A0A091LJ28.1
#=GS A0A1W4WPN4_AGRPL/1-227      AC A0A1W4WPN4.1
#=GS A0A151ZD91_9MYCE/32-133     AC A0A151ZD91.1
#=GS S9U5J9_9TRYP/4-128          AC S9U5J9.1
#=GS A0A0E0HYJ1_ORYNI/1-101      AC A0A0E0HYJ1.1
#=GS F0ZXB4_DICPU/1-126          AC F0ZXB4.1
#=GS A0A0D3D0Y2_BRAOL/1-254      AC A0A0D3D0Y2.1
#=GS A0A0V0UTJ3_9BILA/6-260      AC A0A0V0UTJ3.1
#=GS A0A507B5Y2_9PEZI/1-260      AC A0A507B5Y2.1
#=GS A0A383WIN0_TETOB/1-254      AC A0A383WIN0.1
#=GS A0A0A2JYU1_PENEN/1-227      AC A0A0A2JYU1.1
#=GS A0A5J4Z077_PORPP/4-208      AC A0A5J4Z077.1
#=GS A0A0E0P2G5_ORYRU/96-350     AC A0A0E0P2G5.1
#=GS A0A200Q4R5_9MAGN/1-255      AC A0A200Q4R5.1
#=GS A0A446TII4_TRITD/1-255      AC A0A446TII4.1
#=GS J9HJJ2_9SPIT/1-280          AC J9HJJ2.1
#=GS A0A2B4S237_STYPI/377-627    AC A0A2B4S237.1
#=GS A0A446NWM8_TRITD/1-104      AC A0A446NWM8.1
#=GS A0A392QNV6_9FABA/1-46       AC A0A392QNV6.1
#=GS A0A0G4LJB1_9PEZI/1-260      AC A0A0G4LJB1.1
#=GS E3K529_PUCGT/1-260          AC E3K529.2
#=GS A0A5B6VV56_9ROSI/1-255      AC A0A5B6VV56.1
#=GS A0A2R6Q9G6_ACTCC/1-234      AC A0A2R6Q9G6.1
#=GS W7TMF7_9STRA/1-254          AC W7TMF7.1
#=GS A0A2D3VDB0_9PEZI/1-260      AC A0A2D3VDB0.1
#=GS A0A096MA72_POEFO/1-227      AC A0A096MA72.1
#=GS A0A565B145_9BRAS/1-254      AC A0A565B145.1
#=GS XRN2_YARLI/1-271            AC Q6C961.3
#=GS L8GYH6_ACACA/1-275          AC L8GYH6.1
#=GS A0A2P6TTV0_CHLSO/1-254      AC A0A2P6TTV0.1
#=GS W6L6Q1_9TRYP/8-166          AC W6L6Q1.1
#=GS F0VA25_NEOCL/41-364         AC F0VA25.1
#=GS A0A165AEJ3_XYLHT/1-142      AC A0A165AEJ3.1
#=GS A0A3Q3S9C3_9TELE/1-227      AC A0A3Q3S9C3.1
#=GS A0A453HNA8_AEGTS/5-134      AC A0A453HNA8.1
#=GS A0A178ZHQ6_9EURO/1-262      AC A0A178ZHQ6.1
#=GS A0A3P8X0H4_CYNSE/8-135      AC A0A3P8X0H4.1
#=GS A0A183ET47_9BILA/56-121     AC A0A183ET47.1
#=GS A0A3P7R883_CYLGO/1-142      AC A0A3P7R883.1
#=GS A0A3L8SS42_CHLGU/1-254      AC A0A3L8SS42.1
#=GS A0A1S3LWX1_SALSA/1-227      AC A0A1S3LWX1.1
#=GS K7G845_PELSI/1-200          AC K7G845.1
#=GS D7G4F2_ECTSI/1-253          AC D7G4F2.1
#=GS A0A0D8Y9F7_DICVI/1-255      AC A0A0D8Y9F7.1
#=GS A0A6G0TBZ9_APHGL/1-255      AC A0A6G0TBZ9.1
#=GS S9V5A0_9TRYP/1-248          AC S9V5A0.1
#=GS A0A1E7FVR1_9STRA/10-241     AC A0A1E7FVR1.1
#=GS A0A5J9W443_9POAL/57-310     AC A0A5J9W443.1
#=GS A0A1W0E8K8_9MICR/1-223      AC A0A1W0E8K8.1
#=GS A0A084WPA2_ANOSI/1-227      AC A0A084WPA2.1
#=GS A0A2N5SPL7_9BASI/1-260      AC A0A2N5SPL7.1
#=GS A0A452SJ98_URSAM/1-254      AC A0A452SJ98.1
#=GS U6GRG3_9EIME/65-266         AC U6GRG3.1
#=GS A0A199W6R8_ANACO/8-232      AC A0A199W6R8.1
#=GS A0A445CNT8_ARAHY/1-257      AC A0A445CNT8.1
#=GS Q4DYN0_TRYCC/1-237          AC Q4DYN0.1
#=GS A0A5N6E1Q8_ASPPA/1-257      AC A0A5N6E1Q8.1
#=GS A0A453M1S4_AEGTS/1-186      AC A0A453M1S4.1
#=GS A0A2T0FFU3_9ASCO/1-254      AC A0A2T0FFU3.1
#=GS A0A3M7T6L4_BRAPC/1-257      AC A0A3M7T6L4.1
#=GS A0A1Z5KRK4_FISSO/43-268     AC A0A1Z5KRK4.1
#=GS A7TQ45_VANPO/1-231          AC A7TQ45.1
#=GS A0A665V6F4_ECHNA/1-227      AC A0A665V6F4.1
#=GS M4BVC6_HYAAE/1-185          AC M4BVC6.1
#=GS A0A165KDK2_9BASI/3-224      AC A0A165KDK2.1
#=GS A0A2B7XKT7_9EURO/1-259      AC A0A2B7XKT7.1
#=GS A0A446TIE6_TRITD/1-255      AC A0A446TIE6.1
#=GS A0A061D9I2_BABBI/71-321     AC A0A061D9I2.1
#=GS A0A2K2CQ52_BRADI/1-209      AC A0A2K2CQ52.1
#=GS A0A671WXE8_SPAAU/1-254      AC A0A671WXE8.1
#=GS A0A383VEA9_TETOB/1-226      AC A0A383VEA9.1
#=GS A0A1S7HPA3_9SACH/1-254      AC A0A1S7HPA3.1
#=GS A0A669EC62_ORENI/1-254      AC A0A669EC62.1
#=GS Q4CW10_TRYCC/1-304          AC Q4CW10.1
#=GS A0A0D9YSC6_9ORYZ/1-167      AC A0A0D9YSC6.1
#=GS A0A0J8RFF0_COCIT/16-109     AC A0A0J8RFF0.1
#=GS A0A453M1S7_AEGTS/1-88       AC A0A453M1S7.1
#=GS A0A4D9BYK7_SALSN/1-235      AC A0A4D9BYK7.1
#=GS W4ISF1_PLAFP/45-259         AC W4ISF1.1
#=GS V7CG77_PHAVU/1-254          AC V7CG77.1
#=GS A0A673CI04_9TELE/1-227      AC A0A673CI04.1
#=GS A0A1Z5T7A9_HORWE/1-265      AC A0A1Z5T7A9.1
#=GS I2JXA0_DEKBR/1-165          AC I2JXA0.1
#=GS A0A068QKX0_9VIRU/1-252      AC A0A068QKX0.1
#=GS A0A2K6SLD2_SAIBB/1-254      AC A0A2K6SLD2.1
#=GS A0A3P8V8N8_CYNSE/1-250      AC A0A3P8V8N8.1
#=GS A0A3S2P1B9_CHISP/1-255      AC A0A3S2P1B9.1
#=GS A0A0N8K2T2_SCLFO/1-267      AC A0A0N8K2T2.1
#=GS A0A197JRZ9_9FUNG/1-192      AC A0A197JRZ9.1
#=GS V5HV58_BYSSN/1-227          AC V5HV58.1
#=GS A0A6D2JJV0_9BRAS/1-255      AC A0A6D2JJV0.1
#=GS H6BTC3_EXODN/1-259          AC H6BTC3.1
#=GS A0A0L7K4X3_PLAFX/1-272      AC A0A0L7K4X3.1
#=GS K2RVX6_MACPH/1-227          AC K2RVX6.1
#=GS A0A2J7QVF6_9NEOP/1-227      AC A0A2J7QVF6.1
#=GS A0A446Q744_TRITD/1-174      AC A0A446Q744.1
#=GS A0A1J9QH07_9EURO/1-259      AC A0A1J9QH07.1
#=GS A0A654GSJ4_9CEST/1-139      AC A0A654GSJ4.1
#=GS A0A1B8CHR6_9PEZI/1-227      AC A0A1B8CHR6.1
#=GS A0A482SU95_9ARCH/1-229      AC A0A482SU95.1
#=GS A0A6G0I4Z7_LARCR/1-162      AC A0A6G0I4Z7.1
#=GS A0A5N6Q1E6_9ASTR/1-250      AC A0A5N6Q1E6.1
#=GS A0A267DH31_9PLAT/1-227      AC A0A267DH31.1
#=GS A0A665UMH8_ECHNA/1-230      AC A0A665UMH8.1
#=GS F1MKX7_BOVIN/1-254          AC F1MKX7.1
#=GS A0A4Y8D1X6_9HELO/1-254      AC A0A4Y8D1X6.1
#=GS F4Q1L3_CAVFA/1-147          AC F4Q1L3.1
#=GS J7SB69_KAZNA/1-254          AC J7SB69.1
#=GS XRN1_YEAST/1-227            AC P22147.1
#=GS A0A0P0XZL5_ORYSJ/1-69       AC A0A0P0XZL5.1
#=GS A0A2K6PSM6_RHIRO/1-227      AC A0A2K6PSM6.1
#=GS H9IT93_BOMMO/1-145          AC H9IT93.1
#=GS A0A397G222_9GLOM/1-244      AC A0A397G222.1
#=GS A0A251NRY2_PRUPE/20-268     AC A0A251NRY2.1
#=GS R1CRJ5_EMIHU/1-179          AC R1CRJ5.1
#=GS A0A2X0P8N4_9BASI/1-260      AC A0A2X0P8N4.1
#=GS A0A066XAD5_COLSU/1-260      AC A0A066XAD5.1
#=GS A0A287S1Q5_HORVV/1-194      AC A0A287S1Q5.1
#=GS G9NHM7_HYPAI/1-260          AC G9NHM7.1
#=GS A0A022R9X2_ERYGU/1-255      AC A0A022R9X2.1
#=GS A0A4D8XY37_SALSN/1-237      AC A0A4D8XY37.1
#=GS A0A077ZGF5_TRITR/1-126      AC A0A077ZGF5.1
#=GS W2SKN8_NECAM/15-269         AC W2SKN8.1
#=GS A0A0H5C301_CYBJN/1-101      AC A0A0H5C301.1
#=GS A0A5A9PDI8_9TELE/170-396    AC A0A5A9PDI8.1
#=GS A0A2G4SLA7_RHIZD/1-227      AC A0A2G4SLA7.1
#=GS D7G490_ECTSI/131-361        AC D7G490.1
#=GS A0A059ES26_9MICR/1-66       AC A0A059ES26.1
#=GS A0A0V0X8L7_9BILA/1-227      AC A0A0V0X8L7.1
#=GS E9AD71_LEIMA/1-239          AC E9AD71.1
#=GS A0A0S4JPQ7_BODSA/2-248      AC A0A0S4JPQ7.1
#=GS A0A4W6FTG9_LATCA/1-254      AC A0A4W6FTG9.1
#=GS A0A369S6P7_9METZ/1-227      AC A0A369S6P7.1
#=GS A0A2G5V6T2_9PELO/40-296     AC A0A2G5V6T2.1
#=GS A0A1B8EZZ1_9PEZI/1-227      AC A0A1B8EZZ1.1
#=GS A0A2Z7BZB1_9LAMI/1-254      AC A0A2Z7BZB1.1
#=GS A0A5M6C050_9TREE/1-260      AC A0A5M6C050.1
#=GS A0A3Q1JGU9_ANATE/1-227      AC A0A3Q1JGU9.1
#=GS A0A674C0Z1_SALTR/1-254      AC A0A674C0Z1.1
#=GS A0A1S3YVC2_TOBAC/1-255      AC A0A1S3YVC2.1
#=GS H0ZDX1_TAEGU/1-227          AC H0ZDX1.2
#=GS S2JMG4_MUCC1/1-212          AC S2JMG4.1
#=GS A0A4V6T4M8_MUSBA/1-78       AC A0A4V6T4M8.1
#=GS A0A077Z408_TRITR/1-254      AC A0A077Z408.1
#=GS A0A3R7L1N2_9TRYP/1-242      AC A0A3R7L1N2.1
#=GS A0A1D3D544_9EIME/24-347     AC A0A1D3D544.1
#=GS Q4CX39_TRYCC/6-119          AC Q4CX39.1
#=GS A0A4Z1SWH2_GIAMU/1-248      AC A0A4Z1SWH2.1
#=GS A0A444TWP5_ACIRT/318-546    AC A0A444TWP5.1
#=GS Q0UB95_PHANO/1-227          AC Q0UB95.1
#=GS V9EEG2_PHYPR/1-255          AC V9EEG2.1
#=GS A0A341DEC8_NEOAA/1-227      AC A0A341DEC8.1
#=GS A0A166RSJ2_9HYPO/1-260      AC A0A166RSJ2.1
#=GS B7QH01_IXOSC/1-253          AC B7QH01.1
#=GS C6HE87_AJECH/1-227          AC C6HE87.1
#=GS A0A6Q2XSN3_ESOLU/1-192      AC A0A6Q2XSN3.1
#=GS A0A3M7MJB8_9PLEO/1-260      AC A0A3M7MJB8.1
#=GS U6LTL3_9EIME/3-207          AC U6LTL3.1
#=GS A0A0C3CAL6_HEBCY/1-152      AC A0A0C3CAL6.1
#=GS A0A067RFP2_ZOONE/1-227      AC A0A067RFP2.1
#=GS A0A2K6MIN4_RHIBE/1-227      AC A0A2K6MIN4.1
#=GS A0A1Y1JE13_PLAGO/150-278    AC A0A1Y1JE13.1
#=GS U6MBS9_EIMMA/28-295         AC U6MBS9.1
#=GS A0A5N6F1I5_9EURO/1-257      AC A0A5N6F1I5.1
#=GS T0LBB7_COLGC/1-260          AC T0LBB7.1
#=GS A0A0H2RVV1_9AGAM/1-90       AC A0A0H2RVV1.1
#=GS A0A093XUJ4_9PEZI/1-259      AC A0A093XUJ4.1
#=GS A0A1D6FJM1_MAIZE/23-57      AC A0A1D6FJM1.1
#=GS A0A182G723_AEDAL/1-227      AC A0A182G723.1
#=GS A0A388JQB6_CHABU/22-175     AC A0A388JQB6.1
#=GS A0A3B0K9F7_DROGU/1-191      AC A0A3B0K9F7.1
#=GS E9GTH9_DAPPU/1-183          AC E9GTH9.1
#=GS A0A1Z5T623_HORWE/1-265      AC A0A1Z5T623.1
#=GS A0A423XL86_9PEZI/1-260      AC A0A423XL86.1
#=GS A0A0V1BWV3_TRISP/414-640    AC A0A0V1BWV3.1
#=GS A0A2K6ESR1_PROCO/1-227      AC A0A2K6ESR1.1
#=GS A0A1V2L963_CYBFA/1-227      AC A0A1V2L963.1
#=GS A0A091NBV9_APAVI/1-254      AC A0A091NBV9.1
#=GS W8W1L1_9VIRU/1-141          AC W8W1L1.1
#=GS A0A1R0GWU9_9FUNG/1-226      AC A0A1R0GWU9.1
#=GS A0A0L1I907_PLAFA/45-259     AC A0A0L1I907.1
#=GS A0A3P9QBB0_POERE/1-227      AC A0A3P9QBB0.1
#=GS A0A5N6PVL9_9ASTR/1-254      AC A0A5N6PVL9.1
#=GS A0A665V7G5_ECHNA/1-227      AC A0A665V7G5.1
#=GS V9SGR6_9VIRU/137-232        AC V9SGR6.1
#=GS F1PB11_CANLF/1-254          AC F1PB11.2
#=GS A0A1E5RAE7_9ASCO/1-230      AC A0A1E5RAE7.1
#=GS D8TUT9_VOLCA/1-195          AC D8TUT9.1
#=GS A0A4U0VWK0_9BASI/10-243     AC A0A4U0VWK0.1
#=GS A0A132A7L8_SARSC/1-243      AC A0A132A7L8.1
#=GS A0A1B9GC13_9TREE/8-267      AC A0A1B9GC13.1
#=GS A0A096NVR5_PAPAN/1-254      AC A0A096NVR5.1
#=GS A0A2T7CKC2_9POAL/2-74       AC A0A2T7CKC2.1
#=GS A0A183WGT7_TRIRE/25-177     AC A0A183WGT7.1
#=GS V4TA43_9ROSI/1-254          AC V4TA43.1
#=GS A0A063BZW4_USTVR/1-148      AC A0A063BZW4.1
#=GS A0A099ZFP1_TINGU/1-202      AC A0A099ZFP1.1
#=GS A0A2K1QN91_9PEZI/1-227      AC A0A2K1QN91.1
#=GS A0A452SJ93_URSAM/1-254      AC A0A452SJ93.1
#=GS A0A4D9ESF4_9SAUR/13-248     AC A0A4D9ESF4.1
#=GS A0A2K6DG83_MACNE/109-240    AC A0A2K6DG83.1
#=GS A0A139IH84_9PEZI/1-228      AC A0A139IH84.1
#=GS F6HEH8_VITVI/1-254          AC F6HEH8.1
#=GS A0A5N5NKN5_9ROSI/200-332    AC A0A5N5NKN5.1
#=GS A0A395RQP7_FUSSP/1-228      AC A0A395RQP7.1
#=GS A0A094FIH6_9PEZI/1-227      AC A0A094FIH6.1
#=GS F8WDA0_HUMAN/1-107          AC F8WDA0.1
#=GS A0A6A4NC43_LUPAL/1-254      AC A0A6A4NC43.1
#=GS A0A3B6LR47_WHEAT/1-147      AC A0A3B6LR47.1
#=GS A0A087WQ18_MOUSE/1-40       AC A0A087WQ18.1
#=GS A0A0J7K6X8_LASNI/105-197    AC A0A0J7K6X8.1
#=GS A0A5C3L4H2_9AGAR/1-227      AC A0A5C3L4H2.1
#=GS A0A094AVR8_9PEZI/1-259      AC A0A094AVR8.1
#=GS A0A2J7QVG3_9NEOP/1-227      AC A0A2J7QVG3.1
#=GS H3AKR8_LATCH/1-227          AC H3AKR8.1
#=GS K0KTQ3_WICCF/1-227          AC K0KTQ3.1
#=GS A0A4W6FRX4_LATCA/1-254      AC A0A4W6FRX4.1
#=GS A0A2R8FCT6_9VIRU/84-177     AC A0A2R8FCT6.1
#=GS A0A5B0P5E6_PUCGR/1-191      AC A0A5B0P5E6.1
#=GS L8H1S3_ACACA/1-81           AC L8H1S3.1
#=GS A0A1D6PUT5_MAIZE/1-254      AC A0A1D6PUT5.1
#=GS Q6K2K4_ORYSJ/1-229          AC Q6K2K4.1
#=GS A0A2G3AJV2_CAPAN/1-254      AC A0A2G3AJV2.1
#=GS Q4QJ53_LEIMA/1-228          AC Q4QJ53.1
#=GS A0A1B9GXB5_9TREE/8-267      AC A0A1B9GXB5.1
#=GS A0A669BQH5_ORENI/1-227      AC A0A669BQH5.1
#=GS A0A3R7MJ20_PENVA/1-227      AC A0A3R7MJ20.1
#=GS A0A287SKG3_HORVV/1-184      AC A0A287SKG3.1
#=GS A0A517L0M0_9PEZI/1-227      AC A0A517L0M0.1
#=GS A0A452QNR8_URSAM/1-177      AC A0A452QNR8.1
#=GS A0A1S3LVY0_SALSA/1-227      AC A0A1S3LVY0.1
#=GS A0A448ZAR6_9STRA/284-688    AC A0A448ZAR6.1
#=GS A0A0V0X896_9BILA/1-227      AC A0A0V0X896.1
#=GS A0A671E279_RHIFE/1-227      AC A0A671E279.1
#=GS A0A4W4F501_ELEEL/1-254      AC A0A4W4F501.1
#=GS A0A674NUW3_TAKRU/15-259     AC A0A674NUW3.1
#=GS A0A287LYE2_HORVV/1-254      AC A0A287LYE2.1
#=GS A0A328DZ44_9ASTE/1-250      AC A0A328DZ44.1
#=GS A0A453M1U1_AEGTS/8-262      AC A0A453M1U1.1
#=GS XRN2_CHICK/1-254            AC Q5ZIP4.1
#=GS A0A1C1CF09_9EURO/1-265      AC A0A1C1CF09.1
#=GS A0A0B7NCD2_9FUNG/471-699    AC A0A0B7NCD2.1
#=GS A0A1Y2CP01_9FUNG/127-255    AC A0A1Y2CP01.1
#=GS A0A210PHS3_MIZYE/1-255      AC A0A210PHS3.1
#=GS A0A446NWN3_TRITD/1-254      AC A0A446NWN3.1
#=GS A0A3B6KJY3_WHEAT/1-265      AC A0A3B6KJY3.1
#=GS A0A6I8SI98_XENTR/1-254      AC A0A6I8SI98.1
#=GS A0A286U9W3_9AGAM/1-227      AC A0A286U9W3.1
#=GS A0A3B6H2I0_WHEAT/1-233      AC A0A3B6H2I0.1
#=GS M3JTD0_CANMX/1-226          AC M3JTD0.1
#=GS A0A1V8V4U2_9PEZI/1-262      AC A0A1V8V4U2.1
#=GS A0A1X0P557_9TRYP/1-233      AC A0A1X0P557.1
#=GS A0A672FH60_SALFA/62-215     AC A0A672FH60.1
#=GS A0A4W3K1X8_CALMI/1-254      AC A0A4W3K1X8.1
#=GS A2E007_TRIVA/1-107          AC A2E007.1
#=GS A0A287SKF5_HORVV/86-281     AC A0A287SKF5.1
#=GS A0A0G4PWQ4_PENCA/1-227      AC A0A0G4PWQ4.1
#=GS A0A0P1AH50_PLAHL/1-255      AC A0A0P1AH50.1
#=GS A0A1Y1W9S8_9FUNG/1-237      AC A0A1Y1W9S8.1
#=GS A2EMZ4_TRIVA/1-256          AC A2EMZ4.1
#=GS A0A4S4DAF4_CAMSI/1-87       AC A0A4S4DAF4.1
#=GS A0A287S1R8_HORVV/1-255      AC A0A287S1R8.1
#=GS A0A4Y9ZVU1_9AGAM/1-260      AC A0A4Y9ZVU1.1
#=GS A0A6I8Q8U4_XENTR/1-227      AC A0A6I8Q8U4.1
#=GS A0A453LGJ2_AEGTS/1-31       AC A0A453LGJ2.1
#=GS Q4QE76_LEIMA/1-339          AC Q4QE76.1
#=GS A0A232FF30_9HYME/81-306     AC A0A232FF30.1
#=GS A0A212CI89_CEREH/1-202      AC A0A212CI89.1
#=GS A0A177WJS7_BATDL/1-219      AC A0A177WJS7.1
#=GS A0A095C8E0_CRYGR/23-162     AC A0A095C8E0.1
#=GS A0A453M1S3_AEGTS/1-255      AC A0A453M1S3.1
#=GS S7PGB4_MYOBR/1-192          AC S7PGB4.1
#=GS S9UNL0_9TRYP/1-207          AC S9UNL0.1
#=GS M2W0S3_GALSU/1-225          AC M2W0S3.1
#=GS A0A5D2V1S8_GOSMU/1-254      AC A0A5D2V1S8.1
#=GS A0A151ZT28_9MYCE/1-210      AC A0A151ZT28.1
#=GS A0A4V5P7C6_MONMO/1-227      AC A0A4V5P7C6.1
#=GS E4X911_OIKDI/1-227          AC E4X911.1
#=GS A0A392NPT1_9FABA/1-107      AC A0A392NPT1.1
#=GS A0A0L0NH23_TOLOC/1-193      AC A0A0L0NH23.1
#=GS A0A061FD64_THECC/1-254      AC A0A061FD64.1
#=GS A0A2T6ZQ94_TUBBO/1-227      AC A0A2T6ZQ94.1
#=GS A0A0L9V2K3_PHAAN/1-254      AC A0A0L9V2K3.1
#=GS A0A674C0H2_SALTR/1-254      AC A0A674C0H2.1
#=GS A0A423X7G6_9PEZI/1-227      AC A0A423X7G6.1
#=GS E4URR6_ARTGP/1-227          AC E4URR6.1
#=GS A0A482SD85_9ARCH/1-62       AC A0A482SD85.1
#=GS A0A2K6RNC5_RHIRO/102-355    AC A0A2K6RNC5.1
#=GS A0A427Y4C9_9TREE/1-260      AC A0A427Y4C9.1
#=GS A0A2U9BLS3_SCOMX/1-227      AC A0A2U9BLS3.1
#=GS A0A287LYH0_HORVV/30-283     AC A0A287LYH0.1
#=GS A0A1Q9BX56_SYMMI/37-119     AC A0A1Q9BX56.1
#=GS A0A0L0H8Z9_SPIPD/1-254      AC A0A0L0H8Z9.1
#=GS A0A446UQQ5_TRITD/1-88       AC A0A446UQQ5.1
#=GS F6XNM6_CANLF/1-227          AC F6XNM6.2
#=GS A0A287LYE8_HORVV/1-254      AC A0A287LYE8.1
#=GS J3L6A0_ORYBR/1-254          AC J3L6A0.1
#=GS A0A3P7KIX8_STRVU/1-255      AC A0A3P7KIX8.1
#=GS A0A287X5W2_HORVV/25-92      AC A0A287X5W2.1
#=GS A0A452GVI1_9SAUR/1-254      AC A0A452GVI1.1
#=GS A0A364NGS0_9PLEO/1-260      AC A0A364NGS0.1
#=GS A0A453LG62_AEGTS/1-199      AC A0A453LG62.1
#=GS A0A0D9YSC3_9ORYZ/1-128      AC A0A0D9YSC3.1
#=GS A0A4Y7JXN1_PAPSO/1-254      AC A0A4Y7JXN1.1
#=GS A0A0V0QDK4_PSEPJ/113-219    AC A0A0V0QDK4.1
#=GS Q54GU2_DICDI/1-260          AC Q54GU2.1
#=GS A0A6A5BYS7_NAEFO/1-385      AC A0A6A5BYS7.1
#=GS A0A3Q7TAI1_VULVU/1-254      AC A0A3Q7TAI1.1
#=GS J3K8A5_COCIM/1-227          AC J3K8A5.2
#=GS R1BVA3_EMIHU/1-146          AC R1BVA3.1
#=GS A0A2U3X4H9_ODORO/1-254      AC A0A2U3X4H9.1
#=GS A0A287S1A5_HORVV/1-256      AC A0A287S1A5.1
#=GS XRN2_CANAL/1-250            AC Q5AMG5.4
#=GS W5P8Q9_SHEEP/1-227          AC W5P8Q9.1
#=GS A0A158PPI1_ANISI/1-277      AC A0A158PPI1.1
#=GS A0A163J6C1_ABSGL/1-242      AC A0A163J6C1.1
#=GS C6HCG6_AJECH/1-259          AC C6HCG6.1
#=GS A0A545A983_9PEZI/1-254      AC A0A545A983.1
#=GS A0A1S9DS30_ASPOZ/1-227      AC A0A1S9DS30.1
#=GS A0A0M0JMK0_9EUKA/7-233      AC A0A0M0JMK0.1
#=GS A0A3S3S6H8_9ACAR/1-242      AC A0A3S3S6H8.1
#=GS A0A024GJM0_9STRA/1-256      AC A0A024GJM0.1
#=GS A0A078HZY8_BRANA/1-249      AC A0A078HZY8.1
#=GS A0A6Q2ZB14_ESOLU/1-227      AC A0A6Q2ZB14.1
#=GS K0KWY3_WICCF/1-99           AC K0KWY3.1
#=GS A0A395NEJ4_TRIAR/1-193      AC A0A395NEJ4.1
#=GS A0A2P5I0Q0_9PEZI/1-227      AC A0A2P5I0Q0.1
#=GS A1D003_NEOFI/1-227          AC A1D003.1
#=GS A0A2I1GSG2_9GLOM/1-81       AC A0A2I1GSG2.1
#=GS F8PQY4_SERL3/2-75           AC F8PQY4.1
#=GS A0A078A6J2_STYLE/1-93       AC A0A078A6J2.1
#=GS A0A5J4YW09_PORPP/1-225      AC A0A5J4YW09.1
#=GS A0A078HNA4_BRANA/1-254      AC A0A078HNA4.1
#=GS A0A096MU12_PAPAN/1-227      AC A0A096MU12.2
#=GS A0A177EBL2_9MICR/1-212      AC A0A177EBL2.1
#=GS A0A0N1H4X4_9EURO/1-260      AC A0A0N1H4X4.1
#=GS A0A0E0KK46_ORYPU/1-255      AC A0A0E0KK46.1
#=GS A0A2U9CX34_SCOMX/1-254      AC A0A2U9CX34.1
#=GS A0A452QP32_URSAM/1-212      AC A0A452QP32.1
#=GS A0A446RXT0_TRITD/1-247      AC A0A446RXT0.1
#=GS N4TNZ9_FUSC1/1-228          AC N4TNZ9.1
#=GS A0A100IIK0_ASPNG/1-259      AC A0A100IIK0.1
#=GS A0A6A2YS11_HIBSY/97-187     AC A0A6A2YS11.1
#=GS A0A0V0XW95_TRIPS/10-264     AC A0A0V0XW95.1
#=GS C1FYK0_PARBD/1-259          AC C1FYK0.2
#=GS M4EGQ8_BRARP/1-249          AC M4EGQ8.1
#=GS A0A178F3J7_TRIRU/1-227      AC A0A178F3J7.1
#=GS A0A2K2ALK5_POPTR/1-254      AC A0A2K2ALK5.1
#=GS A0A482S7U6_9ARCH/56-268     AC A0A482S7U6.1
#=GS A0A0D9W034_9ORYZ/1-255      AC A0A0D9W034.1
#=GS A0A179IHW3_CORDF/1-226      AC A0A179IHW3.1
#=GS A0A0L7KS40_9NEOP/1-165      AC A0A0L7KS40.1
#=GS G0RD43_HYPJQ/1-260          AC G0RD43.1
#=GS A0A369GFP4_9HYPO/1-228      AC A0A369GFP4.1
#=GS A0A6G1A6A5_CROCR/1-254      AC A0A6G1A6A5.1
#=GS A0A446TIN2_TRITD/1-255      AC A0A446TIN2.1
#=GS A0A6A3BE42_HIBSY/1-254      AC A0A6A3BE42.1
#=GS A0A316UMF0_9BASI/1-263      AC A0A316UMF0.1
#=GS A0A6A3MSD9_9STRA/1-255      AC A0A6A3MSD9.1
#=GS A0A3Q4G118_NEOBR/1-104      AC A0A3Q4G118.1
#=GS A0A4Q4ZWT8_9PEZI/1-260      AC A0A4Q4ZWT8.1
#=GS A0A4W4GA33_ELEEL/1-227      AC A0A4W4GA33.1
#=GS A0A024WNM9_PLAFA/45-259     AC A0A024WNM9.1
#=GS A0A2C9VYU2_MANES/1-254      AC A0A2C9VYU2.1
#=GS A0A078B6X5_STYLE/1-231      AC A0A078B6X5.1
#=GS A0A0V1CMP8_TRIBR/6-260      AC A0A0V1CMP8.1
#=GS T1KWX8_TETUR/1-227          AC T1KWX8.1
#=GS L8Y9A7_TUPCH/2-95           AC L8Y9A7.1
#=GS D2VW45_NAEGR/1-227          AC D2VW45.1
#=GS A0A0K9QQN2_SPIOL/1-255      AC A0A0K9QQN2.1
#=GS A0A2H6KFF3_9APIC/1-255      AC A0A2H6KFF3.1
#=GS A0A444EGZ4_ENSVE/29-100     AC A0A444EGZ4.1
#=GS W4KGV2_HETIT/1-260          AC W4KGV2.1
#=GS A0A673B5C0_9TELE/1-254      AC A0A673B5C0.1
#=GS XRN2_NEUCR/1-260            AC Q8WZX5.3
#=GS T1HF38_RHOPR/1-226          AC T1HF38.1
#=GS A0A5N4EIJ1_CAMDR/1-220      AC A0A5N4EIJ1.1
#=GS A0A4Q4SVL6_9PEZI/15-241     AC A0A4Q4SVL6.1
#=GS H2ASF0_KAZAF/1-227          AC H2ASF0.1
#=GS A0A364L6X9_9EURO/1-227      AC A0A364L6X9.1
#=GS A0A401NRB0_SCYTO/2-191      AC A0A401NRB0.1
#=GS M1VHN0_CYAM1/1-264          AC M1VHN0.1
#=GS A0A1U7VFS5_NICSY/1-255      AC A0A1U7VFS5.1
#=GS A0A016T3H6_9BILA/1-227      AC A0A016T3H6.1
#=GS E9E7Z7_METAQ/1-193          AC E9E7Z7.1
#=GS A0A3Q0EJT8_VIGRR/1-144      AC A0A3Q0EJT8.1
#=GS A0A0V0XVI0_TRIPS/10-264     AC A0A0V0XVI0.1
#=GS Q4QEY1_LEIMA/80-248         AC Q4QEY1.1
#=GS XRN2_SCHPO/1-256            AC P40848.1
#=GS XRN2_SCHPO/1-256            DR PDB; 3FQD A; 1-256;
#=GS A0A139H6N7_9PEZI/1-263      AC A0A139H6N7.1
#=GS A0A1V6TF84_9EURO/1-227      AC A0A1V6TF84.1
#=GS R1ET42_EMIHU/1-109          AC R1ET42.1
#=GS R1E942_EMIHU/1-196          AC R1E942.1
#=GS A0A0V1AZU5_TRISP/6-261      AC A0A0V1AZU5.1
#=GS A0A3Q0D8B6_MESAU/1-227      AC A0A3Q0D8B6.1
#=GS A0A091K6Q6_COLST/1-202      AC A0A091K6Q6.1
#=GS F6WU61_MACMU/1-227          AC F6WU61.2
#=GS V6LYE0_9EUKA/1-218          AC V6LYE0.1
#=GS W9QSW6_9ROSA/1-255          AC W9QSW6.1
#=GS A0A0L0VUT5_9BASI/1-218      AC A0A0L0VUT5.1
#=GS A0A448ZS96_9STRA/1-232      AC A0A448ZS96.1
#=GS V9K859_CALMI/1-254          AC V9K859.1
#=GS A0A1Y3B7D1_EURMA/1-226      AC A0A1Y3B7D1.1
#=GS L8IX99_9CETA/3-229          AC L8IX99.1
#=GS W2YWG8_PHYPR/1-240          AC W2YWG8.1
#=GS A0A395J921_9HELO/1-88       AC A0A395J921.1
#=GS A0A5F5PW20_HORSE/1-227      AC A0A5F5PW20.1
#=GS A0A2U1P6M5_ARTAN/167-366    AC A0A2U1P6M5.1
#=GS A0A5N5G769_9ROSA/1-252      AC A0A5N5G769.1
#=GS S9TWN9_9TRYP/1-228          AC S9TWN9.1
#=GS A0A5B7CTT5_PORTR/1-256      AC A0A5B7CTT5.1
#=GS A0A2U4B9G0_TURTR/1-227      AC A0A2U4B9G0.1
#=GS A0A3Q2WP62_HAPBU/1-244      AC A0A3Q2WP62.1
#=GS A0A0F8V4H5_9EURO/1-258      AC A0A0F8V4H5.1
#=GS A0A1W0A9T1_9STRA/1-233      AC A0A1W0A9T1.1
#=GS A0A2P6UZ56_9CHLO/445-535    AC A0A2P6UZ56.1
#=GS A0A3Q0GWU1_ALLSI/10-232     AC A0A3Q0GWU1.1
#=GS A0A5M9J547_MONFR/1-227      AC A0A5M9J547.1
#=GS M4CVG5_BRARP/1-254          AC M4CVG5.1
#=GS A0A673T7E9_SURSU/1-227      AC A0A673T7E9.1
#=GS L7JUP0_TRAHO/1-296          AC L7JUP0.1
#=GS A0A1A8VKK7_9APIC/85-354     AC A0A1A8VKK7.1
#=GS A0A679KVG8_PLAKH/61-275     AC A0A679KVG8.1
#=GS A0A0M9WKF1_9EURO/1-227      AC A0A0M9WKF1.1
#=GS A0A2K6CB35_MACNE/1-227      AC A0A2K6CB35.1
#=GS A0A0D3F570_9ORYZ/1-229      AC A0A0D3F570.1
#=GS A0A674C145_SALTR/1-254      AC A0A674C145.1
#=GS A0A0L0CYM8_PLAFA/45-259     AC A0A0L0CYM8.1
#=GS A0A2I0AW30_9ASPA/1-255      AC A0A2I0AW30.1
#=GS A0A0E0GUV6_ORYNI/1-255      AC A0A0E0GUV6.1
#=GS A0A4R0R6J7_9APHY/1-227      AC A0A4R0R6J7.1
#=GS A0A5D2S340_GOSMU/1-255      AC A0A5D2S340.1
#=GS A0A4W6FRM8_LATCA/1-254      AC A0A4W6FRM8.1
#=GS A0A060YQW7_ONCMY/1-227      AC A0A060YQW7.1
#=GS A0A498SJB3_ACAVI/13-266     AC A0A498SJB3.1
#=GS A0A446UQL4_TRITD/1-255      AC A0A446UQL4.1
#=GS A0A2L2TG96_9HYPO/1-260      AC A0A2L2TG96.1
#=GS A0A163M6X4_DIDRA/1-227      AC A0A163M6X4.1
#=GS A0A0N9P705_9VIRU/11-131     AC A0A0N9P705.1
#=GS A0A0L0SG22_ALLM3/1-228      AC A0A0L0SG22.1
#=GS XRN2_ASPFU/1-259            AC Q8TFZ1.4
#=GS A0A2A9MKE9_9APIC/169-421    AC A0A2A9MKE9.1
#=GS I1BIY9_RHIO9/3-210          AC I1BIY9.1
#=GS K2NU04_TRYCR/1-250          AC K2NU04.1
#=GS A0A395RG25_9HYPO/1-260      AC A0A395RG25.1
#=GS A0A4W5PS22_9TELE/1-227      AC A0A4W5PS22.1
#=GS A0A0D2AJX1_9PEZI/1-227      AC A0A0D2AJX1.1
#=GS H2MS17_ORYLA/1-254          AC H2MS17.2
#=GS A0A5F5PE08_HORSE/2658-2904  AC A0A5F5PE08.1
#=GS A0A2I4GWW1_JUGRE/1-248      AC A0A2I4GWW1.1
#=GS A0A2K3MH04_TRIPR/1-45       AC A0A2K3MH04.1
#=GS A0A446Q728_TRITD/1-236      AC A0A446Q728.1
#=GS A0A5N5DM95_9PEZI/1-265      AC A0A5N5DM95.1
#=GS A0A5N4CTL9_CAMDR/2-241      AC A0A5N4CTL9.1
#=GS A0A0C9ZN18_9AGAM/5-180      AC A0A0C9ZN18.1
#=GS A0A3B6LR63_WHEAT/1-162      AC A0A3B6LR63.1
#=GS A0A2P6NT42_9EUKA/1-250      AC A0A2P6NT42.1
#=GS A0A3P9QAS9_POERE/1-227      AC A0A3P9QAS9.1
#=GS A0A6A4J4T8_APOLU/1-225      AC A0A6A4J4T8.1
#=GS A0A1S3R1V4_SALSA/1-227      AC A0A1S3R1V4.1
#=GS A0A075AWK4_ROZAC/1-251      AC A0A075AWK4.1
#=GS A0A6D2JZN5_9BRAS/1-254      AC A0A6D2JZN5.1
#=GS A0A1U8Q1N6_NELNU/1-144      AC A0A1U8Q1N6.1
#=GS A0A1S2ZT21_ERIEU/1-227      AC A0A1S2ZT21.1
#=GS A0A446UQL5_TRITD/1-254      AC A0A446UQL5.1
#=GS A0A0N1H411_9EURO/1-227      AC A0A0N1H411.1
#=GS A0A446TIH0_TRITD/1-200      AC A0A446TIH0.1
#=GS A0A397GAI3_9GLOM/1-103      AC A0A397GAI3.1
#=GS A0A096LR95_POEFO/1-254      AC A0A096LR95.1
#=GS A0A2C6A6Y4_9HYPO/1-228      AC A0A2C6A6Y4.1
#=GS A0A0L0FJN9_9EUKA/1-119      AC A0A0L0FJN9.1
#=GS A0A446TIC9_TRITD/1-88       AC A0A446TIC9.1
#=GS A0A662XBV5_9STRA/1-255      AC A0A662XBV5.1
#=GS A0A162QFT6_9CRUS/1-256      AC A0A162QFT6.1
#=GS I3ML90_ICTTR/1-227          AC I3ML90.2
#=GS Q4CQV2_TRYCC/1-139          AC Q4CQV2.1
#=GS A0A3Q3G0H2_9LABR/1-105      AC A0A3Q3G0H2.1
#=GS A0A0D2UQG0_GOSRA/1-254      AC A0A0D2UQG0.1
#=GS M9M7G9_PSEA3/1-262          AC M9M7G9.1
#=GS A0A1J9RKA8_9PEZI/1-227      AC A0A1J9RKA8.1
#=GS A0A674N4Y8_TAKRU/1-227      AC A0A674N4Y8.1
#=GS A0A0A1TEC3_9HYPO/1-260      AC A0A0A1TEC3.1
#=GS A0A4X3P0Q0_PRIPA/1-55       AC A0A4X3P0Q0.1
#=GS A0A2K2DG72_BRADI/60-313     AC A0A2K2DG72.1
#=GS U5HJH0_USTV1/13-249         AC U5HJH0.1
#=GS A0A0D9P7H5_METAN/1-260      AC A0A0D9P7H5.1
#=GS A0A068UGS5_COFCA/1-254      AC A0A068UGS5.1
#=GS A0A392NZN2_9FABA/1-130      AC A0A392NZN2.1
#=GS A0A1J4K3Z4_9EUKA/1-94       AC A0A1J4K3Z4.1
#=GS H2MS13_ORYLA/1-254          AC H2MS13.2
#=GS A0A1U7YX89_NELNU/1-254      AC A0A1U7YX89.1
#=GS A0A4U5QHG9_POPAL/1-254      AC A0A4U5QHG9.1
#=GS K7GJE6_PELSI/1-228          AC K7GJE6.1
#=GS A0A0L6WQD9_9AGAR/1-245      AC A0A0L6WQD9.1
#=GS A0A1B6PPS5_SORBI/1-247      AC A0A1B6PPS5.1
#=GS A0A0S4JAK8_BODSA/1-207      AC A0A0S4JAK8.1
#=GS A0A1P8AQR8_ARATH/5-197      AC A0A1P8AQR8.1
#=GS C5MC27_CANTT/1-226          AC C5MC27.1
#=GS A0A096MZS8_PAPAN/1-227      AC A0A096MZS8.1
#=GS A0A2R5H1Y9_9STRA/1-272      AC A0A2R5H1Y9.1
#=GS A0A1V9XBA4_9ACAR/1-256      AC A0A1V9XBA4.1
#=GS A0A453LG33_AEGTS/1-174      AC A0A453LG33.1
#=GS A0A4W6FTD5_LATCA/1-254      AC A0A4W6FTD5.1
#=GS A0A0D2E257_9EURO/1-262      AC A0A0D2E257.1
#=GS W6KT31_9TRYP/1-258          AC W6KT31.1
#=GS A0A421JFI4_9ASCO/1-250      AC A0A421JFI4.1
#=GS A0A674C099_SALTR/1-254      AC A0A674C099.1
#=GS A0A1E1KDC7_9HELO/1-254      AC A0A1E1KDC7.1
#=GS C1E7G3_MICCC/21-226         AC C1E7G3.1
#=GS K3XE19_SETIT/1-254          AC K3XE19.1
#=GS XRN1_HUMAN/1-227            AC Q8IZH2.1
#=GS A0A485LQA0_9STRA/1-231      AC A0A485LQA0.1
#=GS A0A0D2U765_GOSRA/1-251      AC A0A0D2U765.1
#=GS A0A653BUJ6_CALMS/1-255      AC A0A653BUJ6.1
#=GS A0A5J5EWV6_9PEZI/1-227      AC A0A5J5EWV6.1
#=GS A0A0E9NEC4_SAICN/139-244    AC A0A0E9NEC4.1
#=GS A0A1G4MEB6_LACFM/1-254      AC A0A1G4MEB6.1
#=GS Q7QH49_ANOGA/1-255          AC Q7QH49.5
#=GS R0M4X6_ANAPL/1-202          AC R0M4X6.1
#=GS A0A0W0EW62_9AGAR/151-377    AC A0A0W0EW62.1
#=GS A0A1G4IMW8_9SACH/1-254      AC A0A1G4IMW8.1
#=GS A0A060YA14_ONCMY/1-227      AC A0A060YA14.1
#=GS A0A0V1MCG6_9BILA/10-264     AC A0A0V1MCG6.1
#=GS B8MDE9_TALSN/1-227          AC B8MDE9.1
#=GS A4RZB9_OSTLU/1-254          AC A4RZB9.1
#=GS F4PW88_CAVFA/1-335          AC F4PW88.1
#=GS A0CNG4_PARTE/1-213          AC A0CNG4.1
#=GS A0A446UHQ8_TRITD/1-135      AC A0A446UHQ8.1
#=GS F2SMH2_TRIRC/1-46           AC F2SMH2.2
#=GS A0A1W4WNG0_AGRPL/1-227      AC A0A1W4WNG0.1
#=GS A0A660KLS5_9ROSI/1-249      AC A0A660KLS5.1
#=GS B9H4V3_POPTR/1-254          AC B9H4V3.3
#=GS A0A3Q3LF50_9TELE/1-254      AC A0A3Q3LF50.1
#=GS M1VGC6_CYAM1/1-229          AC M1VGC6.1
#=GS N1RBN8_FUSC4/666-881        AC N1RBN8.1
#=GS A0A6A4N7V9_LUPAL/1-254      AC A0A6A4N7V9.1
#=GS A0A3Q0F2U3_VIGRR/1-254      AC A0A3Q0F2U3.1
#=GS A0A3Q4BYN4_MOLML/21-147     AC A0A3Q4BYN4.1
#=GS A0A653BTR2_CALMS/1-95       AC A0A653BTR2.1
#=GS A0A195BLW1_9HYME/1-255      AC A0A195BLW1.1
#=GS A0A3Q3BQR6_HAPBU/7-138      AC A0A3Q3BQR6.1
#=GS K9FP02_PEND2/1-227          AC K9FP02.1
#=GS L2GN25_VITCO/1-250          AC L2GN25.1
#=GS A0A1V6P211_9EURO/1-227      AC A0A1V6P211.1
#=GS A0A1U7ZGQ3_NELNU/1-248      AC A0A1U7ZGQ3.1
#=GS A0A251SIN2_HELAN/1-250      AC A0A251SIN2.1
#=GS A0A0L0DSC3_THETB/1-250      AC A0A0L0DSC3.1
#=GS A0A5J9TRD1_9POAL/1-222      AC A0A5J9TRD1.1
#=GS A0A6A5PNA5_LUPAL/1-246      AC A0A6A5PNA5.1
#=GS A0A3B3I9V6_ORYLA/1-227      AC A0A3B3I9V6.1
#=GS H2ZAS5_CIOSA/1-227          AC H2ZAS5.1
#=GS Q75JF5_DICDI/1-225          AC Q75JF5.1
#=GS A0A6A5P4T3_LUPAL/1-255      AC A0A6A5P4T3.1
#=GS A0A5N5P3T2_9ROSI/54-230     AC A0A5N5P3T2.1
#=GS U6GS58_9EIME/121-326        AC U6GS58.1
#=GS A0A117NKC7_9EURO/1-260      AC A0A117NKC7.1
#=GS A0A251VBM9_HELAN/1-249      AC A0A251VBM9.1
#=GS A0A2R5GSM0_9STRA/1-231      AC A0A2R5GSM0.1
#=GS A0A0P0VJ19_ORYSJ/1-96       AC A0A0P0VJ19.1
#=GS A0A5N6U5S1_9EURO/1-259      AC A0A5N6U5S1.1
#=GS A0A452QNV0_URSAM/1-212      AC A0A452QNV0.1
#=GS A0A5D2ZBH2_GOSMU/1-245      AC A0A5D2ZBH2.1
#=GS A0A482S5Y4_9ARCH/2-87       AC A0A482S5Y4.1
#=GS I3KIQ7_ORENI/1-228          AC I3KIQ7.2
#=GS H0WHT5_OTOGA/1-254          AC H0WHT5.1
#=GS A0A0F8CVE5_CERFI/1-258      AC A0A0F8CVE5.1
#=GS E5A9Y4_LEPMJ/1-260          AC E5A9Y4.1
#=GS A0A0F7TWU7_PENBI/1-227      AC A0A0F7TWU7.1
#=GS A0A3M2S0V0_9HYPO/1-260      AC A0A3M2S0V0.1
#=GS A0A2G7FF58_9EURO/1-257      AC A0A2G7FF58.1
#=GS A0A509AD01_PLABA/168-299    AC A0A509AD01.1
#=GS A0A2A9MBC8_9APIC/980-1230   AC A0A2A9MBC8.1
#=GS A0A397T3A7_9GLOM/1-254      AC A0A397T3A7.1
#=GS H2QK18_PANTR/1-254          AC H2QK18.1
#=GS A0A3Q7JD13_SOLLC/1-254      AC A0A3Q7JD13.1
#=GS A0A251S6D6_HELAN/1-254      AC A0A251S6D6.1
#=GS F1A1N8_DICPU/1-221          AC F1A1N8.1
#=GS I3KIQ8_ORENI/1-228          AC I3KIQ8.2
#=GS A0A397U0Q9_9GLOM/1-202      AC A0A397U0Q9.1
#=GS A0A3M7MS50_9EURO/1-260      AC A0A3M7MS50.1
#=GS A0A4U6U0J7_SETVI/1-244      AC A0A4U6U0J7.1
#=GS A0A218UIY2_9PASE/1-254      AC A0A218UIY2.1
#=GS A0A665V8Q8_ECHNA/1-227      AC A0A665V8Q8.1
#=GS A0A158QM76_HAEPC/1-227      AC A0A158QM76.1
#=GS A0A2P6N8H2_9EUKA/63-330     AC A0A2P6N8H2.1
#=GS A0A1Y2GJF4_9FUNG/1-207      AC A0A1Y2GJF4.1
#=GS A0A287S1H1_HORVV/1-193      AC A0A287S1H1.1
#=GS A0A1D1V1Y3_RAMVA/1-258      AC A0A1D1V1Y3.1
#=GS A0A0S7E173_9EURO/1-227      AC A0A0S7E173.1
#=GS A0A1S4DKE0_TOBAC/1-254      AC A0A1S4DKE0.1
#=GS A0A4W5R7M0_9TELE/1-254      AC A0A4W5R7M0.1
#=GS A0A1Q8S1K2_9PEZI/1-260      AC A0A1Q8S1K2.1
#=GS A0A225AXF9_9EURO/1-262      AC A0A225AXF9.1
#=GS A0A0L8FSJ4_OCTBM/2-205      AC A0A0L8FSJ4.1
#=GS J9JVQ2_ACYPI/1-227          AC J9JVQ2.2
#=GS A0A4W2CPN0_BOBOX/1-254      AC A0A4W2CPN0.1
#=GS A0A337SIV3_FELCA/1-227      AC A0A337SIV3.2
#=GS A0A094CNC5_9PEZI/1-227      AC A0A094CNC5.1
#=GS A0A2Y9NWI7_DELLE/1-227      AC A0A2Y9NWI7.1
#=GS W9I0J7_FUSOX/1-260          AC W9I0J7.1
#=GS A0A3P9D5Y8_9CICH/1-244      AC A0A3P9D5Y8.1
#=GS A0A0C7MLK7_9SACH/1-254      AC A0A0C7MLK7.1
#=GS A0A315VY68_GAMAF/253-293    AC A0A315VY68.1
#=GS A0A5J4NP54_9TREM/1-224      AC A0A5J4NP54.1
#=GS A0A139AUV6_GONPJ/1-160      AC A0A139AUV6.1
#=GS A0A409XNX8_PSICY/1-155      AC A0A409XNX8.1
#=GS A0A2G5EID7_AQUCA/1-254      AC A0A2G5EID7.1
#=GS C1N1S7_MICPC/1-227          AC C1N1S7.1
#=GS A0A0H1B6G5_9EURO/1-259      AC A0A0H1B6G5.1
#=GS A0A1U8N0Q6_GOSHI/1-254      AC A0A1U8N0Q6.1
#=GS A0A183IJ16_9BILA/1-227      AC A0A183IJ16.1
#=GS V4MEW3_EUTSA/1-254          AC V4MEW3.1
#=GS A0A287SKL1_HORVV/1-181      AC A0A287SKL1.1
#=GS A0A512ULM6_9ASCO/1-191      AC A0A512ULM6.1
#=GS A0A0C9Y3T2_9AGAR/1-260      AC A0A0C9Y3T2.1
#=GS D8SZS8_SELML/24-221         AC D8SZS8.1
#=GS A0A1G4JS18_9SACH/1-227      AC A0A1G4JS18.1
#=GS A0A1B9I419_9TREE/1-229      AC A0A1B9I419.1
#=GS A0A061F3C1_THECC/1-255      AC A0A061F3C1.1
#=GS G1KEH8_ANOCA/4-255          AC G1KEH8.1
#=GS A0A428QBT7_9HYPO/1-228      AC A0A428QBT7.1
#=GS A0A5N5X5L5_9EURO/1-227      AC A0A5N5X5L5.1
#=GS A0A674EFL3_SALTR/1-227      AC A0A674EFL3.1
#=GS A0A251R8S6_PRUPE/1-254      AC A0A251R8S6.1
#=GS A0A0L1KU32_9EUGL/1-231      AC A0A0L1KU32.1
#=GS A0A091V6Y5_OPIHO/1-202      AC A0A091V6Y5.1
#=GS A0A1W2TP08_ROSNE/1-260      AC A0A1W2TP08.1
#=GS A0A3N6Q0C6_BRACR/1-254      AC A0A3N6Q0C6.1
#=GS C1H8L2_PARBA/1-259          AC C1H8L2.2
#=GS A0A2G5CMT0_AQUCA/1-256      AC A0A2G5CMT0.1
#=GS A0A251R8R9_PRUPE/1-254      AC A0A251R8R9.1
#=GS A0A093L961_EURHL/3-233      AC A0A093L961.1
#=GS A0A5J5B2R2_9ASTE/4-239      AC A0A5J5B2R2.1
#=GS A0A5D2UYN5_GOSMU/1-254      AC A0A5D2UYN5.1
#=GS A0A3Q1FNZ3_9TELE/8-136      AC A0A3Q1FNZ3.1
#=GS A0A3S3MWR3_9MAGN/1-254      AC A0A3S3MWR3.1
#=GS A0A0L0D4A0_THETB/1-203      AC A0A0L0D4A0.1
#=GS G3QYF8_GORGO/1-227          AC G3QYF8.2
#=GS A0A0C3MYE6_PISTI/6-77       AC A0A0C3MYE6.1
#=GS E1Z8I5_CHLVA/1-50           AC E1Z8I5.1
#=GS A0A6Q2Y502_ESOLU/1-254      AC A0A6Q2Y502.1
#=GS A0A1Z5T678_HORWE/1-228      AC A0A1Z5T678.1
#=GS A0A0E0I4F1_ORYNI/76-135     AC A0A0E0I4F1.1
#=GS A0A384ALC9_BALAS/1-227      AC A0A384ALC9.1
#=GS A0A4D8ZXS0_SALSN/1-255      AC A0A4D8ZXS0.1
#=GS T5ABH4_OPHSC/1-259          AC T5ABH4.1
#=GS A0A1X0NSR6_9TRYP/1-183      AC A0A1X0NSR6.1
#=GS A0A183VX00_TRIRE/1-255      AC A0A183VX00.1
#=GS E5AED4_LEPMJ/1-227          AC E5AED4.1
#=GS A0A6G0I4M8_LARCR/1-254      AC A0A6G0I4M8.1
#=GS A0A4W5MNW2_9TELE/1-254      AC A0A4W5MNW2.1
#=GS A0A2B7X4E5_9EURO/1-259      AC A0A2B7X4E5.1
#=GS A0A0K6FM94_9AGAM/1-227      AC A0A0K6FM94.1
#=GS A0A397XUH9_BRACM/1-249      AC A0A397XUH9.1
#=GS M4AV83_XIPMA/1-227          AC M4AV83.2
#=GS U6GVZ3_EIMAC/27-87          AC U6GVZ3.1
#=GS R1DJK6_EMIHU/34-255         AC R1DJK6.1
#=GS A0A087W1E2_ECHMU/1-226      AC A0A087W1E2.1
#=GS A0A667YQ69_9TELE/1-254      AC A0A667YQ69.1
#=GS A0A674PF24_TAKRU/1-227      AC A0A674PF24.1
#=GS A0A6Q2ZQ98_ESOLU/1-254      AC A0A6Q2ZQ98.1
#=GS A0A0V1NQA0_9BILA/1-227      AC A0A0V1NQA0.1
#=GS A0A1Z5JKV0_FISSO/1-224      AC A0A1Z5JKV0.1
#=GS A0A1E7F0Q6_9STRA/1-164      AC A0A1E7F0Q6.1
#=GS I0YN23_COCSC/1-201          AC I0YN23.1
#=GS A0A6I8NWP6_ORNAN/1-227      AC A0A6I8NWP6.1
#=GS A0A452DTP5_CAPHI/1-254      AC A0A452DTP5.1
#=GS A0A0V1H6G6_9BILA/10-264     AC A0A0V1H6G6.1
#=GS A0A2Z6RK84_9GLOM/1-255      AC A0A2Z6RK84.1
#=GS A0A6A5BPE7_NAEFO/18-134     AC A0A6A5BPE7.1
#=GS A0A1S3E5X8_CICAR/5-239      AC A0A1S3E5X8.1
#=GS A0A6I8NAC8_ORNAN/1-227      AC A0A6I8NAC8.1
#=GS A0A094ZWG2_SCHHA/1-255      AC A0A094ZWG2.1
#=GS A0A059F5K3_9MICR/1-242      AC A0A059F5K3.1
#=GS V8NLT7_OPHHA/92-254         AC V8NLT7.1
#=GS A0A4W4F7E4_ELEEL/1-254      AC A0A4W4F7E4.1
#=GS A0A446Q6X0_TRITD/1-254      AC A0A446Q6X0.1
#=GS A0A161XS38_9PEZI/1-228      AC A0A161XS38.1
#=GS A0A5C3QUQ7_9AGAR/1-227      AC A0A5C3QUQ7.1
#=GS A0A0C4DRC9_MAGP6/1-260      AC A0A0C4DRC9.1
#=GS A0A177UT60_9BASI/1-227      AC A0A177UT60.1
#=GS A0A453HN74_AEGTS/48-215     AC A0A453HN74.1
#=GS A0A093IFK6_EURHL/1-203      AC A0A093IFK6.1
#=GS A0A673B1G8_9TELE/1-254      AC A0A673B1G8.1
#=GS A0A553P2F1_TIGCA/1-95       AC A0A553P2F1.1
#=GS G3PDN9_GASAC/1-254          AC G3PDN9.1
#=GS A0A179IGF2_CORDF/1-260      AC A0A179IGF2.1
#=GS A0A0M9A1V6_9HYME/1-227      AC A0A0M9A1V6.1
#=GS A0A2G5EFN6_AQUCA/1-252      AC A0A2G5EFN6.1
#=GS A0A0L0DB01_THETB/1-267      AC A0A0L0DB01.1
#=GS A0A287S1G3_HORVV/1-255      AC A0A287S1G3.1
#=GS A0A0L0HHR5_SPIPD/1-227      AC A0A0L0HHR5.1
#=GS A0A165SYK9_9APHY/1-237      AC A0A165SYK9.1
#=GS A0A2H4UVI0_9VIRU/1-101      AC A0A2H4UVI0.1
#=GS A0A2G3B295_CAPCH/1-255      AC A0A2G3B295.1
#=GS A0A0M9G6L5_9TRYP/1-228      AC A0A0M9G6L5.1
#=GS A0A0L1KPZ3_9EUGL/108-214    AC A0A0L1KPZ3.1
#=GS A0A3Q0JL31_DIACI/1-76       AC A0A3Q0JL31.1
#=GS A0A444YKC8_ARAHY/84-340     AC A0A444YKC8.1
#=GS A0A1S5XYD5_9VIRU/127-221    AC A0A1S5XYD5.1
#=GS A0A0D2ML90_HYPSF/1-74       AC A0A0D2ML90.1
#=GS X6LJ56_RETFI/1-40           AC X6LJ56.1
#=GS A8Q382_MALGO/9-231          AC A8Q382.1
#=GS A0A094C8C4_9PEZI/1-227      AC A0A094C8C4.1
#=GS A0A444YKD9_ARAHY/84-340     AC A0A444YKD9.1
#=GS A0A1R0GW80_9FUNG/1-263      AC A0A1R0GW80.1
#=GS A0A4P9YZU9_9FUNG/1-128      AC A0A4P9YZU9.1
#=GS A0A0E0NEY5_ORYRU/1-229      AC A0A0E0NEY5.1
#=GS A0A251NQD2_PRUPE/20-268     AC A0A251NQD2.1
#=GS A0A162J664_METRR/1-228      AC A0A162J664.1
#=GS M7Z4I1_TRIUA/1-255          AC M7Z4I1.1
#=GS A0A2P4XY75_9STRA/1-255      AC A0A2P4XY75.1
#=GS A0A158QE72_HYMDI/1-226      AC A0A158QE72.1
#=GS A0A5B0QJG9_PUCGR/1-227      AC A0A5B0QJG9.1
#=GS T0Q513_SAPDV/1-232          AC T0Q513.1
#=GS A0A0V1BVY8_TRISP/444-670    AC A0A0V1BVY8.1
#=GS A0A4Y7L8C8_PAPSO/1-248      AC A0A4Y7L8C8.1
#=GS A0A2Y9JQ13_ENHLU/1-227      AC A0A2Y9JQ13.1
#=GS A0A667YHJ0_9TELE/1-254      AC A0A667YHJ0.1
#=GS A0A177WX05_BATDL/2-162      AC A0A177WX05.1
#=GS A0A0D3FQ41_9ORYZ/1-255      AC A0A0D3FQ41.1
#=GS A0A093PZE6_9PASS/3-230      AC A0A093PZE6.1
#=GS A0A4Q4U6L7_9PEZI/1-260      AC A0A4Q4U6L7.1
#=GS A0A151U543_CAJCA/1-255      AC A0A151U543.1
#=GS A0A674AMW1_SALTR/1-254      AC A0A674AMW1.1
#=GS A0A445HN86_GLYSO/1-244      AC A0A445HN86.1
#=GS G8JXS9_ERECY/1-227          AC G8JXS9.1
#=GS F4W8L4_ACREC/1-226          AC F4W8L4.1
#=GS A0A674C0L7_SALTR/1-254      AC A0A674C0L7.1
#=GS I1C0T9_RHIO9/1-254          AC I1C0T9.1
#=GS A0A284R0H2_ARMOS/66-329     AC A0A284R0H2.1
#=GS A0A0D2KPC3_9EURO/1-227      AC A0A0D2KPC3.1
#=GS A0A0V1BXU0_TRISP/454-680    AC A0A0V1BXU0.1
#=GS A0A674EFS7_SALTR/1-227      AC A0A674EFS7.1
#=GS G5CQM0_9VIRU/70-292         AC G5CQM0.1
#=GS B6QFI8_TALMQ/1-227          AC B6QFI8.1
#=GS A0A1D3D375_9EIME/1-267      AC A0A1D3D375.1
#=GS A0A397UBY3_9GLOM/66-167     AC A0A397UBY3.1
#=GS A0A368EYA6_ANCCA/1-46       AC A0A368EYA6.1
#=GS A8BDL3_GIAIC/1-262          AC A8BDL3.1
#=GS A2FKE6_TRIVA/1-208          AC A2FKE6.1
#=GS A0A5J5B345_9ASTE/1-255      AC A0A5J5B345.1
#=GS A0A2S4KSY9_9HYPO/1-260      AC A0A2S4KSY9.1
#=GS A0A453M1R8_AEGTS/7-261      AC A0A453M1R8.1
#=GS S3BWX5_OPHP1/1-227          AC S3BWX5.1
#=GS A0A2Y9RIR8_TRIMA/1-227      AC A0A2Y9RIR8.1
#=GS D4ABN8_RAT/1-227            AC D4ABN8.2
#=GS Q7RJX4_PLAYO/1-272          AC Q7RJX4.1
#=GS K7UB09_MAIZE/1-254          AC K7UB09.1
#=GS A0A232LWG5_9EURO/1-259      AC A0A232LWG5.1
#=GS A0A1S3CR10_CUCME/1-254      AC A0A1S3CR10.1
#=GS M7BT31_CHEMY/134-208        AC M7BT31.1
#=GS A0A2G5DNT8_AQUCA/1-255      AC A0A2G5DNT8.1
#=GS A0A087SKE6_AUXPR/1-231      AC A0A087SKE6.1
#=GS A0A3F3QGW8_9EURO/1-259      AC A0A3F3QGW8.1
#=GS B6K3T5_SCHJY/1-226          AC B6K3T5.1
#=GS A0A3S2TV83_ORYJA/1-254      AC A0A3S2TV83.1
#=GS A0A0D2JDS0_9CHLO/1-254      AC A0A0D2JDS0.1
#=GS A0A0A2V537_BEABA/1-260      AC A0A0A2V537.1
#=GS A0A093DUH1_TAUER/1-202      AC A0A093DUH1.1
#=GS W6QKZ6_PENRF/1-260          AC W6QKZ6.1
#=GS A0A485PM25_LYNPA/11-232     AC A0A485PM25.1
#=GS G0WC76_NAUDC/1-254          AC G0WC76.1
#=GS H3GSI3_PHYRM/1-255          AC H3GSI3.1
#=GS A0A384L4M6_PLAKH/148-267    AC A0A384L4M6.1
#=GS A0A4S2LKX5_OPIFE/1-224      AC A0A4S2LKX5.1
#=GS A0A670IMH2_PODMU/1-227      AC A0A670IMH2.1
#=GS A0A2K5V3C7_MACFA/1-227      AC A0A2K5V3C7.1
#=GS A0A226MTF2_CALSU/1-237      AC A0A226MTF2.1
#=GS A0A093CMR0_9AVES/3-233      AC A0A093CMR0.1
#=GS A0A044UAX5_ONCVO/1-254      AC A0A044UAX5.2
#=GS A0A2K6MIJ8_RHIBE/1-227      AC A0A2K6MIJ8.1
#=GS B6QCA6_TALMQ/1-262          AC B6QCA6.1
#=GS A0A4Z2DVV1_SCHJA/2-194      AC A0A4Z2DVV1.1
#=GS A0A1S7HQX1_9SACH/1-227      AC A0A1S7HQX1.1
#=GS A0A397G7P2_9GLOM/1-90       AC A0A397G7P2.1
#=GS A0A5N4AMG4_PHOPY/1-227      AC A0A5N4AMG4.1
#=GS A0A674PK61_TAKRU/1-227      AC A0A674PK61.1
#=GS A0A4W3HFZ9_CALMI/2-205      AC A0A4W3HFZ9.1
#=GS A0A0A1T3Q0_9HYPO/1-228      AC A0A0A1T3Q0.1
#=GS U3JPL9_FICAL/1-254          AC U3JPL9.1
#=GS A0A446UQM4_TRITD/1-255      AC A0A446UQM4.1
#=GS U3JX22_FICAL/1-227          AC U3JX22.1
#=GS A0A452QNM6_URSAM/1-212      AC A0A452QNM6.1
#=GS H9IU78_BOMMO/1-255          AC H9IU78.1
#=GS A0A6I8QEI1_XENTR/1-227      AC A0A6I8QEI1.1
#=GS B4HXZ3_DROSE/1-256          AC B4HXZ3.1
#=GS A0A540M460_MALBA/1-255      AC A0A540M460.1
#=GS A0A1Y2LSB6_EPING/1-227      AC A0A1Y2LSB6.1
#=GS A0A671WQX5_SPAAU/1-227      AC A0A671WQX5.1
#=GS A0A251R8U6_PRUPE/1-254      AC A0A251R8U6.1
#=GS A0A0V0WFS3_9BILA/1-255      AC A0A0V0WFS3.1
#=GS W2YIJ2_PHYPR/1-255          AC W2YIJ2.1
#=GS A0A0R3X608_HYDTA/1-257      AC A0A0R3X608.1
#=GS A0A3P7D5S2_SCHSO/1-69       AC A0A3P7D5S2.1
#=GS XRN2_CAEBR/1-257            AC Q60SG7.2
#=GS A0A2C5XHA2_9PEZI/1-228      AC A0A2C5XHA2.1
#=GS A0A287S1H2_HORVV/1-193      AC A0A287S1H2.1
#=GS A0A436ZS69_9PEZI/1-227      AC A0A436ZS69.1
#=GS A0A446NWX2_TRITD/1-254      AC A0A446NWX2.1
#=GS A0A4S4F2E9_CAMSI/226-270    AC A0A4S4F2E9.1
#=GS A0A200Q9I0_9MAGN/12-197     AC A0A200Q9I0.1
#=GS A0A067JVR9_JATCU/1-255      AC A0A067JVR9.1
#=GS M7TWE3_EUTLA/1-259          AC M7TWE3.1
#=GS D0NWL1_PHYIT/1-240          AC D0NWL1.1
#=GS A0A0S3SQ88_PHAAN/1-255      AC A0A0S3SQ88.1
#=GS A0A2H0ZK98_CANAR/1-252      AC A0A2H0ZK98.1
#=GS A0A384ALR7_BALAS/1-227      AC A0A384ALR7.1
#=GS F6TZX3_MONDO/1-227          AC F6TZX3.2
#=GS A0A507F4B3_9FUNG/27-257     AC A0A507F4B3.1
#=GS A0A1B8DFR4_9PEZI/1-227      AC A0A1B8DFR4.1
#=GS A0A5E4F3P9_PRUDU/1-254      AC A0A5E4F3P9.1
#=GS A0A0D9XP88_9ORYZ/1-246      AC A0A0D9XP88.1
#=GS A0A0B2X255_METAS/1-236      AC A0A0B2X255.1
#=GS A0A663E2V1_AQUCH/1-227      AC A0A663E2V1.1
#=GS A0A1R2B5J1_9CILI/1-225      AC A0A1R2B5J1.1
#=GS F0XXG7_AURAN/1-177          AC F0XXG7.1
#=GS A0A6G1E3E5_9ORYZ/1-254      AC A0A6G1E3E5.1
#=GS H2ZNE1_CIOSA/1-139          AC H2ZNE1.1
#=GS A2FWN8_TRIVA/1-210          AC A2FWN8.1
#=GS A0A507F4U3_9FUNG/1-230      AC A0A507F4U3.1
#=GS D8RM82_SELML/2-65           AC D8RM82.1
#=GS A0A1Z5RHK1_SORBI/1-264      AC A0A1Z5RHK1.1
#=GS A0A060SKC3_PYCCI/19-244     AC A0A060SKC3.1
#=GS A0A0N1IQ16_PAPMA/1-227      AC A0A0N1IQ16.1
#=GS A0A2Y9DLH7_TRIMA/1-254      AC A0A2Y9DLH7.1
#=GS E3T4Q9_CROVB/97-309         AC E3T4Q9.1
#=GS A0A498SJ65_ACAVI/1-139      AC A0A498SJ65.1
#=GS U6M256_EIMMA/1-197          AC U6M256.1
#=GS Q5N739_ORYSJ/1-254          AC Q5N739.1
#=GS A0A232LYX4_9EURO/1-227      AC A0A232LYX4.1
#=GS J4C9A3_THEOR/1-257          AC J4C9A3.1
#=GS R8BCI1_TOGMI/1-260          AC R8BCI1.1
#=GS A0A0D1Y6B3_9EURO/1-261      AC A0A0D1Y6B3.1
#=GS A0A6Q2XWF6_ESOLU/1-254      AC A0A6Q2XWF6.1
#=GS A0A1Y1V338_9FUNG/1-179      AC A0A1Y1V338.1
#=GS A0A4W5P316_9TELE/1-227      AC A0A4W5P316.1
#=GS A0A1B6PPS0_SORBI/10-210     AC A0A1B6PPS0.1
#=GS A0A0W4ZS86_PNEJ7/42-292     AC A0A0W4ZS86.1
#=GS A0A1D8PFP3_CANAL/1-226      AC A0A1D8PFP3.1
#=GS A0A3N7EL97_POPTR/1-46       AC A0A3N7EL97.1
#=GS A0A565AZJ7_9BRAS/1-248      AC A0A565AZJ7.1
#=GS A0A1Q3DD65_CEPFO/1-251      AC A0A1Q3DD65.1
#=GS A0A367KCB2_RHIAZ/458-679    AC A0A367KCB2.1
#=GS A0A1Y2HR69_9FUNG/1-247      AC A0A1Y2HR69.1
#=GS A0A4S4LB59_9AGAM/44-268     AC A0A4S4LB59.1
#=GS A0A2Y9G6M0_NEOSC/1-227      AC A0A2Y9G6M0.1
#=GS A0A1R1XU80_9FUNG/1-162      AC A0A1R1XU80.1
#=GS A4H970_LEIBR/1-342          AC A4H970.2
#=GS A0A2G9I5E8_9LAMI/1-255      AC A0A2G9I5E8.1
#=GS A0A4Z2DW47_SCHJA/1-56       AC A0A4Z2DW47.1
#=GS U4UET3_DENPD/1-255          AC U4UET3.1
#=GS A0A341BXY3_NEOAA/1-200      AC A0A341BXY3.1
#=GS A0A087GSR7_ARAAL/1-253      AC A0A087GSR7.1
#=GS A0A667YHI2_9TELE/1-254      AC A0A667YHI2.1
#=GS A0A444YGE2_ARAHY/1-254      AC A0A444YGE2.1
#=GS A0A0E0MCN4_ORYPU/1-102      AC A0A0E0MCN4.1
#=GS A0A132A4S0_SARSC/1-225      AC A0A132A4S0.1
#=GS A0A022QMM7_ERYGU/1-250      AC A0A022QMM7.1
#=GS A0A2Y9IN34_ENHLU/1-144      AC A0A2Y9IN34.1
#=GS A0A0J8RFF0_COCIT/105-170    AC A0A0J8RFF0.1
#=GS U3IB59_ANAPP/1-227          AC U3IB59.1
#=GS A0A2U3VQ97_ODORO/1-227      AC A0A2U3VQ97.1
#=GS A0A022RF65_ERYGU/1-244      AC A0A022RF65.1
#=GS A0A2H3BYZ8_9AGAR/1-153      AC A0A2H3BYZ8.1
#=GS A0A1D6MQ21_MAIZE/1-46       AC A0A1D6MQ21.1
#=GS A0A445GBW7_GLYSO/1-254      AC A0A445GBW7.1
#=GS G3PDN6_GASAC/1-254          AC G3PDN6.1
#=GS M2XVS4_GALSU/1-229          AC M2XVS4.1
#=GS A0A1J5WMM0_9MICR/1-123      AC A0A1J5WMM0.1
#=GS B4KBG4_DROMO/1-256          AC B4KBG4.2
#=GS A0A507EVV4_9FUNG/1-236      AC A0A507EVV4.1
#=GS A0A484AZM7_DRONA/1-226      AC A0A484AZM7.1
#=GS A0A3Q1BJW0_AMPOC/1-153      AC A0A3Q1BJW0.1
#=GS A0A2U3YN25_LEPWE/1-88       AC A0A2U3YN25.1
#=GS H2SH03_TAKRU/1-227          AC H2SH03.3
#=GS V5E8V4_KALBG/1-261          AC V5E8V4.1
#=GS A0A0E0Q602_ORYRU/1-100      AC A0A0E0Q602.1
#=GS A0A507E5Q1_9FUNG/1-134      AC A0A507E5Q1.1
#=GS A0A0C3P7W1_PISTI/6-77       AC A0A0C3P7W1.1
#=GS A0A0L1IBT5_PLAFA/22-305     AC A0A0L1IBT5.1
#=GS L5K8M0_PTEAL/1-227          AC L5K8M0.1
#=GS A0A498IGU5_MALDO/1-255      AC A0A498IGU5.1
#=GS R9PGH3_PSEHS/1-227          AC R9PGH3.1
#=GS A0A2H3H730_FUSOX/1-228      AC A0A2H3H730.1
#=GS F0XTD1_GROCL/1-184          AC F0XTD1.1
#=GS R7QNL0_CHOCR/1-88           AC R7QNL0.1
#=GS A0A674DJQ8_SALTR/1-227      AC A0A674DJQ8.1
#=GS A0A2A9MBC8_9APIC/1418-1457  AC A0A2A9MBC8.1
#=GS K1QTP4_CRAGI/1-255          AC K1QTP4.1
#=GS I2FP92_USTH4/1-261          AC I2FP92.1
#=GS L8GUS3_ACACA/2-97           AC L8GUS3.1
#=GS A0A6I8QS77_XENTR/1-192      AC A0A6I8QS77.1
#=GS A0A1B8D8Y3_9PEZI/1-259      AC A0A1B8D8Y3.1
#=GS A0A446NWR2_TRITD/1-46       AC A0A446NWR2.1
#=GS K6V7H7_9APIC/22-156         AC K6V7H7.1
#=GS A0A0N0DVV5_9TRYP/1-252      AC A0A0N0DVV5.1
#=GS W9WTA8_9EURO/1-262          AC W9WTA8.1
#=GS A0A0V0WFW9_9BILA/1-255      AC A0A0V0WFW9.1
#=GS A0A2K5RZV5_CEBCA/1-227      AC A0A2K5RZV5.1
#=GS K3Y5C0_SETIT/1-244          AC K3Y5C0.1
#=GS A0A1V8TUV0_9PEZI/1-227      AC A0A1V8TUV0.1
#=GS A0A287S1M7_HORVV/1-255      AC A0A287S1M7.1
#=GS A0A420ISB7_9PEZI/1-254      AC A0A420ISB7.1
#=GS A0A0W8DQA7_PHYNI/1-204      AC A0A0W8DQA7.1
#=GS A0A0V0VTM7_9BILA/444-662    AC A0A0V0VTM7.1
#=GS A0A3Q2DB43_CYPVA/1-254      AC A0A3Q2DB43.1
#=GS E1Z9G0_CHLVA/74-180         AC E1Z9G0.1
#=GS A0A4U6SSK5_SETVI/1-255      AC A0A4U6SSK5.1
#=GS A0A2C6LC21_9APIC/1302-1340  AC A0A2C6LC21.1
#=GS A0A674DJ02_SALTR/1-192      AC A0A674DJ02.1
#=GS A0A5F9CJ75_RABIT/1-254      AC A0A5F9CJ75.1
#=GS A0A445FL76_GLYSO/1-254      AC A0A445FL76.1
#=GS R0G793_9BRAS/1-255          AC R0G793.1
#=GS F4RUD7_MELLP/1-198          AC F4RUD7.1
#=GS A0A4S4MZT3_9APHY/1-227      AC A0A4S4MZT3.1
#=GS A0A452QP59_URSAM/1-212      AC A0A452QP59.1
#=GS S4RDG8_PETMA/1-204          AC S4RDG8.1
#=GS A0A428U244_9HYPO/1-260      AC A0A428U244.1
#=GS W5LG92_ASTMX/1-254          AC W5LG92.1
#=GS A0A4Q2DM30_9AGAR/1-260      AC A0A4Q2DM30.1
#=GS F0VP25_NEOCL/777-817        AC F0VP25.1
#=GS R9A9D9_WALI9/26-277         AC R9A9D9.1
#=GS A0A4W2EER7_BOBOX/1-254      AC A0A4W2EER7.1
#=GS E0W1H6_PEDHC/1-222          AC E0W1H6.1
#=GS B4Q532_DROSI/1-201          AC B4Q532.1
#=GS R1FB86_EMIHU/66-301         AC R1FB86.1
#=GS A0A158NKB3_ATTCE/1-226      AC A0A158NKB3.1
#=GS J4VQK5_BEAB2/1-260          AC J4VQK5.1
#=GS B0X5B1_CULQU/1-255          AC B0X5B1.1
#=GS W5NJQ4_LEPOC/1-254          AC W5NJQ4.1
#=GS A0A2P5CH60_PARAD/16-201     AC A0A2P5CH60.1
#=GS A0A285PXX4_9VIRU/1-122      AC A0A285PXX4.1
#=GS A0A643C9N0_BALPH/7-233      AC A0A643C9N0.1
#=GS A0A1E3NYM2_WICAA/93-195     AC A0A1E3NYM2.1
#=GS A0A024XEJ6_PLAFC/22-304     AC A0A024XEJ6.1
#=GS A0A061J8E2_TRYRA/1-199      AC A0A061J8E2.1
#=GS A0A4S4ENB1_CAMSI/357-419    AC A0A4S4ENB1.1
#=GS A0A183K5Z4_9TREM/1-255      AC A0A183K5Z4.1
#=GS A0A0S3RQH3_PHAAN/1-254      AC A0A0S3RQH3.1
#=GS A0A540M2M6_MALBA/1-85       AC A0A540M2M6.1
#=GS A0A1E3IKW9_9TREE/1-235      AC A0A1E3IKW9.1
#=GS T1NHR3_TRIUA/1-249          AC T1NHR3.1
#=GS F4Q1Q5_CAVFA/1-310          AC F4Q1Q5.1
#=GS A0A2G2VGP1_CAPBA/133-336    AC A0A2G2VGP1.1
#=GS A0A1U8HQZ9_GOSHI/1-255      AC A0A1U8HQZ9.1
#=GS A0A1U7U9S6_CARSF/1-227      AC A0A1U7U9S6.1
#=GS A0A2I1E8X7_9GLOM/1-224      AC A0A2I1E8X7.1
#=GS A0A0N9P705_9VIRU/127-221    AC A0A0N9P705.1
#=GS A0A0D2TSH2_GOSRA/1-88       AC A0A0D2TSH2.1
#=GS H2ZND8_CIOSA/1-254          AC H2ZND8.1
#=GS A0A0V0X8Y0_9BILA/1-227      AC A0A0V0X8Y0.1
#=GS A0A4W2FGJ5_BOBOX/1-254      AC A0A4W2FGJ5.1
#=GS A0A3P7DM50_WUCBA/1-231      AC A0A3P7DM50.1
#=GS K3YG00_SETIT/1-254          AC K3YG00.1
#=GS A0A151WIP5_9HYME/1-220      AC A0A151WIP5.1
#=GS A0A1U8NCF3_GOSHI/1-255      AC A0A1U8NCF3.1
#=GS A0A0V1BWH3_TRISP/454-680    AC A0A0V1BWH3.1
#=GS A0A1D6FJM0_MAIZE/21-130     AC A0A1D6FJM0.1
#=GS A0A430Q9X6_SCHBO/1-142      AC A0A430Q9X6.1
#=GS A0A2K3KGW7_TRIPR/6-72       AC A0A2K3KGW7.1
#=GS G0MZ47_CAEBE/1-227          AC G0MZ47.1
#=GS A0A315VSD5_GAMAF/1-227      AC A0A315VSD5.1
#=GS A0A5N6KYY5_9ROSI/1-244      AC A0A5N6KYY5.1
#=GS A0A5N4EIP7_CAMDR/1-220      AC A0A5N4EIP7.1
#=GS J3LTN1_ORYBR/1-255          AC J3LTN1.1
#=GS W5JFP1_ANODA/1-255          AC W5JFP1.1
#=GS A0A422QCF5_9TRYP/1-231      AC A0A422QCF5.1
#=GS H0ZB47_TAEGU/1-254          AC H0ZB47.2
#=GS C6LVC6_GIAIB/1-260          AC C6LVC6.1
#=GS A0A5D6Y0P8_9STRA/1-240      AC A0A5D6Y0P8.1
#=GS A0A1A6A0Q5_9TREE/1-229      AC A0A1A6A0Q5.1
#=GS A0A158RAD4_TAEAS/17-234     AC A0A158RAD4.1
#=GS K0KWY3_WICCF/91-191         AC K0KWY3.1
#=GS A0A5C3DWU3_9BASI/1-227      AC A0A5C3DWU3.1
#=GS C5G8R5_AJEDR/1-259          AC C5G8R5.1
#=GS A0A135UYI9_9PEZI/1-228      AC A0A135UYI9.1
#=GS A0A2P5F7W5_TREOI/1-254      AC A0A2P5F7W5.1
#=GS A0A6G0URM7_9BILA/1-255      AC A0A6G0URM7.1
#=GS A0A024X9Y0_PLAFC/1-272      AC A0A024X9Y0.1
#=GS A0A4V1XPP9_9PEZI/1-192      AC A0A4V1XPP9.1
#=GS A0A452SJ58_URSAM/1-254      AC A0A452SJ58.1
#=GS A0A3B6KR52_WHEAT/1-255      AC A0A3B6KR52.1
#=GS A0A0B1TLD6_OESDE/1-115      AC A0A0B1TLD6.1
#=GS A0A151GBV0_9HYPO/1-260      AC A0A151GBV0.1
#=GS A0A3Q2FUM3_CYPVA/1-227      AC A0A3Q2FUM3.1
#=GS A0A0V0Q911_PSEPJ/1-229      AC A0A0V0Q911.1
#=GS Q4D6K3_TRYCC/1-228          AC Q4D6K3.1
#=GS A0A0G4GNI5_VITBC/23-227     AC A0A0G4GNI5.1
#=GS A0A2B4R4P4_STYPI/1-155      AC A0A2B4R4P4.1
#=GS A0A0G2H1C4_9EURO/1-227      AC A0A0G2H1C4.1
#=GS A0A392V831_9FABA/1-56       AC A0A392V831.1
#=GS A8NWF9_COPC7/17-266         AC A8NWF9.2
#=GS W8W1L1_9VIRU/135-244        AC W8W1L1.1
#=GS A0A3M2REG6_9HYPO/1-228      AC A0A3M2REG6.1
#=GS B4NPI5_DROWI/1-226          AC B4NPI5.2
#=GS A0A287SKG4_HORVV/121-315    AC A0A287SKG4.1
#=GS A0A164YAS6_DAUCS/1-174      AC A0A164YAS6.1
#=GS A0A4Y8DKD2_9HELO/1-227      AC A0A4Y8DKD2.1
#=GS W6L1H7_9TRYP/1-260          AC W6L1H7.1
#=GS A0A3Q7UW37_URSAR/1-227      AC A0A3Q7UW37.1
#=GS T1FA05_HELRO/10-126         AC T1FA05.1
#=GS A0A1S2YL25_CICAR/1-242      AC A0A1S2YL25.1
#=GS A0A453G1X1_AEGTS/1-254      AC A0A453G1X1.1
#=GS A0A453LG97_AEGTS/1-204      AC A0A453LG97.1
#=GS A0A2G2ZSK2_CAPAN/1-254      AC A0A2G2ZSK2.1
#=GS A0A453M1W3_AEGTS/9-263      AC A0A453M1W3.1
#=GS A0A0D3AQT9_BRAOL/1-254      AC A0A0D3AQT9.1
#=GS E1Z9G0_CHLVA/206-234        AC E1Z9G0.1
#=GS Q7S7J5_NEUCR/1-227          AC Q7S7J5.3
#=GS A0A0L1KQ75_9EUGL/1-231      AC A0A0L1KQ75.1
#=GS A0A439D3Q8_9PEZI/1-227      AC A0A439D3Q8.1
#=GS I3EFL4_NEMP3/1-108          AC I3EFL4.1
#=GS A0A2G5V6S8_9PELO/1-227      AC A0A2G5V6S8.1
#=GS A0A1S8BE00_9PEZI/1-227      AC A0A1S8BE00.1
#=GS A0A183D7X8_9BILA/1-76       AC A0A183D7X8.1
#=GS A0A674C0F7_SALTR/1-254      AC A0A674C0F7.1
#=GS A0A3Q1LQQ3_BOVIN/1-254      AC A0A3Q1LQQ3.1
#=GS A0A653HIM1_9APIC/23-354     AC A0A653HIM1.1
#=GS A0A507DWR9_9FUNG/1-254      AC A0A507DWR9.1
#=GS A0A1B9H3S0_9TREE/1-226      AC A0A1B9H3S0.1
#=GS A0A453M1T2_AEGTS/1-88       AC A0A453M1T2.1
#=GS A0A4V2JVH9_9MICR/1-269      AC A0A4V2JVH9.1
#=GS A0A1J5WYI9_9MICR/101-208    AC A0A1J5WYI9.1
#=GS A0A384ALC6_BALAS/1-227      AC A0A384ALC6.1
#=GS C5K9M1_PERM5/1-226          AC C5K9M1.1
#=GS A0A2I3G015_NOMLE/1-254      AC A0A2I3G015.1
#=GS B6K9U0_TOXGV/1095-1132      AC B6K9U0.1
#=GS XRN2_YEAST/1-254            AC Q02792.3
#=GS R0KG46_SETT2/1-260          AC R0KG46.1
#=GS A0A2G9FVA8_9LAMI/1-248      AC A0A2G9FVA8.1
#=GS A0A5J9UGC8_9POAL/1-254      AC A0A5J9UGC8.1
#=GS A0A446TAP0_TRITD/1-267      AC A0A446TAP0.1
#=GS A0A4Q4UZV6_9PEZI/1-227      AC A0A4Q4UZV6.1
#=GS A0A507QWX2_MONPU/1-259      AC A0A507QWX2.1
#=GS A2QRP8_ASPNC/1-259          AC A2QRP8.1
#=GS A0A287S1H0_HORVV/1-251      AC A0A287S1H0.1
#=GS A0A2J6PXD9_9HELO/1-254      AC A0A2J6PXD9.1
#=GS A0A671WIT7_SPAAU/1-227      AC A0A671WIT7.1
#=GS A0A4P9WJD5_9FUNG/1-244      AC A0A4P9WJD5.1
#=GS G8BYK4_TETPH/1-254          AC G8BYK4.1
#=GS W4J845_PLAFP/15-297         AC W4J845.1
#=GS A0A2Y9RT48_TRIMA/1-227      AC A0A2Y9RT48.1
#=GS A0A5C3EP06_9BASI/1-261      AC A0A5C3EP06.1
#=GS A0A0C9VCK4_SPHS4/1-241      AC A0A0C9VCK4.1
#=GS A0A4W3JP77_CALMI/1-254      AC A0A4W3JP77.1
#=GS A0A5N6G7U3_PETAA/1-257      AC A0A5N6G7U3.1
#=GS A0A0C4EPR0_PUCT1/58-280     AC A0A0C4EPR0.1
#=GS A0A0L1KPZ3_9EUGL/1-115      AC A0A0L1KPZ3.1
#=GS A0A1J1IF62_9DIPT/1-227      AC A0A1J1IF62.1
#=GS A0A0E0JRN0_ORYPU/1-254      AC A0A0E0JRN0.1
#=GS A0A370TLK0_9HELO/1-227      AC A0A370TLK0.1
#=GS K9FNX8_PEND2/1-260          AC K9FNX8.1
#=GS A0A4X2KAM0_VOMUR/1-254      AC A0A4X2KAM0.1
#=GS R4XEQ8_TAPDE/97-202         AC R4XEQ8.1
#=GS E3MMY7_CAERE/1-227          AC E3MMY7.1
#=GS B2WLK6_PYRTR/1-192          AC B2WLK6.1
#=GS A0A0F9XKD8_TRIHA/1-228      AC A0A0F9XKD8.1
#=GS A0A1S3J3Y8_LINUN/1-255      AC A0A1S3J3Y8.1
#=GS A0A2C9VHF3_MANES/1-255      AC A0A2C9VHF3.1
#=GS C5K7B3_PERM5/1-263          AC C5K7B3.1
#=GS A0A2G5DN33_AQUCA/1-188      AC A0A2G5DN33.1
#=GS A0A446UHR7_TRITD/1-258      AC A0A446UHR7.1
#=GS A0A674DJE7_SALTR/4-137      AC A0A674DJE7.1
#=GS A0A162JCN3_9PEZI/1-227      AC A0A162JCN3.1
#=GS A0A671ENB3_RHIFE/1-144      AC A0A671ENB3.1
#=GS A0A5N4EJ67_CAMDR/1-220      AC A0A5N4EJ67.1
#=GS A0A2N6P1R0_BEABA/1-260      AC A0A2N6P1R0.1
#=GS M0ZWH0_SOLTU/1-254          AC M0ZWH0.1
#=GS A0A1B8AC35_FUSPO/1-228      AC A0A1B8AC35.1
#=GS A0A453LGB9_AEGTS/1-62       AC A0A453LGB9.1
#=GS A0A3B6KP77_WHEAT/1-255      AC A0A3B6KP77.1
#=GS A0A660KNS5_9ROSI/1-252      AC A0A660KNS5.1
#=GS A0A3L8S9X3_CHLGU/1-227      AC A0A3L8S9X3.1
#=GS A0A482W2X0_9CUCU/1-227      AC A0A482W2X0.1
#=GS A0A180GG45_PUCT1/1-260      AC A0A180GG45.1
#=GS A0A4S4LMA0_9AGAM/11-227     AC A0A4S4LMA0.1
#=GS A0A098VM69_9MICR/1-240      AC A0A098VM69.1
#=GS A0A4Y7KPR0_PAPSO/1-250      AC A0A4Y7KPR0.1
#=GS A0A1D1UWA0_RAMVA/1-227      AC A0A1D1UWA0.1
#=GS A0A0T6B354_9SCAR/1-58       AC A0A0T6B354.1
#=GS A0A0V1NQ82_9BILA/1-227      AC A0A0V1NQ82.1
#=GS L2GTK3_VAVCU/32-332         AC L2GTK3.1
#=GS A0A2S6CEQ6_9PEZI/1-263      AC A0A2S6CEQ6.1
#=GS A0A3Q1IBF2_ANATE/1-254      AC A0A3Q1IBF2.1
#=GS A0A420PQK7_FUSOX/1-260      AC A0A420PQK7.1
#=GS A0A1D6MQ24_MAIZE/1-254      AC A0A1D6MQ24.1
#=GS A0A074S558_9AGAM/41-299     AC A0A074S558.1
#=GS T1G453_HELRO/1-119          AC T1G453.1
#=GS A0A0C2G9U9_9BILA/20-228     AC A0A0C2G9U9.1
#=GS A0A180H1L9_PUCT1/1-191      AC A0A180H1L9.1
#=GS A0A5C5FZT4_9BASI/1-222      AC A0A5C5FZT4.1
#=GS A0A2T7C064_9POAL/1-255      AC A0A2T7C064.1
#=GS A0A0D3EWU4_9ORYZ/1-254      AC A0A0D3EWU4.1
#=GS A0A2P6NW21_9EUKA/1-229      AC A0A2P6NW21.1
#=GS A0A091EIF8_CORBR/3-236      AC A0A091EIF8.1
#=GS A0A200QQE8_9MAGN/1153-1403  AC A0A200QQE8.1
#=GS A0A5C5FT15_9BASI/1-259      AC A0A5C5FT15.1
#=GS A0A194Q871_PAPXU/1-227      AC A0A194Q871.1
#=GS A0A162LX34_METRR/1-260      AC A0A162LX34.1
#=GS A0A4S4DHQ7_CAMSI/45-299     AC A0A4S4DHQ7.1
#=GS A0A0K0FXX6_STRVS/1-255      AC A0A0K0FXX6.1
#=GS A0A5N5HPG5_9ROSA/1-255      AC A0A5N5HPG5.1
#=GS A0A2G5EID8_AQUCA/1-254      AC A0A2G5EID8.1
#=GS A0A287SKG9_HORVV/98-292     AC A0A287SKG9.1
#=GS A0A0P7B392_9HYPO/1-228      AC A0A0P7B392.1
#=GS I1GM96_BRADI/1-255          AC I1GM96.1
#=GS A0A284RMQ1_ARMOS/1-145      AC A0A284RMQ1.1
#=GS A0A3P7CK80_SCHSO/20-122     AC A0A3P7CK80.1
#=GS A0A135U3J7_9PEZI/1-260      AC A0A135U3J7.1
#=GS A0A6I8UHU7_DROPS/1-256      AC A0A6I8UHU7.1
#=GS A0A2T9YKV1_9FUNG/1-223      AC A0A2T9YKV1.1
#=GS C1GEM5_PARBD/1-227          AC C1GEM5.1
#=GS A0A448YK08_BRENA/1-254      AC A0A448YK08.1
#=GS A0A2H3XJE3_PHODC/1-254      AC A0A2H3XJE3.1
#=GS A0A4Q4WW97_9PEZI/1-260      AC A0A4Q4WW97.1
#=GS A0A4T0MB71_9BASI/1-264      AC A0A4T0MB71.1
#=GS A0A669E6P6_ORENI/1-228      AC A0A669E6P6.1
#=GS A0A166GRW0_DAUCS/1-255      AC A0A166GRW0.1
#=GS A0A061IV25_TRYRA/1-249      AC A0A061IV25.1
#=GS A0A2A4JDR6_HELVI/233-366    AC A0A2A4JDR6.1
#=GS A0A453LG90_AEGTS/1-200      AC A0A453LG90.1
#=GS A0A672V5B0_STRHB/1-227      AC A0A672V5B0.1
#=GS A0A1S3ZDF2_TOBAC/1-151      AC A0A1S3ZDF2.1
#=GS A0A2P6NDC2_9EUKA/1-221      AC A0A2P6NDC2.1
#=GS H8ZBU7_NEMS1/1-206          AC H8ZBU7.1
#=GS A0A081CLS0_PSEA2/1-262      AC A0A081CLS0.1
#=GS I7IPR2_BABMR/1-247          AC I7IPR2.1
#=GS R7YMQ5_CONA1/1-227          AC R7YMQ5.1
#=GS A0A182G3E4_AEDAL/1-227      AC A0A182G3E4.1
#=GS A0A423THA8_PENVA/1-179      AC A0A423THA8.1
#=GS A0A674H827_TAEGU/1-254      AC A0A674H827.1
#=GS A0A251TQE5_HELAN/23-56      AC A0A251TQE5.1
#=GS G0S058_CHATD/1-260          AC G0S058.1
#=GS A0A3M7NCD1_9EURO/1-192      AC A0A3M7NCD1.1
#=GS A0A067TJP7_GALM3/1-92       AC A0A067TJP7.1
#=GS A0A0V0X8R2_9BILA/1-227      AC A0A0V0X8R2.1
#=GS A0A4S4KQN3_9AGAM/73-322     AC A0A4S4KQN3.1
#=GS H2ZND9_CIOSA/1-255          AC H2ZND9.1
#=GS A0A430QEX1_SCHBO/1-255      AC A0A430QEX1.1
#=GS A0A090LFU6_STRRB/1-255      AC A0A090LFU6.1
#=GS F9WKE4_TRYVY/1-291          AC F9WKE4.1
#=GS A0A2K6F7U7_PROCO/132-204    AC A0A2K6F7U7.1
#=GS A4HSR7_LEIIN/1-228          AC A4HSR7.2
#=GS R4X9X0_TAPDE/1-227          AC R4X9X0.1
#=GS A0A397GAI3_9GLOM/96-203     AC A0A397GAI3.1
#=GS A0A5B0NCP0_PUCGR/1-227      AC A0A5B0NCP0.1
#=GS A0A179H756_PURLI/1-228      AC A0A179H756.1
#=GS A7F7G2_SCLS1/1-254          AC A7F7G2.1
#=GS F6SXK5_CIOIN/11-139         AC F6SXK5.2
#=GS A0A183D2V0_9BILA/1-86       AC A0A183D2V0.1
#=GS A0A4Y9XWN6_9AGAM/1-260      AC A0A4Y9XWN6.1
#=GS A0A6G0IJ74_LARCR/1-227      AC A0A6G0IJ74.1
#=GS T0MDL4_9MICR/1-85           AC T0MDL4.1
#=GS A0A512UHQ1_9ASCO/1-252      AC A0A512UHQ1.1
#=GS A0A3L6S893_PANMI/1-255      AC A0A3L6S893.1
#=GS A0A453LG91_AEGTS/1-269      AC A0A453LG91.1
#=GS A0A5B0PP69_PUCGR/1-260      AC A0A5B0PP69.1
#=GS F6HTU7_VITVI/1-76           AC F6HTU7.1
#=GS B6ADJ9_CRYMR/1-233          AC B6ADJ9.1
#=GS A0A4C1V0Q4_EUMVA/1-255      AC A0A4C1V0Q4.1
#=GS A0A5N6QU91_9ROSI/1-251      AC A0A5N6QU91.1
#=GS A0A446UQR8_TRITD/1-255      AC A0A446UQR8.1
#=GS A0A452QNW4_URSAM/1-212      AC A0A452QNW4.1
#=GS A0A0U5GCQ1_9EURO/1-258      AC A0A0U5GCQ1.1
#=GS A0A2I0XCS2_9ASPA/1-61       AC A0A2I0XCS2.1
#=GS A0A2K2DG71_BRADI/1-144      AC A0A2K2DG71.1
#=GS A0A6G1DM54_9ORYZ/1-255      AC A0A6G1DM54.1
#=GS A0A2K3NPB7_TRIPR/1-255      AC A0A2K3NPB7.1
#=GS A0A5N6HWD4_9EURO/1-227      AC A0A5N6HWD4.1
#=GS M1WG75_CLAP2/1-260          AC M1WG75.1
#=GS A0A285PXX4_9VIRU/119-212    AC A0A285PXX4.1
#=GS A0A0L1KZ98_9EUGL/5-128      AC A0A0L1KZ98.1
#=GS A0A091SA92_NESNO/1-202      AC A0A091SA92.1
#=GS A0A0P9F9F3_RHOGW/1-259      AC A0A0P9F9F3.1
#=GS A0CKC7_PARTE/1-245          AC A0CKC7.1
#=GS B4L6X0_DROMO/1-226          AC B4L6X0.2
#=GS A0A6A6NHU4_HEVBR/1-254      AC A0A6A6NHU4.1
#=GS W4KBZ3_HETIT/2-219          AC W4KBZ3.1
#=GS A0A5N5P7P1_9PEZI/1-227      AC A0A5N5P7P1.1
#=GS A0A0D3BUP9_BRAOL/1-241      AC A0A0D3BUP9.1
#=GS W4GDB6_9STRA/1-254          AC W4GDB6.1
#=GS A0A0V1BWX3_TRISP/435-661    AC A0A0V1BWX3.1
#=GS A0A0E0BFJ5_9ORYZ/1-255      AC A0A0E0BFJ5.1
#=GS A0A4T0W4R0_9PEZI/1-228      AC A0A4T0W4R0.1
#=GS M0SQU7_MUSAM/1-234          AC M0SQU7.1
#=GS A0A4W6BWD5_LATCA/1-227      AC A0A4W6BWD5.1
#=GS A0A136J687_9PEZI/1-86       AC A0A136J687.1
#=GS A0A151I7K8_9HYME/1-226      AC A0A151I7K8.1
#=GS A0A067HAX6_CITSI/1-144      AC A0A067HAX6.1
#=GS A0A2C6LC21_9APIC/592-880    AC A0A2C6LC21.1
#=GS A0A2P6QEF9_ROSCH/1-255      AC A0A2P6QEF9.1
#=GS A0A341DD31_NEOAA/1-227      AC A0A341DD31.1
#=GS A0A2K6DG80_MACNE/1-254      AC A0A2K6DG80.1
#=GS A0A1V6RKT5_9EURO/1-227      AC A0A1V6RKT5.1
#=GS A0A090CKB6_PODAN/1-228      AC A0A090CKB6.1
#=GS A0A3M7AYT4_HORWE/1-265      AC A0A3M7AYT4.1
#=GS C9SA94_VERA1/1-260          AC C9SA94.1
#=GS G8BHU0_CANPC/1-250          AC G8BHU0.1
#=GS A0A1D3U7J6_9APIC/1-272      AC A0A1D3U7J6.1
#=GS U6L0P8_EIMTE/1-153          AC U6L0P8.1
#=GS A0A0P1BF07_9BASI/1-272      AC A0A0P1BF07.1
#=GS A0A367Y1J4_9ASCO/1-250      AC A0A367Y1J4.1
#=GS A0A446UQN5_TRITD/1-255      AC A0A446UQN5.1
#=GS A0A0D2B456_9EURO/1-227      AC A0A0D2B456.1
#=GS A0A1Z5J6T6_FISSO/1-317      AC A0A1Z5J6T6.1
#=GS A0A5M9JBZ6_MONFR/36-165     AC A0A5M9JBZ6.1
#=GS A0A4D9B5J6_SALSN/1-255      AC A0A4D9B5J6.1
#=GS A0A446NWR7_TRITD/1-88       AC A0A446NWR7.1
#=GS A0A0D2QNX8_GOSRA/1-254      AC A0A0D2QNX8.1
#=GS A0A103XIA7_CYNCS/1-42       AC A0A103XIA7.1
#=GS A0A4W3HES5_CALMI/1-88       AC A0A4W3HES5.1
#=GS A0A453LGA2_AEGTS/1-269      AC A0A453LGA2.1
#=GS A0A368FBI3_ANCCA/1-89       AC A0A368FBI3.1
#=GS A0A2I0ALA0_9ASPA/1-88       AC A0A2I0ALA0.1
#=GS A0A402E6I5_9SAUR/1-227      AC A0A402E6I5.1
#=GS M7P6U5_PNEMU/1-255          AC M7P6U5.1
#=GS V4V8C8_9ROSI/1-254          AC V4V8C8.1
#=GS A0A218ZBB1_9HELO/58-311     AC A0A218ZBB1.1
#=GS X0DEB8_FUSOX/1-260          AC X0DEB8.1
#=GS A0A1Z5J7E2_FISSO/1-224      AC A0A1Z5J7E2.1
#=GS A0A0D2G1U0_9EURO/1-265      AC A0A0D2G1U0.1
#=GS A0A1U8PE51_GOSHI/1-254      AC A0A1U8PE51.1
#=GS A0A2C5Y2E9_9HYPO/1-260      AC A0A2C5Y2E9.1
#=GS A0A673CG56_9TELE/1-227      AC A0A673CG56.1
#=GS C5WX87_SORBI/1-255          AC C5WX87.1
#=GS A0A196S8Q6_BLAHN/1-221      AC A0A196S8Q6.1
#=GS W7HY15_9PEZI/1-227          AC W7HY15.1
#=GS F0ZRF0_DICPU/1-238          AC F0ZRF0.1
#=GS A0A2H5U0F1_RHIID/1-255      AC A0A2H5U0F1.1
#=GS A0A2R6RBF7_ACTCC/1-69       AC A0A2R6RBF7.1
#=GS A0A1J7IKR8_LUPAN/1-254      AC A0A1J7IKR8.1
#=GS A0A183ALY7_9TREM/1-46       AC A0A183ALY7.1
#=GS A0A446Q735_TRITD/1-46       AC A0A446Q735.1
#=GS A0A2V0NSJ6_9CHLO/1-123      AC A0A2V0NSJ6.1
#=GS A0A5N5KGF1_9ROSI/1-193      AC A0A5N5KGF1.1
#=GS W7JDB4_PLAFA/1-272          AC W7JDB4.1
#=GS A0A168JRJ4_MUCCL/1-248      AC A0A168JRJ4.1
#=GS K3X1Z0_GLOUD/1-255          AC K3X1Z0.1
#=GS E3K4R9_PUCGT/1-227          AC E3K4R9.2
#=GS A0A453M1L9_AEGTS/8-262      AC A0A453M1L9.1
#=GS A0A5F4CSI4_CANLF/1-163      AC A0A5F4CSI4.1
#=GS A0A4Z2DWA9_SCHJA/1-183      AC A0A4Z2DWA9.1
#=GS C1HDL9_PARBA/1-227          AC C1HDL9.1
#=GS A0A2K5DPR6_AOTNA/1-227      AC A0A2K5DPR6.1
#=GS A0A5N4EIX1_CAMDR/1-232      AC A0A5N4EIX1.1
#=GS A7AUQ3_BABBO/1-270          AC A7AUQ3.1
#=GS D4A914_RAT/1-254            AC D4A914.3
#=GS A0A669DQV1_ORENI/1-254      AC A0A669DQV1.1
#=GS A0A0D2SCP2_GOSRA/1-255      AC A0A0D2SCP2.1
#=GS A0A5N7D869_9EURO/1-257      AC A0A5N7D869.1
#=GS B0WKM2_CULQU/1-227          AC B0WKM2.1
#=GS K2PFJ7_TRYCR/1-243          AC K2PFJ7.1
#=GS D6WPZ7_TRICA/1-255          AC D6WPZ7.2
#=GS A0A367IZ69_RHIAZ/1-254      AC A0A367IZ69.1
#=GS A0A1E5RA06_9ASCO/1-246      AC A0A1E5RA06.1
#=GS A0A392NHF3_9FABA/1-123      AC A0A392NHF3.1
#=GS G4MV17_MAGO7/1-227          AC G4MV17.1
#=GS A0A0T6B373_9SCAR/1-149      AC A0A0T6B373.1
#=GS A0A1V6V9T7_9EURO/1-260      AC A0A1V6V9T7.1
#=GS A0A067KL13_JATCU/1-254      AC A0A067KL13.1
#=GS A0A2Z6QW50_9GLOM/1-241      AC A0A2Z6QW50.1
#=GS A0A452I8J4_9SAUR/1-227      AC A0A452I8J4.1
#=GS A0A341BV61_NEOAA/1-254      AC A0A341BV61.1
#=GS A5KBJ4_PLAVS/164-274        AC A5KBJ4.1
#=GS A0A1X0P7T7_9TRYP/1-251      AC A0A1X0P7T7.1
#=GS A0A3Q3LZN3_9TELE/6-138      AC A0A3Q3LZN3.1
#=GS A0A225ATY0_9EURO/1-227      AC A0A225ATY0.1
#=GS A0A2N5VFB5_9BASI/1-227      AC A0A2N5VFB5.1
#=GS A0A2A2LW55_9BILA/1-255      AC A0A2A2LW55.1
#=GS A0A0V1LSV3_9BILA/1-227      AC A0A0V1LSV3.1
#=GS A0A2I0BC70_9ASPA/1-247      AC A0A2I0BC70.1
#=GS A0A0E0P2G6_ORYRU/4-258      AC A0A0E0P2G6.1
#=GS A0A0V0XV71_TRIPS/233-459    AC A0A0V0XV71.1
#=GS A0A0S4JAB4_BODSA/1-329      AC A0A0S4JAB4.1
#=GS A0A446NWQ8_TRITD/1-254      AC A0A446NWQ8.1
#=GS A0A372QTW6_9GLOM/25-276     AC A0A372QTW6.1
#=GS A0A4W6BRE4_LATCA/1-227      AC A0A4W6BRE4.1
#=GS A0A453LG83_AEGTS/2-129      AC A0A453LG83.1
#=GS A0A0V1MCF6_9BILA/10-264     AC A0A0V1MCF6.1
#=GS A0A5P1EIJ1_ASPOF/3-233      AC A0A5P1EIJ1.1
#=GS F0UA88_AJEC8/1-259          AC F0UA88.1
#=GS A2ECV4_TRIVA/1-249          AC A2ECV4.1
#=GS A0A553P9Q1_TIGCA/1-227      AC A0A553P9Q1.1
#=GS A0A6A5LR14_LUPAL/1-255      AC A0A6A5LR14.1
#=GS A0A446Q6T6_TRITD/1-236      AC A0A446Q6T6.1
#=GS Q0D7K3_ORYSJ/1-101          AC Q0D7K3.1
#=GS M3WTR5_FELCA/1-227          AC M3WTR5.4
#=GS A0A158PJZ6_ANGCS/1-227      AC A0A158PJZ6.1
#=GS U4TYM1_DENPD/1-227          AC U4TYM1.1
#=GS A0A287S1D7_HORVV/1-255      AC A0A287S1D7.1
#=GS A0A5N5SR67_9CRUS/1-257      AC A0A5N5SR67.1
#=GS B4N066_DROWI/1-256          AC B4N066.2
#=GS A0A0S6XEQ9_9FUNG/20-203     AC A0A0S6XEQ9.1
#=GS A0A4Q4ZBP8_9PEZI/1-260      AC A0A4Q4ZBP8.1
#=GS A0A2P7YLC8_9PEZI/1-227      AC A0A2P7YLC8.1
#=GS A0A176WQH6_MARPO/1-254      AC A0A176WQH6.1
#=GS A0A1B9IM36_9TREE/1-258      AC A0A1B9IM36.1
#=GS A0A671WM69_SPAAU/1-192      AC A0A671WM69.1
#=GS A0A2J7QVH1_9NEOP/1-227      AC A0A2J7QVH1.1
#=GS A0A137Q9X0_9AGAR/9-226      AC A0A137Q9X0.1
#=GS A0A4W3HGU5_CALMI/2-205      AC A0A4W3HGU5.1
#=GS W8W1T0_9VIRU/1-134          AC W8W1T0.1
#=GS A0A1B9FXW7_9TREE/1-229      AC A0A1B9FXW7.1
#=GS A0A4S4LLA6_9AGAM/1-260      AC A0A4S4LLA6.1
#=GS A0A401P1R7_SCYTO/34-287     AC A0A401P1R7.1
#=GS A0A061CZZ3_BABBI/1-271      AC A0A061CZZ3.1
#=GS A0A1S3VJQ0_VIGRR/1-251      AC A0A1S3VJQ0.1
#=GS A0A2B7ZRV4_9EURO/1-227      AC A0A2B7ZRV4.1
#=GS A0A183Q1P0_9TREM/1-78       AC A0A183Q1P0.1
#=GS A0A0S4IWC0_BODSA/1-200      AC A0A0S4IWC0.1
#=GS A0A553HYH9_9PEZI/1-227      AC A0A553HYH9.1
#=GS Q9VWI1_DROME/1-226          AC Q9VWI1.1
#=GS W8QE83_9VIRU/121-228        AC W8QE83.1
#=GS H9FRE3_MACMU/1-254          AC H9FRE3.1
#=GS A0A150UUF5_9PEZI/1-79       AC A0A150UUF5.1
#=GS A0A3B3HTS4_ORYLA/1-254      AC A0A3B3HTS4.1
#=GS A0A162ASM6_DAUCS/1-238      AC A0A162ASM6.1
#=GS A0A445LGM1_GLYSO/1-256      AC A0A445LGM1.1
#=GS A0A4Z1KU18_9HELO/1-227      AC A0A4Z1KU18.1
#=GS E3RIA5_PYRTT/1-227          AC E3RIA5.1
#=GS A0A3Q0KN92_SCHMA/1-187      AC A0A3Q0KN92.1
#=GS A0A2K3DVR7_CHLRE/1-199      AC A0A2K3DVR7.1
#=GS A0A2K6U3J6_SAIBB/1-227      AC A0A2K6U3J6.1
#=GS A0A1X1BLB8_9APIC/1-269      AC A0A1X1BLB8.1
#=GS D2XAW2_GBMV/1-120           AC D2XAW2.1
#=GS A0A437AME5_9MICR/1-249      AC A0A437AME5.1
#=GS A0A2C5X0V8_9PEZI/1-258      AC A0A2C5X0V8.1
#=GS F2WLR5_9VIRU/11-131         AC F2WLR5.1
#=GS A0A2Y9JFU8_ENHLU/1-227      AC A0A2Y9JFU8.1
#=GS A0A1L9NFW0_ASPTC/1-227      AC A0A1L9NFW0.1
#=GS A0A3Q7G7X3_SOLLC/1-254      AC A0A3Q7G7X3.1
#=GS B6KFS2_TOXGV/1-245          AC B6KFS2.1
#=GS U7PKF2_SPOS1/1-260          AC U7PKF2.1
#=GS A0A3B6ELM8_WHEAT/1-254      AC A0A3B6ELM8.1
#=GS A0A1Q3C8R0_CEPFO/1-225      AC A0A1Q3C8R0.1
#=GS A0A154P516_DUFNO/1-255      AC A0A154P516.1
#=GS A0A1B8GL08_9PEZI/1-227      AC A0A1B8GL08.1
#=GS A0A166ZJI6_9PEZI/1-260      AC A0A166ZJI6.1
#=GS A0A509AJ58_PLABA/59-273     AC A0A509AJ58.1
#=GS A0A4W4G9K9_ELEEL/1-227      AC A0A4W4G9K9.1
#=GS T0M3A4_CAMFR/3-256          AC T0M3A4.1
#=GS A0A498IMI0_MALDO/1-252      AC A0A498IMI0.1
#=GS A0A1C7LTM4_GRIFR/1-206      AC A0A1C7LTM4.1
#=GS A0A2Y9TD31_PHYMC/1-227      AC A0A2Y9TD31.1
#=GS A0A1J5WYI9_9MICR/1-109      AC A0A1J5WYI9.1
#=GS A0A2G5B9M2_COERN/1-253      AC A0A2G5B9M2.1
#=GS S9U8R8_9TRYP/94-341         AC S9U8R8.1
#=GS A0A328DMP7_9ASTE/1-254      AC A0A328DMP7.1
#=GS X6NTG6_RETFI/1-229          AC X6NTG6.1
#=GS A0A1U8PGV3_GOSHI/1-254      AC A0A1U8PGV3.1
#=GS Q4N2I0_THEPA/1-268          AC Q4N2I0.1
#=GS A0A162IRB1_CORDF/1-260      AC A0A162IRB1.1
#=GS A0A1D6GFP1_MAIZE/1-255      AC A0A1D6GFP1.1
#=GS A0A200QQE8_9MAGN/1-254      AC A0A200QQE8.1
#=GS A7TQ00_VANPO/1-254          AC A7TQ00.1
#=GS A0A452DTJ8_CAPHI/1-254      AC A0A452DTJ8.1
#=GS A0A5F7ZF39_MACMU/110-240    AC A0A5F7ZF39.1
#=GS M2X7X0_GALSU/1-257          AC M2X7X0.1
#=GS A0A1J8RIQ8_9AGAM/1-227      AC A0A1J8RIQ8.1
#=GS A0A5G2RBD4_PIG/1-227        AC A0A5G2RBD4.1
#=GS G7E7M5_MIXOS/1-227          AC G7E7M5.1
#=GS A2FHN6_TRIVA/1-211          AC A2FHN6.1
#=GS A0A0E0I4F2_ORYNI/1-115      AC A0A0E0I4F2.1
#=GS A0A4Z0Z1P3_9PEZI/1-260      AC A0A4Z0Z1P3.1
#=GS A0A1J8PW93_9AGAM/36-295     AC A0A1J8PW93.1
#=GS S9TXD2_9TRYP/22-254         AC S9TXD2.1
#=GS A0A674DKM4_SALTR/1-227      AC A0A674DKM4.1
#=GS L8FNP2_PSED2/1-227          AC L8FNP2.1
#=GS S9UQX4_9TRYP/22-272         AC S9UQX4.1
#=GS A0A4U6SUJ5_SETVI/1-255      AC A0A4U6SUJ5.1
#=GS A0A0F4GRH1_9PEZI/1-228      AC A0A0F4GRH1.1
#=GS A0A1U7X1I6_NICSY/1-144      AC A0A1U7X1I6.1
#=GS A0A0V0UT95_9BILA/6-260      AC A0A0V0UT95.1
#=GS A0A0L0HIV7_SPIPD/1-206      AC A0A0L0HIV7.1
#=GS A0A5N4EIH4_CAMDR/1-220      AC A0A5N4EIH4.1
#=GS A0A1Y2ACR1_9FUNG/1-168      AC A0A1Y2ACR1.1
#=GS A0A6A5BPE7_NAEFO/128-229    AC A0A6A5BPE7.1
#=GS A0A0L1KUK9_9EUGL/1-217      AC A0A0L1KUK9.1
#=GS A0A0B2X7H0_METAS/1-193      AC A0A0B2X7H0.1
#=GS A0A4W6FTC5_LATCA/1-254      AC A0A4W6FTC5.1
#=GS A0A1X1BGW8_9APIC/74-312     AC A0A1X1BGW8.1
#=GS A0A158Q501_DRAME/1-227      AC A0A158Q501.1
#=GS A0A2H4UUU7_9VIRU/1-215      AC A0A2H4UUU7.1
#=GS A0A1U8KVN5_GOSHI/1-255      AC A0A1U8KVN5.1
#=GS A0A3L6Q1N0_PANMI/784-873    AC A0A3L6Q1N0.1
#=GS S8E775_9LAMI/1-187          AC S8E775.1
#=GS I7LUA6_TETTS/1-247          AC I7LUA6.1
#=GS A0A448ZSH2_9STRA/61-306     AC A0A448ZSH2.1
#=GS A0A5N6TVS8_9EURO/1-227      AC A0A5N6TVS8.1
#=GS A0A1J4K3Z4_9EUKA/95-192     AC A0A1J4K3Z4.1
#=GS A0A3Q0I6A4_PHODC/1-255      AC A0A3Q0I6A4.1
#=GS A0A6A3ABP2_HIBSY/1-164      AC A0A6A3ABP2.1
#=GS A0A4U8V2K8_STECR/1-227      AC A0A4U8V2K8.1
#=GS A0A674NSH5_TAKRU/15-259     AC A0A674NSH5.1
#=GS A0A1U7Z3L7_NELNU/1-248      AC A0A1U7Z3L7.1
#=GS A0A010R961_9PEZI/1-260      AC A0A010R961.1
#=GS A0A3L6PNM0_PANMI/1-254      AC A0A3L6PNM0.1
#=GS A0A1Q9DQ48_SYMMI/1-226      AC A0A1Q9DQ48.1
#=GS A0A1L7WVL4_9HELO/1-218      AC A0A1L7WVL4.1
#=GS A0A4Y9YA93_9AGAM/28-249     AC A0A4Y9YA93.1
#=GS R4XBL5_TAPDE/1-255          AC R4XBL5.1
#=GS G9N8T7_HYPVG/1-189          AC G9N8T7.1
#=GS A0A2P5VZ85_GOSBA/1-254      AC A0A2P5VZ85.1
#=GS A0A5E4MV77_9HEMI/1-254      AC A0A5E4MV77.1
#=GS A0A1F8AA46_9EURO/1-257      AC A0A1F8AA46.1
#=GS A0A287LYG5_HORVV/36-289     AC A0A287LYG5.1
#=GS A0A067HAW9_CITSI/1-254      AC A0A067HAW9.1
#=GS A0A6H5I1X9_9HYME/1-255      AC A0A6H5I1X9.1
#=GS A0A446Q6V3_TRITD/1-174      AC A0A446Q6V3.1
#=GS A0A1J1H5U9_PLARL/41-255     AC A0A1J1H5U9.1
#=GS A0A0E0R4G0_ORYRU/1-193      AC A0A0E0R4G0.1
#=GS A0A6G0Y2L4_APHCR/1-255      AC A0A6G0Y2L4.1
#=GS A0A444YKG6_ARAHY/84-340     AC A0A444YKG6.1
#=GS A0A5C7H676_9ROSI/1-254      AC A0A5C7H676.1
#=GS A0A371DL31_9APHY/1-52       AC A0A371DL31.1
#=GS A0A395NJP8_TRIAR/1-260      AC A0A395NJP8.1
#=GS V5D681_TRYCR/1-135          AC V5D681.1
#=GS Q4UI27_THEAN/78-314         AC Q4UI27.1
#=GS A0A2R6WDK2_MARPO/1-254      AC A0A2R6WDK2.1
#=GS H2ZNE0_CIOSA/1-255          AC H2ZNE0.1
#=GS A0A3D8T4Z0_9EURO/1-227      AC A0A3D8T4Z0.1
#=GS A0A024VVN3_PLAFA/22-298     AC A0A024VVN3.1
#=GS A0A672FFG0_SALFA/62-215     AC A0A672FFG0.1
#=GS A0A3Q3H0M9_KRYMA/3-126      AC A0A3Q3H0M9.1
#=GS A0A0N4TCL7_BRUPA/1-140      AC A0A0N4TCL7.1
#=GS A0A1Y1XEL7_9FUNG/1-187      AC A0A1Y1XEL7.1
#=GS A0A2R8ZI65_PANPA/1-227      AC A0A2R8ZI65.1
#=GS A0A0F8U1X6_9EURO/1-227      AC A0A0F8U1X6.1
#=GS A0A150G503_GONPE/1-226      AC A0A150G503.1
#=GS A0A3M9YKQ6_9PEZI/1-228      AC A0A3M9YKQ6.1
#=GS A0A0A2LJX5_PENIT/1-260      AC A0A0A2LJX5.1
#=GS A0A0R3QFT5_9BILA/1-46       AC A0A0R3QFT5.1
#=GS A0A2Y9RN60_TRIMA/1-227      AC A0A2Y9RN60.1
#=GS A0A2P1EJ93_9VIRU/70-292     AC A0A2P1EJ93.1
#=GS A0A0L0GDF4_9EUKA/1-254      AC A0A0L0GDF4.1
#=GS K2N280_TRYCR/48-351         AC K2N280.1
#=GS A0A662X7Y6_9STRA/532-771    AC A0A662X7Y6.1
#=GS A0A5N5Q0R5_9PEZI/1-260      AC A0A5N5Q0R5.1
#=GS A0A0M9G7C8_9TRYP/1-285      AC A0A0M9G7C8.1
#=GS A0A540M6J6_MALBA/19-175     AC A0A540M6J6.1
#=GS R1CPP9_EMIHU/34-162         AC R1CPP9.1
#=GS A0A096NVR3_PAPAN/1-254      AC A0A096NVR3.2
#=GS A0A1L8G1K6_XENLA/128-200    AC A0A1L8G1K6.1
#=GS A0A384DG16_URSMA/1-227      AC A0A384DG16.1
#=GS G5CBC2_HETGA/1-254          AC G5CBC2.1
#=GS D3AY96_POLPP/135-236        AC D3AY96.1
#=GS A0A4W5PW27_9TELE/1-227      AC A0A4W5PW27.1
#=GS A0A671WZB3_SPAAU/1-254      AC A0A671WZB3.1
#=GS A0A091P460_HALAL/2-230      AC A0A091P460.1
#=GS A0A4C1UNF2_EUMVA/1-134      AC A0A4C1UNF2.1
#=GS G5AZ56_HETGA/1-227          AC G5AZ56.1
#=GS A8XYR3_CAEBR/1-227          AC A8XYR3.2
#=GS A0A0V0ZDT2_9BILA/6-260      AC A0A0V0ZDT2.1
#=GS A0A2C5XDE6_9HYPO/102-204    AC A0A2C5XDE6.1
#=GS L5M9A1_MYODS/1-138          AC L5M9A1.1
#=GS A0A5N6FXI3_PETAA/1-227      AC A0A5N6FXI3.1
#=GS A0A067EDY5_CITSI/1-255      AC A0A067EDY5.1
#=GS A0A1S4CCZ6_TOBAC/1-254      AC A0A1S4CCZ6.1
#=GS A0A2W1BT41_HELAM/1-218      AC A0A2W1BT41.1
#=GS A0A2K3N9L9_TRIPR/1-240      AC A0A2K3N9L9.1
#=GS A0A194S7J0_RHOGW/1-134      AC A0A194S7J0.1
#=GS A0A672V834_STRHB/1-227      AC A0A672V834.1
#=GS A0A5N5K6R6_9ROSI/256-391    AC A0A5N5K6R6.1
#=GS A0A2I2EXL7_9EURO/1-259      AC A0A2I2EXL7.1
#=GS XRN2_HUMAN/1-254            AC Q9H0D6.1
#=GS C4MB93_ENTHI/114-220        AC C4MB93.1
#=GS A0A0V0X872_9BILA/1-227      AC A0A0V0X872.1
#=GS A0A4S4DY34_CAMSI/1-230      AC A0A4S4DY34.1
#=GS A0A2P7YF81_9ASCO/464-692    AC A0A2P7YF81.1
#=GS A0A137QL22_9AGAR/1-259      AC A0A137QL22.1
#=GS A0A093XVK5_9PEZI/1-227      AC A0A093XVK5.1
#=GS J9J378_9SPIT/1-231          AC J9J378.1
#=GS A0A368S423_SETIT/1-246      AC A0A368S423.1
#=GS A0A1A8YQ96_9APIC/1-272      AC A0A1A8YQ96.1
#=GS A0A180H070_PUCT1/1-227      AC A0A180H070.1
#=GS G3TDK6_LOXAF/1-254          AC G3TDK6.1
#=GS A0A4U6SRM0_SETVI/1-255      AC A0A4U6SRM0.1
#=GS A0A4W3JP97_CALMI/106-222    AC A0A4W3JP97.1
#=GS I2G634_USTH4/1-227          AC I2G634.1
#=GS R1C673_EMIHU/1-192          AC R1C673.1
#=GS A0A3P8YH78_ESOLU/1-254      AC A0A3P8YH78.1
#=GS A0A1U7X9N4_NICSY/1-254      AC A0A1U7X9N4.1
#=GS A0A068UF84_COFCA/1-239      AC A0A068UF84.1
#=GS A0A094L962_PODCR/2-230      AC A0A094L962.1
#=GS A0A5N6TAD0_ASPPS/1-257      AC A0A5N6TAD0.1
#=GS W5P2W0_SHEEP/3-229          AC W5P2W0.1
#=GS A0A5B7EBG8_PORTR/1-76       AC A0A5B7EBG8.1
#=GS A0A2H3ZT99_PHODC/1-255      AC A0A2H3ZT99.1
#=GS A0A2T9YLK3_9FUNG/1-253      AC A0A2T9YLK3.1
#=GS A0A1R3GW73_COCAP/1-255      AC A0A1R3GW73.1
#=GS A0A0A0KNF5_CUCSA/1-254      AC A0A0A0KNF5.1
#=GS A0A091UN18_NIPNI/2-230      AC A0A091UN18.1
#=GS A7TIY6_VANPO/1-228          AC A7TIY6.1
#=GS B4MA44_DROVI/1-226          AC B4MA44.2
#=GS E9CSJ5_COCPS/1-227          AC E9CSJ5.1
#=GS A0A453G1X5_AEGTS/36-289     AC A0A453G1X5.1
#=GS A0A1S3LVT7_SALSA/1-227      AC A0A1S3LVT7.1
#=GS A0A485PUC8_LYNPA/10-232     AC A0A485PUC8.1
#=GS A0A091MAC6_CARIC/2-230      AC A0A091MAC6.1
#=GS A0A3Q1FP20_9TELE/1-225      AC A0A3Q1FP20.1
#=GS A0A401T7I1_CHIPU/1-227      AC A0A401T7I1.1
#=GS A0A3Q1BXT3_AMPOC/1-254      AC A0A3Q1BXT3.1
#=GS A0A4R8RB45_COLTR/1-228      AC A0A4R8RB45.1
#=GS X6MLI2_RETFI/1-190          AC X6MLI2.1
#=GS A0A369JM15_HYPMA/1-260      AC A0A369JM15.1
#=GS A0A4D8ZLG5_SALSN/1-234      AC A0A4D8ZLG5.1
#=GS A0A4W3HBZ7_CALMI/1-88       AC A0A4W3HBZ7.1
#=GS A0A0D0BMG4_9AGAM/1-204      AC A0A0D0BMG4.1
#=GS M7NSN6_PNEMU/1-224          AC M7NSN6.1
#=GS W6KTW7_9TRYP/3-265          AC W6KTW7.1
#=GS A0A3B1JUI0_ASTMX/2-138      AC A0A3B1JUI0.1
#=GS B4JHR5_DROGR/1-256          AC B4JHR5.1
#=GS A0A2G2X1B3_CAPBA/1-254      AC A0A2G2X1B3.1
#=GS A0A4Y7IU98_PAPSO/6-64       AC A0A4Y7IU98.1
#=GS Q9BHK7_CAEEL/1-227          AC Q9BHK7.3
#=GS A0A453LG42_AEGTS/2-62       AC A0A453LG42.1
#=GS A0A061HD67_BLUGR/1-256      AC A0A061HD67.1
#=GS A0A4E0RYG4_FASHE/1-224      AC A0A4E0RYG4.1
#=GS A0A0V0WGA4_9BILA/1-255      AC A0A0V0WGA4.1
#=GS XRN2_KLULA/1-254            AC Q6CKX0.3
#=GS T1FT39_HELRO/1-255          AC T1FT39.1
#=GS A0A0G2E2P7_9EURO/1-261      AC A0A0G2E2P7.1
#=GS A0A1S2XUJ6_CICAR/1-255      AC A0A1S2XUJ6.1
#=GS B8AHX3_ORYSI/1-229          AC B8AHX3.1
#=GS A0A329SMC5_9STRA/1-255      AC A0A329SMC5.1
#=GS A0A0M8ZVB7_9HYME/1-255      AC A0A0M8ZVB7.1
#=GS F0Y221_AURAN/1-222          AC F0Y221.1
#=GS C5FI77_ARTOC/1-213          AC C5FI77.1
#=GS E3RI22_PYRTT/1-260          AC E3RI22.1
#=GS A0A2I0L9Q3_PUNGR/1-254      AC A0A2I0L9Q3.1
#=GS A0A0G2FTF7_9PEZI/1-260      AC A0A0G2FTF7.1
#=GS XRN4_ARATH/1-255            AC Q9FQ04.1
#=GS C5DHT9_LACTC/1-227          AC C5DHT9.1
#=GS A0A5C3F2Q3_9BASI/1-227      AC A0A5C3F2Q3.1
#=GS A0A3M0K4F0_HIRRU/1-254      AC A0A3M0K4F0.1
#=GS A0A068S692_9FUNG/1-254      AC A0A068S692.1
#=GS A0A0G4N2W1_9PEZI/1-88       AC A0A0G4N2W1.1
#=GS A0A368FCI8_ANCCA/1-156      AC A0A368FCI8.1
#=GS A0A4X3P1C0_PRIPA/1-140      AC A0A4X3P1C0.1
#=GS A0A167EJM5_9ASCO/1-201      AC A0A167EJM5.1
#=GS A0A1U7X4T1_NICSY/1-254      AC A0A1U7X4T1.1
#=GS A0A2P6N6C9_9EUKA/103-179    AC A0A2P6N6C9.1
#=GS A0A016TM48_9BILA/1-255      AC A0A016TM48.1
#=GS A0A177BB76_9BILA/1-216      AC A0A177BB76.1
#=GS C4XVV4_CLAL4/1-191          AC C4XVV4.1
#=GS A0A146JIN5_9VIRU/116-211    AC A0A146JIN5.1
#=GS A0A1V8TW63_9PEZI/1-262      AC A0A1V8TW63.1
#=GS A0A2X0M6Q4_9BASI/1-238      AC A0A2X0M6Q4.1
#=GS A0A087HIP7_ARAAL/1-254      AC A0A087HIP7.1
#=GS A0A6A3SA01_9STRA/1-255      AC A0A6A3SA01.1
#=GS A0A445IN74_GLYSO/1-252      AC A0A445IN74.1
#=GS V2WUA9_MONRO/1-227          AC V2WUA9.1
#=GS A0A446UR20_TRITD/1-255      AC A0A446UR20.1
#=GS X1WQ75_ACYPI/1-255          AC X1WQ75.1
#=GS A0A151ZDW3_9MYCE/1-284      AC A0A151ZDW3.1
#=GS A0A094H9T2_9PEZI/1-227      AC A0A094H9T2.1
#=GS A0A0D2TMR2_GOSRA/1-254      AC A0A0D2TMR2.1
#=GS V7BG04_PHAVU/1-255          AC V7BG04.1
#=GS A0A091HUE0_CALAN/1-227      AC A0A091HUE0.1
#=GS N1S2K8_FUSC4/1-260          AC N1S2K8.1
#=GS A0A087SM89_AUXPR/1-211      AC A0A087SM89.1
#=GS W6Q5U5_PENRF/1-227          AC W6Q5U5.1
#=GS A0A1V6P8L4_PENDC/1-227      AC A0A1V6P8L4.1
#=GS XRN2_PONAB/1-254            AC Q5R4L5.1
#=GS F2U460_SALR5/44-293         AC F2U460.1
#=GS A0A1U8Q8A4_NELNU/3-122      AC A0A1U8Q8A4.1
#=GS A0A5B6VUF4_9ROSI/1-255      AC A0A5B6VUF4.1
#=GS A0A1Y1V393_9FUNG/1-182      AC A0A1Y1V393.1
#=GS A0A364MZG7_9PLEO/1-227      AC A0A364MZG7.1
#=GS A0A367YB15_9ASCO/1-226      AC A0A367YB15.1
#=GS A0A427YVE3_9TREE/1-260      AC A0A427YVE3.1
#=GS A0A3R7LP82_TRYRA/1-237      AC A0A3R7LP82.1
#=GS A0A287LYE7_HORVV/3-131      AC A0A287LYE7.1
#=GS A0A166APL7_9AGAM/1-210      AC A0A166APL7.1
#=GS A0A369SCM7_9METZ/1-282      AC A0A369SCM7.1
#=GS A0A067GZ01_CITSI/1-254      AC A0A067GZ01.1
#=GS A0A445F950_GLYSO/1-255      AC A0A445F950.1
#=GS A0A4U0U4K2_9PEZI/1-228      AC A0A4U0U4K2.1
#=GS A0A094KMG0_ANTCR/3-233      AC A0A094KMG0.1
#=GS A0A2G8SNV5_9APHY/1-227      AC A0A2G8SNV5.1
#=GS A0A1S4BII1_TOBAC/28-222     AC A0A1S4BII1.1
#=GS G4UGX0_NEUT9/1-227          AC G4UGX0.1
#=GS A0A4T0WXM6_9ASCO/1-254      AC A0A4T0WXM6.1
#=GS A0A6A3CKN7_HIBSY/1-255      AC A0A6A3CKN7.1
#=GS A0A3Q0IAZ7_PHODC/1-255      AC A0A3Q0IAZ7.1
#=GS A0A5F9CVN0_RABIT/1-254      AC A0A5F9CVN0.1
#=GS A0A453G1W3_AEGTS/1-187      AC A0A453G1W3.1
#=GS A0A673B2V0_9TELE/1-254      AC A0A673B2V0.1
#=GS F1Q4U5_DANRE/1-227          AC F1Q4U5.1
#=GS A0A1U8ATX2_NELNU/1-253      AC A0A1U8ATX2.1
#=GS A0A3P9CDL3_9CICH/1-227      AC A0A3P9CDL3.1
#=GS A0A2I1C8M5_9EURO/1-205      AC A0A2I1C8M5.1
#=GS A0A2K3DHL2_CHLRE/134-300    AC A0A2K3DHL2.1
#=GS A0A1D6QHZ5_MAIZE/1-88       AC A0A1D6QHZ5.1
#=GS A0A2Y9FJF9_PHYMC/1-254      AC A0A2Y9FJF9.1
#=GS A0A0V1B159_TRISP/6-261      AC A0A0V1B159.1
#=GS A0A5J5MQ28_MUNRE/3-229      AC A0A5J5MQ28.1
#=GS A0A2V3IWE5_9FLOR/1-225      AC A0A2V3IWE5.1
#=GS A0A6A4WUY6_AMPAM/1-255      AC A0A6A4WUY6.1
#=GS A0A6A4W2G3_AMPAM/1-227      AC A0A6A4W2G3.1
#=GS A0A6I8RYS6_XENTR/1-227      AC A0A6I8RYS6.1
#=GS A0A177VEL3_9BASI/1-261      AC A0A177VEL3.1
#=GS A0A2V3IPF9_9FLOR/1-276      AC A0A2V3IPF9.1
#=GS A0A2G5DN20_AQUCA/1-128      AC A0A2G5DN20.1
#=GS A0A0L1JDW1_ASPNO/1-257      AC A0A0L1JDW1.1
#=GS A0A0S4ILZ5_BODSA/140-251    AC A0A0S4ILZ5.1
#=GS A0A6A5EM62_PERFL/20-246     AC A0A6A5EM62.1
#=GS G0QQF0_ICHMG/1-230          AC G0QQF0.1
#=GS A0A183ET47_9BILA/1-59       AC A0A183ET47.1
#=GS A0A0V1HBN0_9BILA/1-194      AC A0A0V1HBN0.1
#=GS A0A251T485_HELAN/1-254      AC A0A251T485.1
#=GS A0A0D9V8E9_9ORYZ/1-254      AC A0A0D9V8E9.1
#=GS A0A5J5FB78_9PEZI/1-255      AC A0A5J5FB78.1
#=GS A0A452QPB3_URSAM/1-212      AC A0A452QPB3.1
#=GS A0A2P1EM37_9VIRU/76-292     AC A0A2P1EM37.1
#=GS A0A2T0FHM8_9ASCO/1-226      AC A0A2T0FHM8.1
#=GS A0A2K6A672_MANLE/1-254      AC A0A2K6A672.1
#=GS A0A401KK71_ASPAW/1-227      AC A0A401KK71.1
#=GS A0A093HMR0_STRCA/2-230      AC A0A093HMR0.1
#=GS A0A5N5WME2_9EURO/1-259      AC A0A5N5WME2.1
#=GS A0A0M3IZI5_ANISI/1-188      AC A0A0M3IZI5.1
#=GS A0A663E9T5_AQUCH/147-223    AC A0A663E9T5.1
#=GS A8P3K5_COPC7/36-254         AC A8P3K5.2
#=GS G1X2J8_ARTOA/1-227          AC G1X2J8.1
#=GS A7ATB8_BABBO/1-255          AC A7ATB8.1
#=GS A0A1M8A844_MALS4/1-259      AC A0A1M8A844.1
#=GS L8GMR4_ACACA/1-192          AC L8GMR4.1
#=GS A0A2J7ZQ31_9CHLO/1-137      AC A0A2J7ZQ31.1
#=GS A0A5F9C4X8_RABIT/105-197    AC A0A5F9C4X8.1
#=GS A0A660KPJ6_9ROSI/1-151      AC A0A660KPJ6.1
#=GS Q4DF75_TRYCC/90-393         AC Q4DF75.1
#=GS A0A397Z1E1_BRACM/1-254      AC A0A397Z1E1.1
#=GS A0A2K5C6F9_AOTNA/1-254      AC A0A2K5C6F9.1
#=GS A0A6G0TYG3_APHGL/1-227      AC A0A6G0TYG3.1
#=GS A0A0R0ERD9_SOYBN/1-255      AC A0A0R0ERD9.1
#=GS E9G6R7_DAPPU/1-256          AC E9G6R7.1
#=GS A0A0D2UUQ5_GOSRA/1-144      AC A0A0D2UUQ5.1
#=GS J4C7N2_THEOR/87-325         AC J4C7N2.1
#=GS A0A287SKH3_HORVV/66-260     AC A0A287SKH3.1
#=GS A0A6I8W551_DROPS/1-226      AC A0A6I8W551.1
#=GS A0A0N4VBL5_ENTVE/85-311     AC A0A0N4VBL5.2
#=GS G1QXY0_NOMLE/1-227          AC G1QXY0.1
#=GS A0A3P8ZKQ3_ESOLU/1-227      AC A0A3P8ZKQ3.1
#=GS A0A5N5J7Q6_PANHP/1-227      AC A0A5N5J7Q6.1
#=GS A0A3P6SRD0_LITSI/13-266     AC A0A3P6SRD0.1
#=GS S8D5H8_9LAMI/1-255          AC S8D5H8.1
#=GS A0A5E4R3Y9_9NEOP/1-227      AC A0A5E4R3Y9.1
#=GS B8B8J9_ORYSI/1-93           AC B8B8J9.1
#=GS A0A232F2Z4_9HYME/1-227      AC A0A232F2Z4.1
#=GS A0A315VY68_GAMAF/1-236      AC A0A315VY68.1
#=GS A0A4U0X601_9PEZI/1-263      AC A0A4U0X601.1
#=GS F7GUR3_CALJA/1-227          AC F7GUR3.3
#=GS X6LW28_RETFI/1-40           AC X6LW28.1
#=GS A0A024WQL4_PLAFA/1-272      AC A0A024WQL4.1
#=GS A0A0E0CAX8_9ORYZ/1-254      AC A0A0E0CAX8.1
#=GS A0A2S4L446_9HYPO/1-193      AC A0A2S4L446.1
#=GS A0A179UHX1_BLAGS/1-149      AC A0A179UHX1.1
#=GS A0A1S3V7E0_VIGRR/1-255      AC A0A1S3V7E0.1
#=GS X6NTG6_RETFI/245-345        AC X6NTG6.1
#=GS C4MB93_ENTHI/1-119          AC C4MB93.1
#=GS A0A1C7NEK3_9FUNG/1-227      AC A0A1C7NEK3.1
#=GS A0A1D6GFM3_MAIZE/1-255      AC A0A1D6GFM3.1
#=GS A0A2H6KBU9_9APIC/3-130      AC A0A2H6KBU9.1
#=GS A0A671ETB2_RHIFE/1-254      AC A0A671ETB2.1
#=GS A0A1X0NX31_9TRYP/1-253      AC A0A1X0NX31.1
#=GS A0A0D2CTF3_9EURO/1-264      AC A0A0D2CTF3.1
#=GS A0A6A2XM87_HIBSY/1-104      AC A0A6A2XM87.1
#=GS A0A087RJN5_APTFO/3-233      AC A0A087RJN5.1
#=GS A0A1S3E2B9_CICAR/1-255      AC A0A1S3E2B9.2
#=GS A0A1U7ZP95_NELNU/1-254      AC A0A1U7ZP95.1
#=GS W9CGS3_SCLBF/1-254          AC W9CGS3.1
#=GS K3Y598_SETIT/1-244          AC K3Y598.1
#=GS W6UME3_ECHGR/1-257          AC W6UME3.1
#=GS XRN3_ARATH/1-254            AC Q9FQ03.1
#=GS A0A287S1P3_HORVV/1-154      AC A0A287S1P3.1
#=GS K2MMR2_TRYCR/1-237          AC K2MMR2.1
#=GS A0A2X0M022_9BASI/1-260      AC A0A2X0M022.1
#=GS F4P9P3_BATDJ/6-109          AC F4P9P3.1
#=GS A0A1Q9EFQ2_SYMMI/2923-3161  AC A0A1Q9EFQ2.1
#=GS A0A4U0TXQ8_9PEZI/1-228      AC A0A4U0TXQ8.1
#=GS A0A420HVX0_9PEZI/1-227      AC A0A420HVX0.1
#=GS A0A1D6MQ12_MAIZE/1-46       AC A0A1D6MQ12.1
#=GS A0A6H5KWH7_9PHAE/1-57       AC A0A6H5KWH7.1
#=GS A0A0A2VHX0_BEABA/1-228      AC A0A0A2VHX0.1
#=GS A0A4Q4U9B5_9PEZI/1-227      AC A0A4Q4U9B5.1
#=GS A0A093PGU1_PYGAD/3-233      AC A0A093PGU1.1
#=GS A0A1S2ZT19_ERIEU/1-227      AC A0A1S2ZT19.1
#=GS A0A1Y1XDW4_9FUNG/2-109      AC A0A1Y1XDW4.1
#=GS A0A0R0HUG5_SOYBN/1-255      AC A0A0R0HUG5.1
#=GS W7JTT9_PLAFO/45-259         AC W7JTT9.1
#=GS A0A1M8A6Q6_MALS4/1-227      AC A0A1M8A6Q6.1
#=GS A0A0V1LRK1_9BILA/1-255      AC A0A0V1LRK1.1
#=GS XRN2_MOUSE/1-254            AC Q9DBR1.1
#=GS A0A286XDK1_CAVPO/1-103      AC A0A286XDK1.1
#=GS A0A367JV53_RHIST/1-108      AC A0A367JV53.1
#=GS A0A3F3Q0P5_9EURO/1-227      AC A0A3F3Q0P5.1
#=GS A0A0V0U8D8_9BILA/1-255      AC A0A0V0U8D8.1
#=GS A0A453LGA9_AEGTS/2-129      AC A0A453LGA9.1
#=GS A0A0V1NQ81_9BILA/1-227      AC A0A0V1NQ81.1
#=GS A0A5C6P1Y3_9TELE/1-227      AC A0A5C6P1Y3.1
#=GS U6MV47_9EIME/126-163        AC U6MV47.1
#=GS A0A6A3AYX2_HIBSY/1-254      AC A0A6A3AYX2.1
#=GS A0A4Z0Z2F7_9PEZI/1-227      AC A0A4Z0Z2F7.1
#=GS A0A2C9VXR3_MANES/1-254      AC A0A2C9VXR3.1
#=GS A0A453G1X6_AEGTS/37-290     AC A0A453G1X6.1
#=GS A0A425BVI1_9PEZI/1-251      AC A0A425BVI1.1
#=GS A0A446TAN8_TRITD/4-164      AC A0A446TAN8.1
#=GS A0A1U8B8A0_NELNU/1-255      AC A0A1U8B8A0.1
#=GS A0A183PWT8_9TREM/1-198      AC A0A183PWT8.1
#=GS I3LWZ8_ICTTR/1-254          AC I3LWZ8.2
#=GS A0A287LYG4_HORVV/1-254      AC A0A287LYG4.1
#=GS A0A3B6H227_WHEAT/1-254      AC A0A3B6H227.1
#=GS A0A2P6TCB3_CHLSO/1-270      AC A0A2P6TCB3.1
#=GS A0A3S1B162_ELYCH/1-255      AC A0A3S1B162.1
#=GS A0A6J3Q3T0_TURTR/1-254      AC A0A6J3Q3T0.1
#=GS A0A0G4MCX4_9PEZI/1-228      AC A0A0G4MCX4.1
#=GS A0A2K5DPR7_AOTNA/1-227      AC A0A2K5DPR7.1
#=GS A0A0L0CZP9_PLAFA/4-128      AC A0A0L0CZP9.1
#=GS A2EY48_TRIVA/99-192         AC A2EY48.1
#=GS A0A5N5HR33_9ROSA/1-255      AC A0A5N5HR33.1
#=GS A0A010RAF5_9PEZI/1-228      AC A0A010RAF5.1
#=GS A0A3Q2WPX3_HAPBU/1-228      AC A0A3Q2WPX3.1
#=GS A0A063BXG9_USTVR/1-104      AC A0A063BXG9.1
#=GS A0A5B0M3W2_PUCGR/1-218      AC A0A5B0M3W2.1
#=GS A0A674P3Q4_TAKRU/1-227      AC A0A674P3Q4.1
#=GS A0A1U8NNM6_GOSHI/1-251      AC A0A1U8NNM6.1
#=GS A0A444GJI1_ENSVE/66-91      AC A0A444GJI1.1
#=GS B8NRB0_ASPFN/1-227          AC B8NRB0.1
#=GS B9RET3_RICCO/1-255          AC B9RET3.1
#=GS A0A3B1KK00_ASTMX/1-106      AC A0A3B1KK00.1
#=GS A0A0K9QW95_SPIOL/1-253      AC A0A0K9QW95.1
#=GS A0A452SJ14_URSAM/1-254      AC A0A452SJ14.1
#=GS L1JT89_GUITC/1-226          AC L1JT89.1
#=GS W6MPI3_9ASCO/32-285         AC W6MPI3.1
#=GS U6MT36_9EIME/115-451        AC U6MT36.1
#=GS A0A507DN81_9FUNG/1-227      AC A0A507DN81.1
#=GS G0VHR2_NAUCC/1-254          AC G0VHR2.1
#=GS C1E0G9_MICCC/1-200          AC C1E0G9.1
#=GS A0A427XGR0_9TREE/25-253     AC A0A427XGR0.1
#=GS A0A6A6M1Q2_HEVBR/5-217      AC A0A6A6M1Q2.1
#=GS U6KJK0_EIMTE/115-457        AC U6KJK0.1
#=GS A0A665V7T0_ECHNA/1-227      AC A0A665V7T0.1
#=GS A0A6P9E1B8_JUGRE/1-248      AC A0A6P9E1B8.1
#=GS A0A0F4ZDU9_9PEZI/1-258      AC A0A0F4ZDU9.1
#=GS M3YKU1_MUSPF/1-227          AC M3YKU1.1
#=GS A0A399GCW5_9PLEO/1-260      AC A0A399GCW5.1
#=GS A0A4V5NBP1_9PEZI/1-228      AC A0A4V5NBP1.1
#=GS A0A4Z1T948_GIAMU/1-279      AC A0A4Z1T948.1
#=GS A0A026WMV4_OOCBI/1-227      AC A0A026WMV4.1
#=GS B3RZA2_TRIAD/1-124          AC B3RZA2.1
#=GS A0A4U0WIA1_9PEZI/1-228      AC A0A4U0WIA1.1
#=GS S3D2I5_OPHP1/1-260          AC S3D2I5.1
#=GS A0A3D8QWS7_9HELO/1-254      AC A0A3D8QWS7.1
#=GS B6HKZ0_PENRW/1-227          AC B6HKZ0.1
#=GS A0A1S4DDY7_TOBAC/1-103      AC A0A1S4DDY7.1
#=GS A0A2G8L6G4_STIJA/1-255      AC A0A2G8L6G4.1
#=GS A0A0B0P6A8_GOSAR/1-254      AC A0A0B0P6A8.1
#=GS A0A0Q3URG9_AMAAE/6-238      AC A0A0Q3URG9.1
#=GS Q555U6_DICDI/1-240          AC Q555U6.1
#=GS A0A2I2YLX7_GORGO/1-227      AC A0A2I2YLX7.1
#=GS A0A444UNV9_ACIRT/1-227      AC A0A444UNV9.1
#=GS A0A093ZLF7_9PEZI/1-227      AC A0A093ZLF7.1
#=GS A0A2K5RZY9_CEBCA/1-227      AC A0A2K5RZY9.1
#=GS A0A2Y9JH23_ENHLU/1-227      AC A0A2Y9JH23.1
#=GS A0A0B1TLD6_OESDE/116-185    AC A0A0B1TLD6.1
#=GS A0A699ZIX5_HAELA/1-57       AC A0A699ZIX5.1
#=GS A0A4U0V645_9PEZI/1-263      AC A0A4U0V645.1
#=GS A0A095C8E0_CRYGR/156-224    AC A0A095C8E0.1
#=GS A0A0K0CVI3_ANGCA/1-218      AC A0A0K0CVI3.2
#=GS A0A200PW89_9MAGN/1-254      AC A0A200PW89.1
#=GS D0N6Z2_PHYIT/1-255          AC D0N6Z2.1
#=GS A0A072PM35_9EURO/1-259      AC A0A072PM35.1
#=GS A0A384L4M6_PLAKH/22-157     AC A0A384L4M6.1
#=GS A0A2P6V276_9CHLO/1-245      AC A0A2P6V276.1
#=GS A0A4D9BDQ9_SALSN/1-250      AC A0A4D9BDQ9.1
#=GS A0A1D6QHZ4_MAIZE/1-259      AC A0A1D6QHZ4.1
#=GS A0A446NWS5_TRITD/1-254      AC A0A446NWS5.1
#=GS A0A024WE66_PLAFA/22-304     AC A0A024WE66.1
#=GS A0A446UQM2_TRITD/1-255      AC A0A446UQM2.1
#=GS A0A1V6UAN3_9EURO/1-227      AC A0A1V6UAN3.1
#=GS A0A5E4MT21_9HEMI/1-144      AC A0A5E4MT21.1
#=GS A0A368F5C4_ANCCA/1-144      AC A0A368F5C4.1
#=GS A0A0G0AED0_TRIHA/1-260      AC A0A0G0AED0.1
#=GS A0A078A6J2_STYLE/90-245     AC A0A078A6J2.1
#=GS M3AX32_PSEFD/1-228          AC M3AX32.1
#=GS A0A0D2MWN1_9CHLO/1-226      AC A0A0D2MWN1.1
#=GS H3AIE7_LATCH/3-237          AC H3AIE7.1
#=GS A0A672FKD8_SALFA/1-254      AC A0A672FKD8.1
#=GS G3SD30_GORGO/1-254          AC G3SD30.2
#=GS A0A452F867_CAPHI/1-227      AC A0A452F867.1
#=GS A0A1C7N189_9FUNG/1-254      AC A0A1C7N189.1
#=GS C4R4J6_KOMPG/1-226          AC C4R4J6.1
#=GS W4GFE6_9STRA/1-254          AC W4GFE6.1
#=GS A0A482W2E7_9CUCU/1-255      AC A0A482W2E7.1
#=GS A0A158QWJ3_NIPBR/82-218     AC A0A158QWJ3.1
#=GS A0A2P6SC85_ROSCH/1-257      AC A0A2P6SC85.1
#=GS A0A5F9C4X8_RABIT/1-106      AC A0A5F9C4X8.1
#=GS L5JX81_PTEAL/245-395        AC L5JX81.1
#=GS A0A1X6NNQ0_PORUM/1-293      AC A0A1X6NNQ0.1
#=GS A0A1R3JNN7_9ROSI/1-255      AC A0A1R3JNN7.1
#=GS K1R3Z4_CRAGI/1-227          AC K1R3Z4.1
#=GS A0A2H9TLS1_9FUNG/19-202     AC A0A2H9TLS1.1
#=GS Q6CAZ5_YARLI/1-225          AC Q6CAZ5.1
#=GS A0A0U1LVG4_TALIS/1-227      AC A0A0U1LVG4.1
#=GS A0A2P5HR71_9PEZI/1-260      AC A0A2P5HR71.1
#=GS A0A091PJE6_LEPDC/1-202      AC A0A091PJE6.1
#=GS C4Y738_CLAL4/1-252          AC C4Y738.1
#=GS A0A168CFX4_9HYPO/1-228      AC A0A168CFX4.1
#=GS M1VUG2_CLAP2/1-222          AC M1VUG2.1
#=GS A0A1D6Y7E9_9VIRU/1-119      AC A0A1D6Y7E9.1
#=GS A0A1D6GFN9_MAIZE/1-255      AC A0A1D6GFN9.1
#=GS A0A384AXY0_BALAS/1-200      AC A0A384AXY0.1
#=GS A0A2H3XJI3_PHODC/1-254      AC A0A2H3XJI3.1
#=GS A0A0F4YPA7_TALEM/1-227      AC A0A0F4YPA7.1
#=GS A0A2Y9R625_TRIMA/1-144      AC A0A2Y9R625.1
#=GS A0A2A4JDR6_HELVI/1-227      AC A0A2A4JDR6.1
#=GS A2EY48_TRIVA/1-108          AC A2EY48.1
#=GS A0A4W5MRG7_9TELE/1-254      AC A0A4W5MRG7.1
#=GS A0A1G4AR00_9PEZI/1-260      AC A0A1G4AR00.1
#=GS W5JSY2_ANODA/1-227          AC W5JSY2.1
#=GS A0A094K7Z3_9PEZI/1-259      AC A0A094K7Z3.1
#=GS K8EEN1_9CHLO/1-192          AC K8EEN1.1
#=GS A0A674DJD1_SALTR/1-227      AC A0A674DJD1.1
#=GS A0A067RMB0_ZOONE/1-255      AC A0A067RMB0.1
#=GS A0A066XSA0_COLSU/1-228      AC A0A066XSA0.1
#=GS Q2GWB2_CHAGB/1-227          AC Q2GWB2.1
#=GS A0A0C3AXI3_PILCF/112-181    AC A0A0C3AXI3.1
#=GS M3W8Q9_FELCA/1-254          AC M3W8Q9.2
#=GS A0A4W4F637_ELEEL/1-254      AC A0A4W4F637.1
#=GS A0A146JIN5_9VIRU/1-120      AC A0A146JIN5.1
#=GS A0A4W5P5Y7_9TELE/1-227      AC A0A4W5P5Y7.1
#=GS A0A3M6TXS8_9CNID/3-76       AC A0A3M6TXS8.1
#=GS A0A0M0JRM3_9EUKA/1-109      AC A0A0M0JRM3.1
#=GS A0A5D2WJ61_GOSMU/1-255      AC A0A5D2WJ61.1
#=GS A0A2P5DBS9_PARAD/1-254      AC A0A2P5DBS9.1
#=GS D2VA47_NAEGR/1-275          AC D2VA47.1
#=GS A0A446TIH3_TRITD/1-255      AC A0A446TIH3.1
#=GS A0A5N6MW48_9ASTR/154-398    AC A0A5N6MW48.1
#=GS W9C6A1_SCLBF/1-221          AC W9C6A1.1
#=GS A0A3R7MCI9_9TRYP/1-302      AC A0A3R7MCI9.1
#=GS A0A251R8Y3_PRUPE/1-254      AC A0A251R8Y3.1
#=GS R7QIT8_CHOCR/1-225          AC R7QIT8.1
#=GS A0A4Q4ZFZ9_9PEZI/1-192      AC A0A4Q4ZFZ9.1
#=GS A0A5B6X347_9ROSI/1-255      AC A0A5B6X347.1
#=GS A0A1A5ZU99_9TREE/11-269     AC A0A1A5ZU99.1
#=GS A0A3D8SPH3_9HELO/1-227      AC A0A3D8SPH3.1
#=GS Q4DQL9_TRYCC/1-243          AC Q4DQL9.1
#=GS V5BCF8_TRYCR/1-237          AC V5BCF8.1
#=GS A2ECG7_TRIVA/1-116          AC A2ECG7.1
#=GS A0A0E0G6M0_ORYNI/1-193      AC A0A0E0G6M0.1
#=GS A0A4P6XLP6_9ASCO/1-191      AC A0A4P6XLP6.1
#=GS C4JM55_UNCRE/1-227          AC C4JM55.1
#=GS XRN2_ASPOR/1-257            AC Q2UCP5.3
#=GS A0A5S6PSH2_BRUMA/1-227      AC A0A5S6PSH2.1
#=GS U6GHP3_EIMAC/1-245          AC U6GHP3.1
#=GS A0A5F8G5W1_MONDO/1-254      AC A0A5F8G5W1.1
#=GS A0A2R6WDJ1_MARPO/1-254      AC A0A2R6WDJ1.1
#=GS V5ETF5_KALBG/1-227          AC V5ETF5.1
#=GS A0A195FBR8_9HYME/1-255      AC A0A195FBR8.1
#=GS A0A545A4D9_9PEZI/1-221      AC A0A545A4D9.1
#=GS V7AK39_PHAVU/1-222          AC V7AK39.1
#=GS A0A4S2LJM9_OPIFE/1-224      AC A0A4S2LJM9.1
#=GS A0A078J4K7_BRANA/1-228      AC A0A078J4K7.1
#=GS XRN2_GIBZE/1-260            AC Q4HWE2.3
#=GS A0A084WNP7_ANOSI/1-255      AC A0A084WNP7.1
#=GS A0A3M7M1B6_9PLEO/1-206      AC A0A3M7M1B6.1
#=GS A0A5G2QSC5_PIG/1-227        AC A0A5G2QSC5.1
#=GS A0A2I0XCS2_9ASPA/58-111     AC A0A2I0XCS2.1
#=GS A0A2B7X4Y8_9EURO/1-259      AC A0A2B7X4Y8.1
#=GS A0A453G1V8_AEGTS/1-187      AC A0A453G1V8.1
#=GS A0A1D6PUT4_MAIZE/1-254      AC A0A1D6PUT4.1
#=GS A0A0D2GNE1_9EURO/1-227      AC A0A0D2GNE1.1
#=GS A0A0A2LDP8_PENIT/1-227      AC A0A0A2LDP8.1
#=GS E9CXP3_COCPS/1-259          AC E9CXP3.1
#=GS A0A674AM56_SALTR/1-254      AC A0A674AM56.1
#=GS A0A667XQA9_9TELE/1-103      AC A0A667XQA9.1
#=GS A0A1E3NYM2_WICAA/1-101      AC A0A1E3NYM2.1
#=GS A0A5Q4C3K0_9PEZI/1-228      AC A0A5Q4C3K0.1
#=GS R8BH40_TOGMI/1-227          AC R8BH40.1
#=GS A0A1V6SMY8_9EURO/1-260      AC A0A1V6SMY8.1
#=GS A0A1S3UFE8_VIGRR/1-254      AC A0A1S3UFE8.1
#=GS A0A2R8FCT6_9VIRU/1-87       AC A0A2R8FCT6.1
#=GS A0A091DDA0_FUKDA/611-864    AC A0A091DDA0.1
#=GS T1J5Z8_STRMM/1-255          AC T1J5Z8.1
#=GS K0KWA0_WICCF/1-254          AC K0KWA0.1
#=GS A0A4Q4U0Q6_9PEZI/1-260      AC A0A4Q4U0Q6.1
#=GS A0A422NV84_9TRYP/1-233      AC A0A422NV84.1
#=GS A0A3R7HZP6_9STRA/1-255      AC A0A3R7HZP6.1
#=GS A0A6A1QC58_BALPH/225-465    AC A0A6A1QC58.1
#=GS A0A422PWP5_9TRYP/1-228      AC A0A422PWP5.1
#=GS A0A673CC91_9TELE/1-227      AC A0A673CC91.1
#=GS L8X6F1_THACA/6-252          AC L8X6F1.1
#=GS A0A667Y095_9TELE/1-254      AC A0A667Y095.1
#=GS A0A212CBP3_CEREH/50-291     AC A0A212CBP3.1
#=GS A0A2C5XLA7_9HYPO/1-168      AC A0A2C5XLA7.1
#=GS A0A2I2L5K3_9PHYC/117-218    AC A0A2I2L5K3.1
#=GS F0Z8Q9_DICPU/1-230          AC F0Z8Q9.1
#=GS A0A4Y7KVF2_PAPSO/1-50       AC A0A4Y7KVF2.1
#=GS A0A287S1D9_HORVV/1-251      AC A0A287S1D9.1
#=GS A0A287SKL5_HORVV/93-288     AC A0A287SKL5.1
#=GS F4K1L3_ARATH/1-256          AC F4K1L3.1
#=GS A0A1A8YLK5_9APIC/22-291     AC A0A1A8YLK5.1
#=GS A0A674C185_SALTR/1-254      AC A0A674C185.1
#=GS C5DSC0_ZYGRC/1-254          AC C5DSC0.1
#=GS M3XJ91_LATCH/3-237          AC M3XJ91.1
#=GS A0A2K5V3D7_MACFA/1-227      AC A0A2K5V3D7.1
#=GS A0A445CJV0_ARAHY/1-254      AC A0A445CJV0.1
#=GS A0A663EAP4_AQUCH/147-223    AC A0A663EAP4.1
#=GS A0A1B8APD4_FUSPO/1-260      AC A0A1B8APD4.1
#=GS A0A0K9RUJ5_SPIOL/1-230      AC A0A0K9RUJ5.1
#=GS W1QGQ9_OGAPD/1-227          AC W1QGQ9.1
#=GS A0A117E1B7_ASPNG/1-227      AC A0A117E1B7.1
#=GS V5DKX1_TRYCR/1-250          AC V5DKX1.1
#=GS A0A3Q3F0L7_9LABR/1-97       AC A0A3Q3F0L7.1
#=GS A0A6P9EE87_JUGRE/1-248      AC A0A6P9EE87.1
#=GS A0A0L6WXB0_9AGAR/114-154    AC A0A0L6WXB0.1
#=GS Q4UDL9_THEAN/1-282          AC Q4UDL9.1
#=GS A9UWX5_MONBE/1-235          AC A9UWX5.1
#=GS A0A078IBI7_BRANA/1-254      AC A0A078IBI7.1
#=GS A0A3B6JI76_WHEAT/1-146      AC A0A3B6JI76.1
#=GS S9ULI7_9TRYP/1-279          AC S9ULI7.1
#=GS E2L5B1_MONPE/3-98           AC E2L5B1.1
#=GS A0A0C7MTA0_9SACH/1-227      AC A0A0C7MTA0.1
#=GS E0VK48_PEDHC/1-255          AC E0VK48.1
#=GS A0A337SAM8_FELCA/1-254      AC A0A337SAM8.1
#=GS A0A2U1MIH5_ARTAN/1-250      AC A0A2U1MIH5.1
#=GS A0A1V6RA82_9EURO/1-260      AC A0A1V6RA82.1
#=GS A0A1L7WH14_9HELO/1-254      AC A0A1L7WH14.1
#=GS A0A0P1AVZ9_PLAHL/1-240      AC A0A0P1AVZ9.1
#=GS A0A1S4DKG4_TOBAC/1-88       AC A0A1S4DKG4.1
#=GS W9XQW3_9EURO/1-263          AC W9XQW3.1
#=GS A0A1E5V092_9POAL/1-254      AC A0A1E5V092.1
#=GS A0A397V974_9GLOM/1-227      AC A0A397V974.1
#=GS B9S1X3_RICCO/1-251          AC B9S1X3.1
#=GS A0A5B6X4Z6_9ROSI/1-254      AC A0A5B6X4Z6.1
#=GS XRN2_EMENI/1-258            AC Q5BFH3.3
#=GS M7T156_EUTLA/1-227          AC M7T156.1
#=GS U6L0V3_EIMTE/1-215          AC U6L0V3.1
#=GS A0A1A8YV23_9APIC/105-319    AC A0A1A8YV23.1
#=GS A0A5F9CVG6_RABIT/1-254      AC A0A5F9CVG6.1
#=GS A0A6H5I532_9HYME/1-227      AC A0A6H5I532.1
#=GS A0A2K5DPN7_AOTNA/1-227      AC A0A2K5DPN7.1
#=GS A0A2G9TQ23_TELCI/166-258    AC A0A2G9TQ23.1
#=GS A0A673CEF3_9TELE/1-227      AC A0A673CEF3.1
#=GS A0A1C3YL15_GIBZE/1-228      AC A0A1C3YL15.1
#=GS A0A482WTM6_LAOST/1-179      AC A0A482WTM6.1
#=GS A0A1V9XMP0_9ACAR/26-245     AC A0A1V9XMP0.1
#=GS C4M8Q3_ENTHI/1-235          AC C4M8Q3.1
#=GS W2TS22_NECAM/1-238          AC W2TS22.1
#=GS W5S5F2_9VIRU/121-217        AC W5S5F2.1
#=GS A0A453LGA3_AEGTS/1-205      AC A0A453LGA3.1
#=GS A0A287S1L6_HORVV/1-256      AC A0A287S1L6.1
#=GS A0A672TSK2_STRHB/1-254      AC A0A672TSK2.1
#=GS A0A446NWS3_TRITD/1-254      AC A0A446NWS3.1
#=GS L0P710_PNEJ8/1-224          AC L0P710.1
#=GS D4AR50_ARTBC/1-227          AC D4AR50.1
#=GS M7BT31_CHEMY/1-108          AC M7BT31.1
#=GS A0A5N6EPW2_9EURO/1-227      AC A0A5N6EPW2.1
#=GS G4T5U0_SERID/1-207          AC G4T5U0.1
#=GS A0A1D6GFP2_MAIZE/1-255      AC A0A1D6GFP2.1
#=GS A0A287S1M1_HORVV/3-257      AC A0A287S1M1.1
#=GS A0A671WZI8_SPAAU/1-254      AC A0A671WZI8.1
#=GS A0A0D9YSC2_9ORYZ/1-229      AC A0A0D9YSC2.1
#=GS B3MKR2_DROAN/1-256          AC B3MKR2.1
#=GS A0A194V263_9PEZI/1-260      AC A0A194V263.1
#=GS A0A2N5V3F3_9BASI/1-260      AC A0A2N5V3F3.1
#=GS W8QE83_9VIRU/1-125          AC W8QE83.1
#=GS B8BR14_THAPS/1-178          AC B8BR14.1
#=GS F4S631_MELLP/1-255          AC F4S631.1
#=GS A0A3P8X2X0_CYNSE/1-106      AC A0A3P8X2X0.1
#=GS A0A446TIH4_TRITD/1-255      AC A0A446TIH4.1
#=GS A0CLH9_PARTE/1-228          AC A0CLH9.1
#=GS A0A3N7F0A2_POPTR/1-46       AC A0A3N7F0A2.1
#=GS A0A446TIG4_TRITD/1-255      AC A0A446TIG4.1
#=GS A0A3Q4GLV7_NEOBR/1-244      AC A0A3Q4GLV7.1
#=GS D8PKX0_SCHCM/9-264          AC D8PKX0.1
#=GS A0A6I8Q788_XENTR/1-227      AC A0A6I8Q788.1
#=GS W3WSJ9_PESFW/1-227          AC W3WSJ9.1
#=GS A0A5B6X7N0_9ROSI/1-254      AC A0A5B6X7N0.1
#=GS A0A3S2KZL1_CHISP/1-227      AC A0A3S2KZL1.1
#=GS A0A2K0W3W2_GIBNY/1-193      AC A0A2K0W3W2.1
#=GS A0A665UM72_ECHNA/1-230      AC A0A665UM72.1
#=GS A0A671WZZ8_SPAAU/1-254      AC A0A671WZZ8.1
#=GS A0A286ZPU3_PIG/1-254        AC A0A286ZPU3.1
#=GS G8ZP63_TORDC/1-254          AC G8ZP63.1
#=GS R1GSJ7_BOTPV/1-227          AC R1GSJ7.1
#=GS A0A0N4U8P4_DRAME/1-257      AC A0A0N4U8P4.2
#=GS A0A094CV08_9PEZI/1-259      AC A0A094CV08.1
#=GS B8N4R0_ASPFN/1-257          AC B8N4R0.1
#=GS A0A226EZW5_FOLCA/1-228      AC A0A226EZW5.1
#=GS A0A1R1YDL4_9FUNG/1-228      AC A0A1R1YDL4.1
#=GS A0A1Z5KS75_FISSO/1-255      AC A0A1Z5KS75.1
#=GS H3DJR6_TETNG/1-228          AC H3DJR6.1
#=GS A0A663EAE1_AQUCH/1-159      AC A0A663EAE1.1
#=GS A0A024W9L1_PLAFA/1-272      AC A0A024W9L1.1
#=GS A0A1S4EFA5_DIACI/1-230      AC A0A1S4EFA5.1
#=GS A0A5A8CWW4_CAFRO/141-349    AC A0A5A8CWW4.1
#=GS A0A2P5DKS7_PARAD/107-238    AC A0A2P5DKS7.1
#=GS A0A1R3HYD6_9ROSI/1-254      AC A0A1R3HYD6.1
#=GS Q4DQC3_TRYCC/1-236          AC Q4DQC3.1
#=GS A0A061F2Q0_THECC/1-144      AC A0A061F2Q0.1
#=GS A0A4U0XS03_9PEZI/1-258      AC A0A4U0XS03.1
#=GS A0A6P9EVF0_JUGRE/1-250      AC A0A6P9EVF0.1
#=GS A0A3Q1GQR3_9TELE/8-136      AC A0A3Q1GQR3.1
#=GS A0A445GC31_GLYSO/1-254      AC A0A445GC31.1
#=GS A0A1B7NR59_9EURO/1-227      AC A0A1B7NR59.1
#=GS A0A446Q6T3_TRITD/1-71       AC A0A446Q6T3.1
#=GS A0A3L6SQ38_PANMI/1-254      AC A0A3L6SQ38.1
#=GS A0A061FWL0_THECC/2-49       AC A0A061FWL0.1
#=GS A0A5P1FCI6_ASPOF/1-202      AC A0A5P1FCI6.1
#=GS A0A101MAR0_9EURO/1-227      AC A0A101MAR0.1
#=GS A0A1C1CW92_9EURO/1-227      AC A0A1C1CW92.1
#=GS A0A6I8SKN3_XENTR/1-254      AC A0A6I8SKN3.1
#=GS A0A3Q7VZF6_URSAR/1-254      AC A0A3Q7VZF6.1
#=GS A0A0D2MKZ2_9CHLO/1-92       AC A0A0D2MKZ2.1
#=GS A0A3P7DSQ6_WUCBA/1-176      AC A0A3P7DSQ6.1
#=GS A0A6H5L6C8_9PHAE/132-362    AC A0A6H5L6C8.1
#=GS A0A1Q5U1V4_9EURO/1-260      AC A0A1Q5U1V4.1
#=GS A0A0R4ISJ3_DANRE/1-254      AC A0A0R4ISJ3.1
#=GS W6KHT2_9TRYP/1-228          AC W6KHT2.1
#=GS J4IAS0_9APHY/8-267          AC J4IAS0.1
#=GS U5CKK8_AMBTC/1-124          AC U5CKK8.1
#=GS A0A446TIS2_TRITD/1-255      AC A0A446TIS2.1
#=GS A0A556UYG1_BAGYA/1-237      AC A0A556UYG1.1
#=GS G8BFL4_CANPC/1-226          AC G8BFL4.1
#=GS A0A2H3ZIS2_PHODC/1-155      AC A0A2H3ZIS2.1
#=GS A0A0K9QU19_SPIOL/1-253      AC A0A0K9QU19.1
#=GS R1ER45_BOTPV/1-262          AC R1ER45.1
#=GS A0A5J9VX69_9POAL/1-255      AC A0A5J9VX69.1
#=GS A0A287SKB0_HORVV/93-288     AC A0A287SKB0.1
#=GS A0A6I8S297_XENTR/1-227      AC A0A6I8S297.1
#=GS E3KQB0_PUCGT/1-227          AC E3KQB0.2
#=GS W9YGU1_9EURO/1-227          AC W9YGU1.1
#=GS A0A067JYC9_JATCU/1-254      AC A0A067JYC9.1
#=GS A0A196SDF2_BLAHN/1-257      AC A0A196SDF2.1
#=GS A0A177WKV5_BATDL/1-207      AC A0A177WKV5.1
#=GS A0A2V0NVV1_9CHLO/1-168      AC A0A2V0NVV1.1
#=GS H0EUY9_GLAL7/1-251          AC H0EUY9.1
#=GS A0A061FE44_THECC/1-254      AC A0A061FE44.1
#=GS C0NL64_AJECG/1-259          AC C0NL64.1
#=GS M7UJN6_BOTF1/1-254          AC M7UJN6.1
#=GS A0A199VD05_ANACO/1-254      AC A0A199VD05.1
#=GS Q4CSM8_TRYCC/1-243          AC Q4CSM8.1
#=GS A0A671X120_SPAAU/1-254      AC A0A671X120.1
#=GS A0A422NS66_TRYRA/1-303      AC A0A422NS66.1
#=GS A0A1S8W4E1_9FUNG/1-209      AC A0A1S8W4E1.1
#=GS A0A671X4Y0_SPAAU/1-254      AC A0A671X4Y0.1
#=GS A0A5A7PUI4_STRAF/1-245      AC A0A5A7PUI4.1
#=GS A0A2K3MTZ1_TRIPR/1-186      AC A0A2K3MTZ1.1
#=GS A0A4S8KFA7_MUSBA/1-255      AC A0A4S8KFA7.1
#=GS A0A084QWA5_STAC4/1-228      AC A0A084QWA5.1
#=GS A0A2G5CMZ0_AQUCA/14-269     AC A0A2G5CMZ0.1
#=GS A0A287DCK8_ICTTR/1-227      AC A0A287DCK8.1
#=GS A0A2T7NZU1_POMCA/1-259      AC A0A2T7NZU1.1
#=GS M1PWN4_9VIRU/99-292         AC M1PWN4.1
#=GS A4HP43_LEIBR/1-251          AC A4HP43.1
#=GS A0A098VW49_9MICR/1-229      AC A0A098VW49.1
#=GS A0A212EYH4_DANPL/1-255      AC A0A212EYH4.1
#=GS H3C9G4_TETNG/1-228          AC H3C9G4.1
#=GS A0A2T3A0K2_9PEZI/1-227      AC A0A2T3A0K2.1
#=GS A0A5J4Z3E8_PORPP/13-243     AC A0A5J4Z3E8.1
#=GS A0A1F5LPY9_9EURO/1-260      AC A0A1F5LPY9.1
#=GS A0A367KL81_RHIST/1-134      AC A0A367KL81.1
#=GS A0A395MHM0_9HYPO/1-228      AC A0A395MHM0.1
#=GS A0A660KLS5_9ROSI/851-1096   AC A0A660KLS5.1
#=GS A0A210PG25_MIZYE/1-227      AC A0A210PG25.1
#=GS A0EGN3_PARTE/1-211          AC A0EGN3.1
#=GS A0A1U7LRW5_NEOID/60-298     AC A0A1U7LRW5.1
#=GS A0A4S2N3C0_9PEZI/1-109      AC A0A4S2N3C0.1
#=GS A0A1U7XDE7_NICSY/1-84       AC A0A1U7XDE7.1
#=GS A0A446TIL5_TRITD/1-255      AC A0A446TIL5.1
#=GS A0A3B6GZE2_WHEAT/1-254      AC A0A3B6GZE2.1
#=GS A0A2T7E4W5_9POAL/1-247      AC A0A2T7E4W5.1
#=GS A0A087V8X9_BALRE/2-230      AC A0A087V8X9.1
#=GS A0A2I0M9B3_COLLI/30-265     AC A0A2I0M9B3.1
#=GS A0A2J7ZLR0_9CHLO/5-59       AC A0A2J7ZLR0.1
#=GS A0A2K3DHL2_CHLRE/1-101      AC A0A2K3DHL2.1
#=GS A0A182H0U7_AEDAL/1-255      AC A0A182H0U7.1
#=GS A0A2P6QEG8_ROSCH/1-258      AC A0A2P6QEG8.1
#=GS Q386Z9_TRYB2/1-231          AC Q386Z9.1
#=GS A0A183D2V1_9BILA/1-46       AC A0A183D2V1.1
#=GS A0A2R8ZBD9_PANPA/1-227      AC A0A2R8ZBD9.1
#=GS A0A453M1T6_AEGTS/1-144      AC A0A453M1T6.1
#=GS A0A2A9MEM4_9APIC/1-239      AC A0A2A9MEM4.1
#=GS A0A453LG95_AEGTS/8-98       AC A0A453LG95.1
#=GS A0A4Z1JG48_9HELO/1-254      AC A0A4Z1JG48.1
#=GS W2PPY7_PHYPN/1-255          AC W2PPY7.1
#=GS A0A0A0LG85_CUCSA/1-255      AC A0A0A0LG85.1
#=GS A0A1G4MAX4_LACFM/1-227      AC A0A1G4MAX4.1
#=GS A0A2U4AQ80_TURTR/1-254      AC A0A2U4AQ80.1
#=GS A0A3B0KX78_DROGU/1-226      AC A0A3B0KX78.1
#=GS A0A665V711_ECHNA/1-227      AC A0A665V711.1
#=GS A0A0L8HS88_OCTBM/1-255      AC A0A0L8HS88.1
#=GS A0A0V0XVE0_TRIPS/10-264     AC A0A0V0XVE0.1
#=GS A0A0L7M011_PLAF4/15-304     AC A0A0L7M011.1
#=GS A0A0V0WG14_9BILA/1-255      AC A0A0V0WG14.1
#=GS A0A0L6VPB9_9BASI/1-250      AC A0A0L6VPB9.1
#=GS A0A4U5QPP5_POPAL/1-255      AC A0A4U5QPP5.1
#=GS A0A168FRZ5_CORDF/1-228      AC A0A168FRZ5.1
#=GS A5K486_PLAVS/1-210          AC A5K486.1
#=GS A0A5F8ABN5_MACMU/1-254      AC A0A5F8ABN5.1
#=GS A0A1V6QG94_9EURO/1-227      AC A0A1V6QG94.1
#=GS A0A196S8Z4_BLAHN/1-220      AC A0A196S8Z4.1
#=GS R1ET42_EMIHU/107-184        AC R1ET42.1
#=GS A0A6P9E0R9_JUGRE/1-248      AC A0A6P9E0R9.1
#=GS L2FG12_COLFN/1-260          AC L2FG12.1
#=GS A0A0H5C301_CYBJN/94-194     AC A0A0H5C301.1
#=GS A0A5J5BRI7_9ASTE/1-248      AC A0A5J5BRI7.1
#=GS A0A1Q2YC24_9ASCO/1-254      AC A0A1Q2YC24.1
#=GS A0A1Y3N8K2_PIRSE/9-147      AC A0A1Y3N8K2.1
#=GS A0A384LDR9_PLAKH/1-278      AC A0A384LDR9.1
#=GS A0A5A7RIK0_STRAF/1-254      AC A0A5A7RIK0.1
#=GS A0A5N6UT04_9EURO/1-227      AC A0A5N6UT04.1
#=GS A0A446Q6R7_TRITD/33-225     AC A0A446Q6R7.1
#=GS T1G453_HELRO/99-208         AC T1G453.1
#=GS A0A671WIW7_SPAAU/1-227      AC A0A671WIW7.1
#=GS M4DH51_BRARP/1-254          AC M4DH51.1
#=GS A0A0D3E5Z0_BRAOL/1-249      AC A0A0D3E5Z0.1
#=GS K6UU42_9APIC/1-263          AC K6UU42.1
#=GS A0A510NVG4_9EURO/1-227      AC A0A510NVG4.1
#=GS A0A2H5NS38_CITUN/1-254      AC A0A2H5NS38.1
#=GS A0A4U0XN64_9PEZI/1-227      AC A0A4U0XN64.1
#=GS A0A4S2KAP7_9HYME/299-447    AC A0A4S2KAP7.1
#=GS A0A2A9PKA2_9HYPO/87-311     AC A0A2A9PKA2.1
#=GS A0A2B7ZSU8_9EURO/1-259      AC A0A2B7ZSU8.1
#=GS A0A0L7KWG2_9NEOP/18-67      AC A0A0L7KWG2.1
#=GS A0A4S8KE10_MUSBA/1-254      AC A0A4S8KE10.1
#=GS A0A2K6ESN8_PROCO/1-227      AC A0A2K6ESN8.1
#=GS A0A1A6HIP7_NEOLE/17-105     AC A0A1A6HIP7.1
#=GS A0A5A9NFY6_9TELE/1-254      AC A0A5A9NFY6.1
#=GS A0A094G0Q1_9PEZI/1-259      AC A0A094G0Q1.1
#=GS A0A2T9YLK4_9FUNG/141-363    AC A0A2T9YLK4.1
#=GS W1PT48_AMBTC/1-68           AC W1PT48.1
#=GS W9RNT2_9ROSA/1-236          AC W9RNT2.1
#=GS A0A4Z2D6D8_SCHJA/1-255      AC A0A4Z2D6D8.1
#=GS A0A2P4Z9R5_9HYPO/1-260      AC A0A2P4Z9R5.1
#=GS A0A1D3CXH3_9EIME/1-245      AC A0A1D3CXH3.1
#=GS A0A446TIN0_TRITD/1-251      AC A0A446TIN0.1
#=GS A7ARW6_BABBO/1-234          AC A7ARW6.1
#=GS A0A369H3P1_9HYPO/1-260      AC A0A369H3P1.1
#=GS C5LVR2_PERM5/1-226          AC C5LVR2.1
#=GS M0TND5_MUSAM/1-228          AC M0TND5.1
#=GS A0A2H3Z680_PHODC/1-254      AC A0A2H3Z680.1
#=GS H0ZDW7_TAEGU/1-227          AC H0ZDW7.2
#=GS Q7RJ95_PLAYO/1-40           AC Q7RJ95.1
#=GS V8NTJ9_OPHHA/1-106          AC V8NTJ9.1
#=GS A0A1S3CPK2_CUCME/1-254      AC A0A1S3CPK2.1
#=GS C1MR82_MICPC/4-226          AC C1MR82.1
#=GS J9DGU0_EDHAE/388-528        AC J9DGU0.1
#=GS A0A0N9R383_CEV01/1-213      AC A0A0N9R383.1
#=GS A0A3G2S0V6_9BASI/1-259      AC A0A3G2S0V6.1
#=GS F0UPP2_AJEC8/1-227          AC F0UPP2.1
#=GS E1BMZ8_BOVIN/1-227          AC E1BMZ8.2
#=GS A0A653DAQ2_CALMS/1-175      AC A0A653DAQ2.1
#=GS A0A1V4IGE2_PATFA/1-254      AC A0A1V4IGE2.1
#=GS A0A5N5SZ31_9CRUS/14-191     AC A0A5N5SZ31.1
#=GS A0A251VKN9_HELAN/3-71       AC A0A251VKN9.1
#=GS J5JVD7_BEAB2/1-228          AC J5JVD7.1
#=GS A0A2P6V9B5_9CHLO/1-266      AC A0A2P6V9B5.1
#=GS A0A180G596_PUCT1/1-46       AC A0A180G596.1
#=GS A0A395RZJ4_9HYPO/19-246     AC A0A395RZJ4.1
#=GS A0A409WGR1_PSICY/2-186      AC A0A409WGR1.1
#=GS A0A0D2B8L0_9PEZI/1-259      AC A0A0D2B8L0.1
#=GS L0AVJ1_THEEQ/1-274          AC L0AVJ1.1
#=GS A0A0E0AHH5_9ORYZ/87-187     AC A0A0E0AHH5.1
#=GS A0A0W8DL36_PHYNI/1-255      AC A0A0W8DL36.1
#=GS D8M808_BLAHO/1-254          AC D8M808.1
#=GS A0A2U1P6P0_ARTAN/167-366    AC A0A2U1P6P0.1
#=GS A0A2P5YFX4_GOSBA/1-255      AC A0A2P5YFX4.1
#=GS S7ZUU0_PENO1/1-227          AC S7ZUU0.1
#=GS A0A644F697_GIAIC/1-264      AC A0A644F697.1
#=GS Q4DYR8_TRYCC/1-250          AC Q4DYR8.1
#=GS A0A4W4F4I0_ELEEL/1-254      AC A0A4W4F4I0.1
#=GS A0A016TLX5_9BILA/1-255      AC A0A016TLX5.1
#=GS A0A448Z301_9STRA/1-255      AC A0A448Z301.1
#=GS A0A2N1JCK3_9BASI/1-216      AC A0A2N1JCK3.1
#=GS A0A5J9UT61_9POAL/1-264      AC A0A5J9UT61.1
#=GS G3TF54_LOXAF/1-227          AC G3TF54.1
#=GS A0A1X0NJD0_9TRYP/1-228      AC A0A1X0NJD0.1
#=GS A0A5K1UWP0_MACMU/110-240    AC A0A5K1UWP0.1
#=GS A0A2P7Z0M9_9PEZI/1-257      AC A0A2P7Z0M9.1
#=GS A0A5F8HGS7_MONDO/1-227      AC A0A5F8HGS7.1
#=GS A0A0C2NBT3_THEKT/1-83       AC A0A0C2NBT3.1
#=GS A0A3S3NB82_9MAGN/1-254      AC A0A3S3NB82.1
#=GS A0A2U9BKL6_SCOMX/1-227      AC A0A2U9BKL6.1
#=GS A0A197K7I5_9FUNG/1-111      AC A0A197K7I5.1
#=GS A0A1S3M8P4_SALSA/1-254      AC A0A1S3M8P4.1
#=GS A0A169WPV0_DAUCS/1-254      AC A0A169WPV0.1
#=GS A0A665UL50_ECHNA/1-230      AC A0A665UL50.1
#=GS A0A2K6A657_MANLE/1-254      AC A0A2K6A657.1
#=GS Q6F378_ORYSJ/1-255          AC Q6F378.1
#=GS W5S5F2_9VIRU/1-125          AC W5S5F2.1
#=GS A0A660KSY9_9ROSI/1-252      AC A0A660KSY9.1
#=GS Q4D794_TRYCC/1-228          AC Q4D794.1
#=GS A0A0V1HB32_9BILA/33-259     AC A0A0V1HB32.1
#=GS A0A2R6P080_9APHY/1-145      AC A0A2R6P080.1
#=GS M3XQ36_MUSPF/73-326         AC M3XQ36.1
#=GS A0A094I8R0_9PEZI/1-227      AC A0A094I8R0.1
#=GS A0A395J4X5_9HELO/1-88       AC A0A395J4X5.1
#=GS A0A6H5JF35_9PHAE/1-253      AC A0A6H5JF35.1
#=GS M5W757_PRUPE/1-255          AC M5W757.1
#=GS A0A446TAN5_TRITD/1-267      AC A0A446TAN5.1
#=GS A4I352_LEIIN/1-239          AC A4I352.1
#=GS A0A287LYH3_HORVV/28-281     AC A0A287LYH3.1
#=GS A0A2D3VHH1_9PEZI/1-228      AC A0A2D3VHH1.1
#=GS A0A0V0ZDW0_9BILA/6-260      AC A0A0V0ZDW0.1
#=GS A0A445H934_GLYSO/1-254      AC A0A445H934.1
#=GS A0A2J6LR51_LACSA/1-250      AC A0A2J6LR51.1
#=GS A0A287S1A0_HORVV/1-193      AC A0A287S1A0.1
#=GS A0A445HNC9_GLYSO/1-260      AC A0A445HNC9.1
#=GS A0A183J2P0_9BILA/11-264     AC A0A183J2P0.1
#=GS A0A663E346_AQUCH/1-227      AC A0A663E346.1
#=GS A0A660KQ01_9ROSI/1-255      AC A0A660KQ01.1
#=GS A0A341DD66_NEOAA/1-145      AC A0A341DD66.1
#=GS A0A091TMC9_PHALP/3-233      AC A0A091TMC9.1
#=GS A0A669DKD4_ORENI/1-228      AC A0A669DKD4.1
#=GS A0A5C3EME8_9BASI/1-261      AC A0A5C3EME8.1
#=GS A0A2G5DN12_AQUCA/6-87       AC A0A2G5DN12.1
#=GS A0A087ZYA0_APIME/38-181     AC A0A087ZYA0.1
#=GS A0A453LGH0_AEGTS/2-202      AC A0A453LGH0.1
#=GS A0A0C3E1J9_9AGAM/1-173      AC A0A0C3E1J9.1
#=GS A0A2P6VDQ0_9CHLO/1-254      AC A0A2P6VDQ0.1
#=GS A0A4V1IR82_9FUNG/1-68       AC A0A4V1IR82.1
#=GS W7JVG1_PLAFA/22-296         AC W7JVG1.1
#=GS A0A0L7R1M4_9HYME/1-255      AC A0A0L7R1M4.1
#=GS A0A0L1I8U7_PLAFA/1-272      AC A0A0L1I8U7.1
#=GS A0A2I0IN20_PUNGR/1-133      AC A0A2I0IN20.1
#=GS F7CSR7_ORNAN/1-92           AC F7CSR7.2
#=GS A0A1Y1ULX4_9TREE/1-229      AC A0A1Y1ULX4.1
#=GS A0A671X1J6_SPAAU/1-254      AC A0A671X1J6.1
#=GS A0A1Y2DXB6_9PEZI/1-260      AC A0A1Y2DXB6.1
#=GS A0A177WJS5_BATDL/1-219      AC A0A177WJS5.1
#=GS I2GX81_TETBL/1-254          AC I2GX81.1
#=GS A0A4D9DY50_9SAUR/1-227      AC A0A4D9DY50.1
#=GS A0A4P1QUE2_LUPAN/1-255      AC A0A4P1QUE2.1
#=GS A0A093XXM5_9PEZI/1-259      AC A0A093XXM5.1
#=GS A0A420QYV9_FUSOX/1-228      AC A0A420QYV9.1
#=GS A0A212FCT2_DANPL/1-227      AC A0A212FCT2.1
#=GS A0A087VXB5_ECHMU/1-257      AC A0A087VXB5.1
#=GS A0A067PS72_9AGAM/1-227      AC A0A067PS72.1
#=GS A0A1D6MQ11_MAIZE/1-254      AC A0A1D6MQ11.1
#=GS A0A166DK02_DAUCS/1-255      AC A0A166DK02.1
#=GS A0A2K3JQ31_TRIPR/1-239      AC A0A2K3JQ31.1
#=GS A0A3N7EGL0_POPTR/1-97       AC A0A3N7EGL0.1
#=GS W9RHI7_9ROSA/1-250          AC W9RHI7.1
#=GS A0A6G1C4S2_9ORYZ/1-176      AC A0A6G1C4S2.1
#=GS A0A5F5XEL9_FELCA/18-174     AC A0A5F5XEL9.1
#=GS Q5KGH2_CRYNJ/1-229          AC Q5KGH2.2
#=GS A0A1J7IGT7_LUPAN/1-254      AC A0A1J7IGT7.1
#=GS A0A498HVV3_MALDO/1-254      AC A0A498HVV3.1
#=GS A0A446LV12_TRITD/1-104      AC A0A446LV12.1
#=GS A0A2N3N690_9PEZI/3-229      AC A0A2N3N690.1
#=GS A0A150G1X6_GONPE/107-271    AC A0A150G1X6.1
#=GS A0A0G4PFA7_PENCA/1-260      AC A0A0G4PFA7.1
#=GS A0A1E3NZV2_WICAA/1-170      AC A0A1E3NZV2.1
#=GS A0A0V0RM65_9BILA/402-628    AC A0A0V0RM65.1
#=GS A0A329S629_9STRA/1-240      AC A0A329S629.1
#=GS G8YJE1_PICSO/1-226          AC G8YJE1.1
#=GS A0A2K5WKW8_MACFA/111-240    AC A0A2K5WKW8.1
#=GS A0A4P9VXT9_9FUNG/119-212    AC A0A4P9VXT9.1
#=GS A0A3P8SAB8_AMPPE/1-227      AC A0A3P8SAB8.1
#=GS K2R094_MACPH/1-268          AC K2R094.1
#=GS Q4N7H8_THEPA/31-272         AC Q4N7H8.1
#=GS A0A0L7LXQ8_PLAF4/45-259     AC A0A0L7LXQ8.1
#=GS A0A0D2S922_GOSRA/1-254      AC A0A0D2S922.1
#=GS A2ECG7_TRIVA/108-198        AC A2ECG7.1
#=GS A0A540N975_MALBA/38-290     AC A0A540N975.1
#=GS A0A4Z1JVA1_9HELO/1-227      AC A0A4Z1JVA1.1
#=GS A0A251R8V3_PRUPE/1-254      AC A0A251R8V3.1
#=GS A0A015JG86_RHIIW/1-246      AC A0A015JG86.1
#=GS B4JX24_DROGR/1-226          AC B4JX24.1
#=GS A0A384DE85_URSMA/34-280     AC A0A384DE85.1
#=GS A0A3Q1CJI1_AMPOC/1-227      AC A0A3Q1CJI1.1
#=GS A0A084QK23_STAC4/1-260      AC A0A084QK23.1
#=GS A2D951_TRIVA/101-199        AC A2D951.1
#=GS A0A443SJQ0_9ACAR/1-38       AC A0A443SJQ0.1
#=GS B6HAA4_PENRW/1-217          AC B6HAA4.1
#=GS C5DJK2_LACTC/1-254          AC C5DJK2.1
#=GS A0A139YBW2_GIBM7/1-260      AC A0A139YBW2.1
#=GS A0A1J7HZA9_LUPAN/1-255      AC A0A1J7HZA9.1
#=GS A0A446UQL3_TRITD/1-251      AC A0A446UQL3.1
#=GS A0A3Q7VVL4_URSAR/1-227      AC A0A3Q7VVL4.1
#=GS K0STL9_THAOC/61-291         AC K0STL9.1
#=GS A0A367JEZ8_RHIST/1-254      AC A0A367JEZ8.1
#=GS A0A238FK81_9BASI/21-246     AC A0A238FK81.1
#=GS A0A5C3FAZ7_9BASI/1-261      AC A0A5C3FAZ7.1
#=GS W5MMP5_LEPOC/1-227          AC W5MMP5.1
#=GS A0CZ91_PARTE/1-223          AC A0CZ91.1
#=GS W4YTY2_STRPU/12-249         AC W4YTY2.1
#=GS W5LJE1_ASTMX/1-216          AC W5LJE1.2
#=GS A0A674EFM6_SALTR/1-227      AC A0A674EFM6.1
#=GS H2P161_PONAB/1-254          AC H2P161.1
#=GS A0A067TM94_GALM3/4-98       AC A0A067TM94.1
#=GS A0A5N3XJR0_MUNRE/1-227      AC A0A5N3XJR0.1
#=GS A0A3Q0E969_CARSF/1-178      AC A0A3Q0E969.1
#=GS A0A2P8XEQ7_BLAGE/14-196     AC A0A2P8XEQ7.1
#=GS A0A0C9WT56_9AGAR/1-61       AC A0A0C9WT56.1
#=GS A0A453M1R0_AEGTS/4-72       AC A0A453M1R0.1
#=GS W2R4J2_PHYPN/1-240          AC W2R4J2.1
#=GS A0A0M8MHX0_9BASI/1-227      AC A0A0M8MHX0.1
#=GS A0A540M2M6_MALBA/97-380     AC A0A540M2M6.1
#=GS A0A0V0WFH2_9BILA/1-255      AC A0A0V0WFH2.1
#=GS A0A200R792_9MAGN/1-254      AC A0A200R792.1
#=GS A0A2N5W758_9BASI/1-234      AC A0A2N5W758.1
#=GS A0A1V2L0A5_CYBFA/1-254      AC A0A1V2L0A5.1
#=GS A0A1D6GFN7_MAIZE/1-255      AC A0A1D6GFN7.1
#=GS F8PQY3_SERL3/1-70           AC F8PQY3.1
#=GS Q4DQY9_TRYCC/1-237          AC Q4DQY9.1
#=GS A0A0D9P3K0_METAN/18-213     AC A0A0D9P3K0.1
#=GS A0A094HPF2_9PEZI/1-259      AC A0A094HPF2.1
#=GS A0A0C4DZ55_MAGP6/1-227      AC A0A0C4DZ55.1
#=GS A0A3P9P989_POERE/1-254      AC A0A3P9P989.1
#=GS A0A1Y1JE84_PLAGO/56-271     AC A0A1Y1JE84.1
#=GS A0A446UQP3_TRITD/1-255      AC A0A446UQP3.1
#=GS A7EQS3_SCLS1/1-227          AC A7EQS3.1
#=GS A0A2P6TTG7_CHLSO/1016-1201  AC A0A2P6TTG7.1
#=GS A0A0G4FMX9_VITBC/1-222      AC A0A0G4FMX9.1
#=GS L8GNL2_ACACA/1-144          AC L8GNL2.1
#=GS A0A2K5NC46_CERAT/1-254      AC A0A2K5NC46.1
#=GS A0A446TIQ0_TRITD/1-255      AC A0A446TIQ0.1
#=GS A0A340WBU9_LIPVE/1-227      AC A0A340WBU9.1
#=GS A0A4W3HZI6_CALMI/1-192      AC A0A4W3HZI6.1
#=GS A0A1Z5KD03_FISSO/1-238      AC A0A1Z5KD03.1
#=GS A0A425BV07_9PEZI/1-227      AC A0A425BV07.1
#=GS A0A2K1JH68_PHYPA/1-254      AC A0A2K1JH68.1
#=GS M3ZBU9_NOMLE/1-227          AC M3ZBU9.1
#=GS A0A1Q8RCU8_9PEZI/14-241     AC A0A1Q8RCU8.1
#=GS A0A3P8TA24_AMPPE/1-254      AC A0A3P8TA24.1
#=GS W9HZU5_FUSOX/1-260          AC W9HZU5.1
#=GS A0A2I4AWP2_9TELE/1-227      AC A0A2I4AWP2.1
#=GS A0A150G1X6_GONPE/1-84       AC A0A150G1X6.1
#=GS A0A3Q0HWU0_PHODC/2-56       AC A0A3Q0HWU0.1
#=GS A0A2S5B1K8_9BASI/1-227      AC A0A2S5B1K8.1
#=GS A0A4S4EQW1_CAMSI/1-202      AC A0A4S4EQW1.1
#=GS A0A6Q2YNP3_ESOLU/1-227      AC A0A6Q2YNP3.1
#=GS A0A446TIJ3_TRITD/1-255      AC A0A446TIJ3.1
#=GS A0A446Q6W9_TRITD/1-254      AC A0A446Q6W9.1
#=GS A0A4W5R7G3_9TELE/1-254      AC A0A4W5R7G3.1
#=GS A0A0C2DCD8_9BILA/1-255      AC A0A0C2DCD8.1
#=GS W7M8R3_GIBM7/1-228          AC W7M8R3.1
#=GS A0A453LGJ8_AEGTS/1-192      AC A0A453LGJ8.1
#=GS A0A2J7ZMI7_9CHLO/1-214      AC A0A2J7ZMI7.1
#=GS A0A455B7E4_PHYMC/1-227      AC A0A455B7E4.1
#=GS A0A507DML5_9FUNG/1-253      AC A0A507DML5.1
#=GS A0A024GA24_9STRA/1-234      AC A0A024GA24.1
#=GS A0A4P1R0K3_LUPAN/1-78       AC A0A4P1R0K3.1
#=GS A0A673B0I4_9TELE/1-254      AC A0A673B0I4.1
#=GS A0A3Q1B604_AMPOC/1-227      AC A0A3Q1B604.1
#=GS A0A660KN63_9ROSI/1-98       AC A0A660KN63.1
#=GS A0A0V1LTJ2_9BILA/1-227      AC A0A0V1LTJ2.1
#=GS A0A1Z5KEG2_FISSO/54-296     AC A0A1Z5KEG2.1
#=GS A0A1Q9DL65_SYMMI/1-206      AC A0A1Q9DL65.1
#=GS A0A0K0DTB8_STRER/1-255      AC A0A0K0DTB8.1
#=GS M7BX00_CHEMY/3-228          AC M7BX00.1
#=GS F4WWH8_ACREC/1-255          AC F4WWH8.1
#=GS A0A5N6V8A1_9EURO/1-257      AC A0A5N6V8A1.1
#=GS A0A4W3JRJ3_CALMI/1-254      AC A0A4W3JRJ3.1
#=GS T2AX49_9VIRU/1-119          AC T2AX49.1
#=GS A0A4W3HZC7_CALMI/2-205      AC A0A4W3HZC7.1
#=GS A0A124SH65_CYNCS/1-250      AC A0A124SH65.1
#=GS A0A6I8W576_DROPS/1-226      AC A0A6I8W576.1
#=GS A0A446TAR7_TRITD/38-186     AC A0A446TAR7.1
#=GS A0A673CG60_9TELE/1-227      AC A0A673CG60.1
#=GS A0A3Q3BGJ8_KRYMA/1-227      AC A0A3Q3BGJ8.1
#=GS A0A0D2FKT2_9EURO/1-227      AC A0A0D2FKT2.1
#=GS A0A287LYH6_HORVV/1-254      AC A0A287LYH6.1
#=GS A0A4Y7K3Y9_PAPSO/1-262      AC A0A4Y7K3Y9.1
#=GS A0A1U8ETL8_CAPAN/1-255      AC A0A1U8ETL8.1
#=GS A0A4R0RTT4_9APHY/1-260      AC A0A4R0RTT4.1
#=GS EX0N_IIV3/123-232           AC Q197A1.1
#=GS A0A1D3THG0_9APIC/60-274     AC A0A1D3THG0.1
#=GS A0A453LGC4_AEGTS/3-186      AC A0A453LGC4.1
#=GS A0A091HP99_BUCRH/4-233      AC A0A091HP99.1
#=GS S9VKJ1_9TRYP/1-194          AC S9VKJ1.1
#=GS A0A2U1P6P0_ARTAN/1-174      AC A0A2U1P6P0.1
#=GS A0A1G4JQQ9_9SACH/1-254      AC A0A1G4JQQ9.1
#=GS A0A453G1U3_AEGTS/68-321     AC A0A453G1U3.1
#=GS A0A6G1DL10_9ORYZ/1-255      AC A0A6G1DL10.1
#=GS A0A1V8TS25_9PEZI/1-227      AC A0A1V8TS25.1
#=GS B7PTZ6_IXOSC/1-154          AC B7PTZ6.1
#=GS A0A4W6FTG1_LATCA/1-254      AC A0A4W6FTG1.1
#=GS F7CSV0_ORNAN/1-92           AC F7CSV0.2
#=GS Q4U9U2_THEAN/1-268          AC Q4U9U2.1
#=GS A0A226NBX3_CALSU/1-227      AC A0A226NBX3.1
#=GS A0A194UYW7_9PEZI/1-227      AC A0A194UYW7.1
#=GS A0A673T7C5_SURSU/1-227      AC A0A673T7C5.1
#=GS A0A2G9V3L3_TELCI/40-110     AC A0A2G9V3L3.1
#=GS A0A4W3KFI7_CALMI/1-254      AC A0A4W3KFI7.1
#=GS A0A1E5RIM6_HANUV/1-230      AC A0A1E5RIM6.1
#=GS A0A671WK55_SPAAU/1-227      AC A0A671WK55.1
#=GS A0A137Q5Y8_9AGAR/1-217      AC A0A137Q5Y8.1
#=GS U6K0I7_9EIME/299-498        AC U6K0I7.1
#=GS A0A6A5CGK5_NAEFO/1-343      AC A0A6A5CGK5.1
#=GS A0A087SEE1_AUXPR/1-254      AC A0A087SEE1.1
#=GS A0A3B6LUY7_WHEAT/1-255      AC A0A3B6LUY7.1
#=GS A0A4W5MRM6_9TELE/1-254      AC A0A4W5MRM6.1
#=GS U3J2M3_ANAPP/1-254          AC U3J2M3.2
#=GS Q57W91_TRYB2/1-244          AC Q57W91.1
#=GS A0A287LYD3_HORVV/1-254      AC A0A287LYD3.1
#=GS G0R1H5_ICHMG/1-231          AC G0R1H5.1
#=GS A0A6A3ADS2_HIBSY/1-255      AC A0A6A3ADS2.1
#=GS A0A2P6R694_ROSCH/1-255      AC A0A2P6R694.1
#=GS A0A2P5BER4_PARAD/1-258      AC A0A2P5BER4.1
#=GS X6LFQ9_RETFI/1-225          AC X6LFQ9.1
#=GS U6GVZ3_EIMAC/120-379        AC U6GVZ3.1
#=GS A0A251SDV5_HELAN/1-254      AC A0A251SDV5.1
#=GS A0A482S5Y4_9ARCH/82-182     AC A0A482S5Y4.1
#=GS A0A672FH60_SALFA/1-66       AC A0A672FH60.1
#=GS V6LRY8_9EUKA/1-289          AC V6LRY8.1
#=GS A0A5N6MLQ6_9ASTR/1-254      AC A0A5N6MLQ6.1
#=GS A0A4U6XL14_9PEZI/1-228      AC A0A4U6XL14.1
#=GS A0A4W5P620_9TELE/1-227      AC A0A4W5P620.1
#=GS A0A3Q0IR65_DIACI/1-255      AC A0A3Q0IR65.1
#=GS A0A340WYZ5_LIPVE/1-254      AC A0A340WYZ5.1
#=GS A0A3Q3M3T5_9TELE/1-227      AC A0A3Q3M3T5.1
#=GS A0A1U8J343_GOSHI/1-255      AC A0A1U8J343.1
#=GS A0A665V6W1_ECHNA/1-227      AC A0A665V6W1.1
#=GS A0A0D8Y0X5_DICVI/1-227      AC A0A0D8Y0X5.1
#=GS A0A063BRA9_USTVR/557-783    AC A0A063BRA9.1
#=GS R0HTN4_9BRAS/1-254          AC R0HTN4.1
#=GS A0A2P8YJ30_BLAGE/129-165    AC A0A2P8YJ30.1
#=GS A0A2U1NGN4_ARTAN/1-254      AC A0A2U1NGN4.1
#=GS A6R8Q5_AJECN/1-259          AC A6R8Q5.1
#=GS A0A4V1X9Y9_9PEZI/1-260      AC A0A4V1X9Y9.1
#=GS A0A2G8LD93_STIJA/1-232      AC A0A2G8LD93.1
#=GS A0A507EVU9_9FUNG/1-231      AC A0A507EVU9.1
#=GS T0MCZ2_9MICR/1-246          AC T0MCZ2.1
#=GS A0A093GV42_DRYPU/1-254      AC A0A093GV42.1
#=GS C9JCZ8_HUMAN/1-88           AC C9JCZ8.1
#=GS A0A2K6F7U7_PROCO/1-142      AC A0A2K6F7U7.1
#=GS A0A5C6NNE9_9TELE/4-242      AC A0A5C6NNE9.1
#=GS A0A0M0JAW5_9EUKA/226-461    AC A0A0M0JAW5.1
#=GS A0A6G1DIZ4_9ORYZ/1-255      AC A0A6G1DIZ4.1
#=GS A0A5J9TPM5_9POAL/1-255      AC A0A5J9TPM5.1
#=GS A0A197JZI5_9FUNG/1-207      AC A0A197JZI5.1
#=GS A0A2J6L2D8_LACSA/1-235      AC A0A2J6L2D8.1
#=GS A0A183EG75_9BILA/1-141      AC A0A183EG75.1
#=GS A0A4Y7IZ39_PAPSO/4-58       AC A0A4Y7IZ39.1
#=GS A0A674GK40_TAEGU/1-178      AC A0A674GK40.1
#=GS A0A369K9T1_HYPMA/1-227      AC A0A369K9T1.1
#=GS A0A674NRG1_TAKRU/15-259     AC A0A674NRG1.1
#=GS A0A2U1LIW1_ARTAN/1-259      AC A0A2U1LIW1.1
#=GS A0A446NWY4_TRITD/1-254      AC A0A446NWY4.1
#=GS T0JV44_COLGC/1-228          AC T0JV44.1
#=GS A0A167CV40_9ASCO/1-145      AC A0A167CV40.1
#=GS A0A6H5KZW9_9PHAE/20-214     AC A0A6H5KZW9.1
#=GS A0A3Q7VL90_URSAR/1-227      AC A0A3Q7VL90.1
#=GS A0A096P9L5_OSTTA/1-206      AC A0A096P9L5.1
#=GS A0A672FFG0_SALFA/1-66       AC A0A672FFG0.1
#=GS G7PH32_MACFA/1-254          AC G7PH32.1
#=GS G7XNP3_ASPKW/1-259          AC G7XNP3.1
#=GS A0A1V4K402_PATFA/1-227      AC A0A1V4K402.1
#=GS A0A1U7V171_NICSY/16-167     AC A0A1U7V171.1
#=GS A0A0K0CTQ1_ANGCA/1-247      AC A0A0K0CTQ1.2
#=GS L1I795_GUITC/18-121         AC L1I795.1
#=GS A0A2G5CKG8_AQUCA/1-255      AC A0A2G5CKG8.1
#=GS A0A1D6MQ20_MAIZE/1-174      AC A0A1D6MQ20.1
#=GS A0A167ZWZ5_9EURO/1-261      AC A0A167ZWZ5.1
#=GS A0A232F0M1_9HYME/1-255      AC A0A232F0M1.1
#=GS G8YGJ3_PICSO/1-251          AC G8YGJ3.1
#=GS A0A175VRX2_9PEZI/1-260      AC A0A175VRX2.1
#=GS W9R6M9_9ROSA/1-251          AC W9R6M9.1
#=GS A0A674C189_SALTR/1-254      AC A0A674C189.1
#=GS V4KCS7_EUTSA/1-254          AC V4KCS7.1
#=GS A2EP68_TRIVA/1-210          AC A2EP68.1
#=GS A0A4W3KFH8_CALMI/1-254      AC A0A4W3KFH8.1
#=GS A0A423VVQ8_9PEZI/1-260      AC A0A423VVQ8.1
#=GS A0A5F8G1M1_MONDO/1-254      AC A0A5F8G1M1.1
#=GS A0A179HCT8_PURLI/1-260      AC A0A179HCT8.1
#=GS F0VE48_NEOCL/1-239          AC F0VE48.1
#=GS A0A4W2DCX1_BOBOX/1-227      AC A0A4W2DCX1.1
#=GS W6LCR5_9TRYP/1-228          AC W6LCR5.1
#=GS A0A0V0RLV3_9BILA/402-628    AC A0A0V0RLV3.1
#=GS A0A4W4G9I6_ELEEL/1-227      AC A0A4W4G9I6.1
#=GS A0A2H3I657_9EURO/1-262      AC A0A2H3I657.1
#=GS W9IYC9_FUSOX/1-228          AC W9IYC9.1
#=GS A0A2R8FDC5_9VIRU/84-177     AC A0A2R8FDC5.1
#=GS A0A4S4EQW1_CAMSI/203-274    AC A0A4S4EQW1.1
#=GS A0A1V6TB63_9EURO/1-260      AC A0A1V6TB63.1
#=GS A0A444UUL6_ACIRT/105-180    AC A0A444UUL6.1
#=GS E3LRH7_CAERE/1-255          AC E3LRH7.1
#=GS A0A4Y9XU37_9APHY/1-256      AC A0A4Y9XU37.1
#=GS R1DRP7_EMIHU/19-235         AC R1DRP7.1
#=GS A0A1V2L7M1_CYBFA/2-70       AC A0A1V2L7M1.1
#=GS D2XAW2_GBMV/116-211         AC D2XAW2.1
#=GS A0A433P949_9FUNG/1-197      AC A0A433P949.1
#=GS A0A0K6FVQ8_9AGAM/1-259      AC A0A0K6FVQ8.1
#=GS D8LV03_BLAHO/1-260          AC D8LV03.1
#=GS A0A1N6LWA2_BABMR/1-254      AC A0A1N6LWA2.1
#=GS L1LER9_THEEQ/440-690        AC L1LER9.1
#=GS U6LGV9_9EIME/240-508        AC U6LGV9.1
#=GS A0A6A0AAV9_HAELA/1-84       AC A0A6A0AAV9.1
#=GS S9VBN3_9TRYP/1-234          AC S9VBN3.1
#=GS A0A0M0JMJ0_9EUKA/545-752    AC A0A0M0JMJ0.1
#=GS XRN1_MOUSE/1-227            AC P97789.1
#=GS A0A699ZF65_HAELA/1-57       AC A0A699ZF65.1
#=GS A0A671WZ49_SPAAU/1-254      AC A0A671WZ49.1
#=GS A0A2K6ESP8_PROCO/1-227      AC A0A2K6ESP8.1
#=GS A0A4Z1JC80_9HELO/1-227      AC A0A4Z1JC80.1
#=GS F2U7H9_SALR5/1-219          AC F2U7H9.1
#=GS A0A0V0XW70_TRIPS/10-264     AC A0A0V0XW70.1
#=GS A0A093QZA5_PHACA/3-233      AC A0A093QZA5.1
#=GS A0A0N4T803_BRUPA/1-192      AC A0A0N4T803.1
#=GS A0A4S2LKJ2_OPIFE/1-224      AC A0A4S2LKJ2.1
#=GS A0A0P7BM22_9HYPO/1-260      AC A0A0P7BM22.1
#=GS F2WLR5_9VIRU/127-221        AC F2WLR5.1
#=GS A0A015L2C5_RHIIW/1-255      AC A0A015L2C5.1
#=GS A0A1W0A9W7_9STRA/768-1021   AC A0A1W0A9W7.1
#=GS A0A1U8B2N1_NELNU/1-253      AC A0A1U8B2N1.1
#=GS A0A314KWV8_NICAT/1-254      AC A0A314KWV8.1
#=GS A0A4S4F2E9_CAMSI/1-226      AC A0A4S4F2E9.1
#=GS A0A3R7LZH3_TRYRA/1-250      AC A0A3R7LZH3.1
#=GS A0A1S3LW81_SALSA/1-227      AC A0A1S3LW81.1
#=GS G1M1L5_AILME/1-223          AC G1M1L5.1
#=GS A0A446TIG9_TRITD/1-255      AC A0A446TIG9.1
#=GS A0A5F9CK00_RABIT/1-254      AC A0A5F9CK00.1
#=GS W6KG20_9TRYP/1-251          AC W6KG20.1
#=GS A0A4S4ENE8_CAMSI/66-111     AC A0A4S4ENE8.1
#=GS A0A0C3NFJ7_PHLGI/1-228      AC A0A0C3NFJ7.1
#=GS A0A2Y9P7Z4_DELLE/1-227      AC A0A2Y9P7Z4.1
#=GS E3T4F8_CROVB/1-213          AC E3T4F8.1
#=GS A0A1B7MQ64_9AGAM/1-227      AC A0A1B7MQ64.1
#=GS A0A3B0KBA4_DROGU/1-226      AC A0A3B0KBA4.1
#=GS A0A287LYE3_HORVV/33-286     AC A0A287LYE3.1
#=GS G0MQE8_CAEBE/1-280          AC G0MQE8.1
#=GS G1M1T0_AILME/1-254          AC G1M1T0.1
#=GS A0A673B5C5_9TELE/1-254      AC A0A673B5C5.1
#=GS A0A4U5Q015_POPAL/1-254      AC A0A4U5Q015.1
#=GS A0A2K3LZ99_TRIPR/1-77       AC A0A2K3LZ99.1
#=GS A0A2G5BFE1_COERN/1-161      AC A0A2G5BFE1.1
#=GS A0A4Q4VYM8_9PEZI/1-260      AC A0A4Q4VYM8.1
#=GS J4C361_THEOR/1-281          AC J4C361.1
#=GS A0A2I0WAV0_9ASPA/1-254      AC A0A2I0WAV0.1
#=GS A0A2J7QVG1_9NEOP/1-227      AC A0A2J7QVG1.1
#=GS A0A2I0VB53_9ASPA/1-250      AC A0A2I0VB53.1
#=GS K8EM27_9CHLO/1-248          AC K8EM27.1
#=GS A0A200R7B0_9MAGN/54-236     AC A0A200R7B0.1
#=GS R1DPI6_EMIHU/1-245          AC R1DPI6.1
#=GS A0A135LP29_PENPA/1-260      AC A0A135LP29.1
#=GS A0A0D7A574_9AGAR/17-124     AC A0A0D7A574.1
#=GS A0A2A3EEH8_APICC/1-227      AC A0A2A3EEH8.1
#=GS A0A0C3P7W9_PISTI/6-82       AC A0A0C3P7W9.1
#=GS T1G6A0_HELRO/1-118          AC T1G6A0.1
#=GS V5FG21_BYSSN/1-259          AC V5FG21.1
#=GS A0A376B7R7_9ASCO/1-226      AC A0A376B7R7.1
#=GS E2LXL5_MONPE/3-213          AC E2LXL5.1
#=GS A0A0L0SDG6_ALLM3/6-262      AC A0A0L0SDG6.1
#=GS A0A674EFL5_SALTR/1-227      AC A0A674EFL5.1
#=GS A0A674GDC4_TAEGU/1-170      AC A0A674GDC4.1
#=GS A0A1E3HRF6_9TREE/1-229      AC A0A1E3HRF6.1
#=GS A0A151ND65_ALLMI/1-254      AC A0A151ND65.1
#=GS A0A420HD91_9PEZI/1-244      AC A0A420HD91.1
#=GS E9AH11_LEIIN/1-270          AC E9AH11.1
#=GS A0A315AB42_PRUYE/1-165      AC A0A315AB42.1
#=GS A0A4S2L8R2_9HYME/1-226      AC A0A4S2L8R2.1
#=GS M0RWF5_MUSAM/1-233          AC M0RWF5.1
#=GS A0A0B1PF02_9BILA/3-226      AC A0A0B1PF02.1
#=GS A0A446Q6X9_TRITD/1-254      AC A0A446Q6X9.1
#=GS X0CFA0_FUSOX/1-260          AC X0CFA0.1
#=GS A0A5D2ZCS0_GOSMU/1-254      AC A0A5D2ZCS0.1
#=GS A0A1S5XYD5_9VIRU/11-129     AC A0A1S5XYD5.1
#=GS A0A5N5MRE2_9ROSI/1-254      AC A0A5N5MRE2.1
#=GS A0A2C5Y9Y8_9HYPO/1-228      AC A0A2C5Y9Y8.1
#=GS A0A0N5D3U0_THECL/1-227      AC A0A0N5D3U0.1
#=GS A0A4W5P357_9TELE/5-137      AC A0A4W5P357.1
#=GS A0A674AM32_SALTR/1-254      AC A0A674AM32.1
#=GS A0A671WIX7_SPAAU/4-223      AC A0A671WIX7.1
#=GS A0A3M6UJ11_9CNID/1-227      AC A0A3M6UJ11.1
#=GS B4GW61_DROPE/1-111          AC B4GW61.1
#=GS A0A2K1IF84_PHYPA/1-254      AC A0A2K1IF84.1
#=GS G1KDG4_ANOCA/1-227          AC G1KDG4.2
#=GS G1MW63_MELGA/1-258          AC G1MW63.2
#=GS A0A168DRG5_9EURO/1-227      AC A0A168DRG5.1
#=GS R1CT79_EMIHU/1-245          AC R1CT79.1
#=GS F0VP25_NEOCL/407-528        AC F0VP25.1
#=GS I7MKR8_TETTS/1-239          AC I7MKR8.2
#=GS Q8SQN6_ENCCU/1-261          AC Q8SQN6.1
#=GS A0A2P6TTG7_CHLSO/969-1018   AC A0A2P6TTG7.1
#=GS A0A0L9V627_PHAAN/1-243      AC A0A0L9V627.1
#=GS L5LFL0_MYODS/1-254          AC L5LFL0.1
#=GS A0A1D3JM87_PLAMA/1-272      AC A0A1D3JM87.1
#=GS A0A1V4K3R2_PATFA/1-227      AC A0A1V4K3R2.1
#=GS A0A1Y1XDW4_9FUNG/101-187    AC A0A1Y1XDW4.1
#=GS A0A1X6NU41_PORUM/1-225      AC A0A1X6NU41.1
#=GS A0A287SKK6_HORVV/5-72       AC A0A287SKK6.1
#=GS B2B220_PODAN/1-277          AC B2B220.1
#=GS A0A0M8MYR6_9BASI/2-260      AC A0A0M8MYR6.1
#=GS D7G8V1_ECTSI/20-214         AC D7G8V1.1
#=GS I1NC68_SOYBN/1-254          AC I1NC68.1
#=GS A0A2P6VPQ0_9CHLO/479-582    AC A0A2P6VPQ0.1
#=GS A0A1D3PBT8_PLAMA/52-269     AC A0A1D3PBT8.1
#=GS A0A150GP34_GONPE/1-103      AC A0A150GP34.1
#=GS A0A446UR31_TRITD/1-255      AC A0A446UR31.1
#=GS A0A5D2XC88_GOSMU/1-255      AC A0A5D2XC88.1
#=GS K7IR49_NASVI/1-226          AC K7IR49.1
#=GS A0A6A6KKE3_HEVBR/1-255      AC A0A6A6KKE3.1
#=GS A0A663EAE1_AQUCH/147-223    AC A0A663EAE1.1
#=GS A0A3S3NXE9_9ACAR/1-227      AC A0A3S3NXE9.1
#=GS A0A2K5JWF6_COLAP/1-254      AC A0A2K5JWF6.1
#=GS A0A2P7YZ08_9ASCO/1-252      AC A0A2P7YZ08.1
#=GS A0A1E3IS20_9TREE/1-201      AC A0A1E3IS20.1
#=GS A0A1D6MQ10_MAIZE/1-254      AC A0A1D6MQ10.1
#=GS A0A2N5SZ78_9BASI/1-227      AC A0A2N5SZ78.1
#=GS A0A667Y9N2_9TELE/1-254      AC A0A667Y9N2.1
#=GS A0A0K8LLE9_9EURO/1-259      AC A0A0K8LLE9.1
#=GS A0A1B7P8L7_9EURO/1-259      AC A0A1B7P8L7.1
#=GS A0A5B6U9Y8_9ROSI/1-254      AC A0A5B6U9Y8.1
#=GS A0A423VMA5_9PEZI/1-260      AC A0A423VMA5.1
#=GS A0A507F583_9FUNG/1-231      AC A0A507F583.1
#=GS A0A2K6ESP9_PROCO/1-227      AC A0A2K6ESP9.1
#=GS A0A3R7RG04_TRYRA/1-248      AC A0A3R7RG04.1
#=GS K0SHV6_THAOC/124-484        AC K0SHV6.1
#=GS A0A5N5DKN7_9PEZI/1-227      AC A0A5N5DKN7.1
#=GS A4IDF0_LEIIN/1-251          AC A4IDF0.1
#=GS A0A0L0T8C1_ALLM3/4-238      AC A0A0L0T8C1.1
#=GS A0A4U5R5B8_POPAL/1-255      AC A0A4U5R5B8.1
#=GS A0A556V3L2_BAGYA/1-192      AC A0A556V3L2.1
#=GS A0A1Q9BX56_SYMMI/1-39       AC A0A1Q9BX56.1
#=GS A0A2P6TY66_CHLSO/1-226      AC A0A2P6TY66.1
#=GS A0A446UQL8_TRITD/1-255      AC A0A446UQL8.1
#=GS G1N3Q8_MELGA/1-200          AC G1N3Q8.2
#=GS K1X1G8_MARBU/1-254          AC K1X1G8.1
#=GS A0A238BIN9_9BILA/36-297     AC A0A238BIN9.1
#=GS A0A078GAI2_BRANA/1-239      AC A0A078GAI2.1
#=GS A0A0L0F3J5_9EUKA/48-100     AC A0A0L0F3J5.1
#=GS A0A4W4G951_ELEEL/1-227      AC A0A4W4G951.1
#=GS Q4N5X7_THEPA/1-354          AC Q4N5X7.1
#=GS A0A0V0RLS5_9BILA/412-638    AC A0A0V0RLS5.1
#=GS A0A453G1V3_AEGTS/67-320     AC A0A453G1V3.1
#=GS A0A2U9BKR7_SCOMX/1-227      AC A0A2U9BKR7.1
#=GS A0A024VQE1_PLAFA/45-236     AC A0A024VQE1.1
#=GS F7EXN5_ORNAN/3-229          AC F7EXN5.2
#=GS A0A068UJ53_COFCA/1-255      AC A0A068UJ53.1
#=GS X0D277_FUSOX/1-228          AC X0D277.1
#=GS A0A182DXR7_ONCOC/20-289     AC A0A182DXR7.1
#=GS A0A250WUK2_9CHLO/1-256      AC A0A250WUK2.1
#=GS A0A384DGJ4_URSMA/1-227      AC A0A384DGJ4.1
#=GS A0A0S3S585_PHAAN/1-251      AC A0A0S3S585.1
#=GS A0A420HDF4_9PEZI/1-227      AC A0A420HDF4.1
#=GS A0A2K3K4C9_TRIPR/1-130      AC A0A2K3K4C9.1
#=GS A0A4P9WIP2_9FUNG/32-258     AC A0A4P9WIP2.1
#=GS A0A1V6T0H1_9EURO/1-227      AC A0A1V6T0H1.1
#=GS A0A179UI91_BLAGS/1-259      AC A0A179UI91.1
#=GS A0A2U9R834_PICKU/39-264     AC A0A2U9R834.1
#=GS A0A1U7LMN0_NEOID/1-185      AC A0A1U7LMN0.1
#=GS A0A2G9S9K5_LITCT/1-88       AC A0A2G9S9K5.1
#=GS I3EFL4_NEMP3/100-206        AC I3EFL4.1
#=GS A0A5J9W902_9POAL/1-255      AC A0A5J9W902.1
#=GS A0A4P9Y7N9_9FUNG/1-277      AC A0A4P9Y7N9.1
#=GS A0A5S6PVI8_BRUMA/1-254      AC A0A5S6PVI8.1
#=GS A0A060W1Z3_ONCMY/1-254      AC A0A060W1Z3.1
#=GS G1RG93_NOMLE/1-254          AC G1RG93.1
#=GS A0A5B6X0M4_9ROSI/1-255      AC A0A5B6X0M4.1
#=GS A0A1J6IFK7_NICAT/1-250      AC A0A1J6IFK7.1
#=GS A0A1V8T500_9PEZI/1-262      AC A0A1V8T500.1
#=GS L8YF78_TUPCH/1-143          AC L8YF78.1
#=GS K7Y9P1_9VIRU/70-292         AC K7Y9P1.1
#=GS A0A2P4Y092_9STRA/1-255      AC A0A2P4Y092.1
#=GS A0A2H9TIC5_9FUNG/16-180     AC A0A2H9TIC5.1
#=GS A0A067BPM3_SAPPC/1-254      AC A0A067BPM3.1
#=GS A0A2P5EDZ2_TREOI/1-222      AC A0A2P5EDZ2.1
#=GS A0A3M7BC79_HORWE/1-265      AC A0A3M7BC79.1
#=GS A0A2J6L061_LACSA/1-254      AC A0A2J6L061.1
#=GS A0A2R6PZN8_ACTCC/1-254      AC A0A2R6PZN8.1
#=GS A0A674MVQ9_TAKRU/15-259     AC A0A674MVQ9.1
#=GS A0A091K1Z4_COLST/2-230      AC A0A091K1Z4.1
#=GS A0A5N6ZI10_9EURO/1-227      AC A0A5N6ZI10.1
#=GS A0A4S3JY69_9EURO/1-259      AC A0A4S3JY69.1
#=GS H2PBM7_PONAB/1-227          AC H2PBM7.1
#=GS A0A1V6YR73_PENNA/1-260      AC A0A1V6YR73.1
#=GS A0A453G1P5_AEGTS/45-298     AC A0A453G1P5.1
#=GS F8VQ87_MOUSE/1-227          AC F8VQ87.1
#=GS T1JKJ5_STRMM/1-145          AC T1JKJ5.1
#=GS K7JAH3_NASVI/6-124          AC K7JAH3.1
#=GS A0A0F7VF77_PENBI/1-260      AC A0A0F7VF77.1
#=GS A0A484DUP0_BRELC/1-240      AC A0A484DUP0.1
#=GS R4THG2_9PHYC/1-204          AC R4THG2.1
#=GS G7Y9Q2_CLOSI/1-257          AC G7Y9Q2.1
#=GS A0A498SJ65_ACAVI/136-211    AC A0A498SJ65.1
#=GS A0A2V0NSJ6_9CHLO/119-182    AC A0A2V0NSJ6.1
#=GS D2UYF9_NAEGR/131-226        AC D2UYF9.1
#=GS V9ETT5_PHYPR/1-240          AC V9ETT5.1
#=GS A0A0L0DJ19_THETB/1-192      AC A0A0L0DJ19.1
#=GS A0A1D3RDD5_9APIC/22-291     AC A0A1D3RDD5.1
#=GS A0A016T3P2_9BILA/1-227      AC A0A016T3P2.1
#=GS A0A0V1CMC2_TRIBR/6-260      AC A0A0V1CMC2.1
#=GS A0A158QIV7_RODNA/1-172      AC A0A158QIV7.1
#=GS A0A3D8SVU3_9EURO/1-258      AC A0A3D8SVU3.1
#=GS A0A2S4VF23_9BASI/1-93       AC A0A2S4VF23.1
#=GS A0A369HF44_9HYPO/1-228      AC A0A369HF44.1
#=GS A0A287LYD7_HORVV/1-254      AC A0A287LYD7.1
#=GS A0A5F9CTD8_RABIT/1-227      AC A0A5F9CTD8.1
#=GS A0A446NWQ7_TRITD/1-254      AC A0A446NWQ7.1
#=GS Q0D0F4_ASPTN/1-259          AC Q0D0F4.1
#=GS A0A2S4Q1C5_9PEZI/1-227      AC A0A2S4Q1C5.1
#=GS A0A2P5CLJ9_TREOI/1-258      AC A0A2P5CLJ9.1
#=GS A0A1Y1VLD2_9FUNG/3-204      AC A0A1Y1VLD2.1
#=GS A0A2U3ZXX4_ODORO/1-144      AC A0A2U3ZXX4.1
#=GS A0A6A5EFB9_PERFL/1-254      AC A0A6A5EFB9.1
#=GS A0A5N6SLH2_ASPPS/1-227      AC A0A5N6SLH2.1
#=GS A0A084GHV7_PSEDA/1-259      AC A0A084GHV7.1
#=GS B6AB64_CRYMR/1-249          AC B6AB64.1
#=GS A0A135LKY0_PENPA/1-227      AC A0A135LKY0.1
#=GS A0A5A7T6K4_CUCME/1-254      AC A0A5A7T6K4.1
#=GS S3CIY2_GLAL2/1-254          AC S3CIY2.1
#=GS A0A1J4KNW9_9EUKA/97-199     AC A0A1J4KNW9.1
#=GS A0A6P9ENA8_JUGRE/1-254      AC A0A6P9ENA8.1
#=GS A2YJR2_ORYSI/1-101          AC A2YJR2.1
#=GS A0A024X767_PLAFC/45-259     AC A0A024X767.1
#=GS A0A3M6VN15_9STRA/1-240      AC A0A3M6VN15.1
#=GS A0A165ID50_9APHY/7-117      AC A0A165ID50.1
#=GS A0A5C3DZC5_9BASI/1-227      AC A0A5C3DZC5.1
#=GS A0A6A5CIN3_NAEFO/1-316      AC A0A6A5CIN3.1
#=GS A0A444GJI1_ENSVE/1-69       AC A0A444GJI1.1
#=GS A0A3G2SD50_9BASI/1-227      AC A0A3G2SD50.1
#=GS A0A452SJ72_URSAM/1-254      AC A0A452SJ72.1
#=GS A0A1J9QQU8_9PEZI/1-264      AC A0A1J9QQU8.1
#=GS A0A067GYL6_CITSI/1-254      AC A0A067GYL6.1
#=GS A0A1S8BJP4_9PEZI/1-264      AC A0A1S8BJP4.1
#=GS A0A0K8L968_9EURO/1-227      AC A0A0K8L968.1
#=GS A0A507CV98_9FUNG/1-203      AC A0A507CV98.1
#=GS A0A2Y9IUG6_ENHLU/1-254      AC A0A2Y9IUG6.1
#=GS A0A0W8B9R1_PHYNI/1-240      AC A0A0W8B9R1.1
#=GS A0A420YA27_9PEZI/1-260      AC A0A420YA27.1
#=GS A0A453G1P8_AEGTS/1-254      AC A0A453G1P8.1
#=GS R7Z5C3_CONA1/1-260          AC R7Z5C3.1
#=GS A0A1D2MS83_ORCCI/3-226      AC A0A1D2MS83.1
#=GS W2S7A2_9EURO/1-227          AC W2S7A2.1
#=GS A0A4R8PX79_COLTR/1-260      AC A0A4R8PX79.1
#=GS A0A672V840_STRHB/1-227      AC A0A672V840.1
#=GS A0A0U5GT97_9EURO/1-227      AC A0A0U5GT97.1
#=GS A0A139HA37_9PEZI/1-228      AC A0A139HA37.1
#=GS A0A4Y7IX06_PAPSO/1-248      AC A0A4Y7IX06.1
#=GS A0A1Q3E423_LENED/11-186     AC A0A1Q3E423.1
#=GS A0A1X7UZF6_AMPQE/774-1009   AC A0A1X7UZF6.1
#=GS A0A665V7J0_ECHNA/1-227      AC A0A665V7J0.1
#=GS A0A194PHC4_PAPXU/1-255      AC A0A194PHC4.1
#=GS A0A6G0XS87_9STRA/1-254      AC A0A6G0XS87.1
#=GS A0A093QPU4_PHACA/1-202      AC A0A093QPU4.1
#=GS A0A4U6XV28_9PEZI/1-260      AC A0A4U6XV28.1
#=GS L0PA85_PNEJ8/8-232          AC L0PA85.1
#=GS A0A1D6MQ22_MAIZE/1-254      AC A0A1D6MQ22.1
#=GS A0A4Q7JRI4_METCM/1-228      AC A0A4Q7JRI4.1
#=GS V4YNJ2_TOXGV/75-429         AC V4YNJ2.1
#=GS A0A1A8VQF6_9APIC/54-325     AC A0A1A8VQF6.1
#=GS A0A0V0ZEI4_9BILA/6-260      AC A0A0V0ZEI4.1
#=GS C8V746_EMENI/1-227          AC C8V746.1
#=GS A0A485KPZ9_9STRA/1-254      AC A0A485KPZ9.1
#=GS A0A5N5KTS5_9ROSI/4-131      AC A0A5N5KTS5.1
#=GS A0A093YX52_9PEZI/1-259      AC A0A093YX52.1
#=GS A0A341DCG9_NEOAA/1-227      AC A0A341DCG9.1
#=GS S9VBT2_9TRYP/37-270         AC S9VBT2.1
#=GS A0A2G5CMY1_AQUCA/14-269     AC A0A2G5CMY1.1
#=GS A1CP86_ASPCL/1-259          AC A1CP86.1
#=GS A0A5J5AVK4_9ASTE/1-254      AC A0A5J5AVK4.1
#=GS A0A2J8A1Y6_9CHLO/1-53       AC A0A2J8A1Y6.1
#=GS A0A0D1YV44_9EURO/1-227      AC A0A0D1YV44.1
#=GS A0A2K6A2U8_MANLE/1-227      AC A0A2K6A2U8.1
#=GS G2QUB3_THETT/1-105          AC G2QUB3.1
#=GS A0A287S1B0_HORVV/1-193      AC A0A287S1B0.1
#=GS A0A087WNV6_MOUSE/1-227      AC A0A087WNV6.1
#=GS A0A0J8QLE2_COCIT/1-92       AC A0A0J8QLE2.1
#=GS F6HTU6_VITVI/1-155          AC F6HTU6.1
#=GS V2YPU2_MONRO/1-260          AC V2YPU2.1
#=GS A0A094BLU4_9PEZI/1-227      AC A0A094BLU4.1
#=GS A0A409VKF3_9AGAR/1-227      AC A0A409VKF3.1
#=GS A0A2N6NND8_BEABA/3-214      AC A0A2N6NND8.1
#=GS A0A0B0NRD1_GOSAR/1-255      AC A0A0B0NRD1.1
#=GS A0A226P3Y4_COLVI/1-254      AC A0A226P3Y4.1
#=GS A0A167SJ53_9PEZI/1-260      AC A0A167SJ53.1
#=GS A0A1V6Y4M7_PENNA/1-227      AC A0A1V6Y4M7.1
#=GS G0WEB8_NAUDC/1-227          AC G0WEB8.2
#=GS A0A446Q6Z9_TRITD/1-174      AC A0A446Q6Z9.1
#=GS A0A1B8DWH2_9PEZI/1-227      AC A0A1B8DWH2.1
#=GS I1MY22_SOYBN/1-254          AC I1MY22.2
#=GS A0A1X7RD60_ZYMTR/1-264      AC A0A1X7RD60.1
#=GS A0A2K3NP65_TRIPR/1-253      AC A0A2K3NP65.1
#=GS A0A0K3C805_RHOTO/1-173      AC A0A0K3C805.1
#=GS H2QNI6_PANTR/1-227          AC H2QNI6.2
#=GS A0A367YDQ7_9ASCO/1-226      AC A0A367YDQ7.1
#=GS A0A0J8QL48_COCIT/1-188      AC A0A0J8QL48.1
#=GS A0A6G1B6M6_CROCR/1-227      AC A0A6G1B6M6.1
#=GS A0A287SKF9_HORVV/1-88       AC A0A287SKF9.1
#=GS A0A0E0FWD2_ORYNI/1-254      AC A0A0E0FWD2.1
#=GS A0A2T9ZCW4_9FUNG/1-223      AC A0A2T9ZCW4.1
#=GS A0A6Q2X264_ESOLU/1-254      AC A0A6Q2X264.1
#=GS A0A0V1LT45_9BILA/1-227      AC A0A0V1LT45.1
#=GS A0A653HGS1_9APIC/69-288     AC A0A653HGS1.1
#=GS A0A3Q1GQX5_9TELE/1-227      AC A0A3Q1GQX5.1
#=GS A0A1X7UQD8_AMPQE/1-227      AC A0A1X7UQD8.1
#=GS A0A178ZQM0_9EURO/1-227      AC A0A178ZQM0.1
#=GS A0A1U7LM37_NEOID/1-46       AC A0A1U7LM37.1
#=GS A0A287LYI1_HORVV/1-254      AC A0A287LYI1.1
#=GS A0A2K3QIK4_9HYPO/1-193      AC A0A2K3QIK4.1
#=GS A0A395J220_9HELO/1-227      AC A0A395J220.1
#=GS J3KB90_COCIM/1-259          AC J3KB90.2
#=GS A0A2P6VPQ0_9CHLO/580-670    AC A0A2P6VPQ0.1
#=GS A0A075AB66_9TREM/1-224      AC A0A075AB66.1
#=GS A0A2K3PET0_TRIPR/106-257    AC A0A2K3PET0.1
#=GS A0A0B1PAD3_UNCNE/1-254      AC A0A0B1PAD3.1
#=GS A0A0D1YE75_9EURO/1-263      AC A0A0D1YE75.1
#=GS B8M0U5_TALSN/1-262          AC B8M0U5.1
#=GS Q016I4_OSTTA/1-254          AC Q016I4.1
#=GS XRN2_CRYNJ/1-260            AC P0CL88.1
#=GS A0A0K9PRW9_ZOSMR/1-255      AC A0A0K9PRW9.1
#=GS K8F5I5_9CHLO/1-44           AC K8F5I5.1
#=GS A0A1D6PUT8_MAIZE/1-174      AC A0A1D6PUT8.1
#=GS A0A446UQK8_TRITD/1-255      AC A0A446UQK8.1
#=GS A0A1L8G4C4_XENLA/1-227      AC A0A1L8G4C4.1
#=GS A0A1Y1JCB1_PLAGO/1-279      AC A0A1Y1JCB1.1
#=GS A0A2K5JHP0_COLAP/1-227      AC A0A2K5JHP0.1
#=GS A0A3Q4MHM2_NEOBR/1-96       AC A0A3Q4MHM2.1
#=GS A0A0D0DU40_9AGAM/1-277      AC A0A0D0DU40.1
#=GS A0A0M8NZ12_9EURO/1-260      AC A0A0M8NZ12.1
#=GS A0A2U3XNW1_LEPWE/24-299     AC A0A2U3XNW1.1
#=GS A0A6A2YE78_HIBSY/1-255      AC A0A6A2YE78.1
#=GS A0A059ESL7_9MICR/1-207      AC A0A059ESL7.1
#=GS A0A1V6PTP0_9EURO/1-260      AC A0A1V6PTP0.1
#=GS A0A2U1MZ95_ARTAN/1-254      AC A0A2U1MZ95.1
#=GS A0A0R0HRZ9_SOYBN/1-249      AC A0A0R0HRZ9.1
#=GS A0A671X577_SPAAU/1-254      AC A0A671X577.1
#=GS A0A5N5NQM3_9ROSI/1-173      AC A0A5N5NQM3.1
#=GS A0A369GIE5_9HYPO/1-260      AC A0A369GIE5.1
#=GS A0A2G5EF42_AQUCA/1-252      AC A0A2G5EF42.1
#=GS A0A0C4F067_PUCT1/1-260      AC A0A0C4F067.1
#=GS A0A428PN66_9HYPO/1-260      AC A0A428PN66.1
#=GS A2WXG4_ORYSI/1-254          AC A2WXG4.1
#=GS A0A5B0M105_PUCGR/1-260      AC A0A5B0M105.1
#=GS A0A653BTQ1_CALMS/1-255      AC A0A653BTQ1.1
#=GS W9RCG5_9ROSA/1-251          AC W9RCG5.1
#=GS A0A1U8N0T3_GOSHI/1-254      AC A0A1U8N0T3.1
#=GS A0A0V1BWX9_TRISP/454-680    AC A0A0V1BWX9.1
#=GS A0A0D1CXS6_USTMA/1-227      AC A0A0D1CXS6.1
#=GS I1NIU3_SOYBN/1-255          AC I1NIU3.1
#=GS A0A1W4WK74_AGRPL/1-255      AC A0A1W4WK74.1
#=GS A0A261Y0M0_9FUNG/1-254      AC A0A261Y0M0.1
#=GS A0A287S1C2_HORVV/1-193      AC A0A287S1C2.1
#=GS A0A2T6ZHS5_TUBBO/1-255      AC A0A2T6ZHS5.1
#=GS A0A1B9INU8_9TREE/8-234      AC A0A1B9INU8.1
#=GS A0A1S3G9G9_DIPOR/1-227      AC A0A1S3G9G9.1
#=GS A0A4R5XDM2_9AGAM/1-165      AC A0A4R5XDM2.1
#=GS A0A0E0G6M3_ORYNI/1-232      AC A0A0E0G6M3.1
#=GS X6PEL1_RETFI/19-155         AC X6PEL1.1
#=GS A0A0G4M565_9PEZI/1-228      AC A0A0G4M565.1
#=GS A0A395MJ61_9HYPO/1-260      AC A0A395MJ61.1
#=GS A0A3M7AZ82_HORWE/1-228      AC A0A3M7AZ82.1
#=GS A0A397ZEI9_BRACM/1-253      AC A0A397ZEI9.1
#=GS A0A484CRR9_PERFV/1-227      AC A0A484CRR9.1
#=GS A0A453G1Y2_AEGTS/80-333     AC A0A453G1Y2.1
#=GS A0A086T4Q0_ACRC1/1-260      AC A0A086T4Q0.1
#=GS A0A674DK33_SALTR/1-227      AC A0A674DK33.1
#=GS A0A3M6TXW5_9CNID/1-56       AC A0A3M6TXW5.1
#=GS E2BLM1_HARSA/1-255          AC E2BLM1.1
#=GS A0A0B2UJ03_9MICR/1-257      AC A0A0B2UJ03.1
#=GS A0A1S3IY18_LINUN/1-227      AC A0A1S3IY18.2
#=GS A0A482WS34_LAOST/1-227      AC A0A482WS34.1
#=GS A0A6I8TB89_AEDAE/1-227      AC A0A6I8TB89.1
#=GS A0A261Y0I2_9FUNG/1-216      AC A0A261Y0I2.1
#=GS A0A3Q2V9U2_HAPBU/1-228      AC A0A3Q2V9U2.1
#=GS E4V4U4_ARTGP/1-259          AC E4V4U4.1
#=GS K0S1C0_THAOC/60-298         AC K0S1C0.1
#=GS A0A1B8EPV6_9PEZI/1-259      AC A0A1B8EPV6.1
#=GS A0A3B6MW01_WHEAT/1-261      AC A0A3B6MW01.1
#=GS A0A5N5MMD9_9ROSI/1-261      AC A0A5N5MMD9.1
#=GS A0A3Q4GTN6_NEOBR/1-254      AC A0A3Q4GTN6.1
#=GS A0A2T3AIZ5_9PEZI/1-260      AC A0A2T3AIZ5.1
#=GS A0A0V0SBU6_9BILA/1-255      AC A0A0V0SBU6.1
#=GS B6K9U0_TOXGV/622-882        AC B6K9U0.1
#=GS J3P0Q6_GAET3/1-227          AC J3P0Q6.1
#=GS A0A287S1I8_HORVV/1-255      AC A0A287S1I8.1
#=GS E1ZGU2_CHLVA/1-253          AC E1ZGU2.1
#=GS A0A0D2TSH7_GOSRA/1-254      AC A0A0D2TSH7.1
#=GS A0A1S3USG8_VIGRR/1-254      AC A0A1S3USG8.1
#=GS A0A287LYG7_HORVV/35-288     AC A0A287LYG7.1
#=GS A0A218V8L6_9PASE/1-227      AC A0A218V8L6.1
#=GS A0A0L0T643_ALLM3/1-216      AC A0A0L0T643.1
#=GS A0A2U9R9V1_PICKU/1-254      AC A0A2U9R9V1.1
#=GS A0A1J4L273_9EUKA/1-253      AC A0A1J4L273.1
#=GS J4G5W3_9APHY/16-241         AC J4G5W3.1
#=GS R1CT44_EMIHU/1-109          AC R1CT44.1
#=GS A0A0W4ZWA1_PNEJ7/1-224      AC A0A0W4ZWA1.1
#=GS A0A0Q3MFR8_AMAAE/1-227      AC A0A0Q3MFR8.1
#=GS A0A540MHP4_MALBA/1-254      AC A0A540MHP4.1
#=GS A0A151WRK5_9HYME/1-255      AC A0A151WRK5.1
#=GS A0A665UM07_ECHNA/1-230      AC A0A665UM07.1
#=GS V5AT41_TRYCR/1-236          AC V5AT41.1
#=GS A0A2C6L1V9_9APIC/1-281      AC A0A2C6L1V9.1
#=GS V8NTJ9_OPHHA/104-193        AC V8NTJ9.1
#=GS A0A0L0DMJ1_THETB/13-312     AC A0A0L0DMJ1.1
#=GS R4XEQ8_TAPDE/1-106          AC R4XEQ8.1
#=GS A0A5E4GGG2_PRUDU/1-249      AC A0A5E4GGG2.1
#=GS A0A2R6NM24_9APHY/1-259      AC A0A2R6NM24.1
#=GS A0A4Z1NN16_9PEZI/1-258      AC A0A4Z1NN16.1
#=GS Q75AG4_ASHGO/1-227          AC Q75AG4.1
#=GS A0A409YHJ9_9AGAR/21-280     AC A0A409YHJ9.1
#=GS A0A445F952_GLYSO/1-46       AC A0A445F952.1
#=GS A0A5D2ZB66_GOSMU/1-254      AC A0A5D2ZB66.1
#=GS A0A654GSG1_9CEST/1-88       AC A0A654GSG1.1
#=GS A0A1Z5JMH0_FISSO/20-245     AC A0A1Z5JMH0.1
#=GS A0A2V0PKP3_9CHLO/5-122      AC A0A2V0PKP3.1
#=GS A0A0B7MPF3_9FUNG/1-257      AC A0A0B7MPF3.1
#=GS A0A553QUQ8_9TELE/1-227      AC A0A553QUQ8.1
#=GS A0A5J5CM14_9PERO/1-254      AC A0A5J5CM14.1
#=GS A0A5N6Q0B2_9ASTR/1-254      AC A0A5N6Q0B2.1
#=GS A0A2G5EID1_AQUCA/1-254      AC A0A2G5EID1.1
#=GS A0A0E0G6M4_ORYNI/1-232      AC A0A0E0G6M4.1
#=GS A0A6I8QP13_XENTR/1-254      AC A0A6I8QP13.1
#=GS A0A3Q2UZI3_HAPBU/1-96       AC A0A3Q2UZI3.1
#=GS W5MMS8_LEPOC/1-227          AC W5MMS8.1
#=GS G9P7Z2_HYPAI/7-234          AC G9P7Z2.1
#=GS A0A267FA13_9PLAT/1-227      AC A0A267FA13.1
#=GS A0A3B5QRQ6_XIPMA/1-243      AC A0A3B5QRQ6.1
#=GS G2Y3L6_BOTF4/1-227          AC G2Y3L6.1
#=GS A0A183PRX8_9TREM/57-130     AC A0A183PRX8.1
#=GS K6VAY0_9APIC/1-210          AC K6VAY0.1
#=GS A0A1S9DQI1_ASPOZ/1-257      AC A0A1S9DQI1.1
#=GS E3QMQ8_COLGM/1-260          AC E3QMQ8.1
#=GS A0A4T0VYB0_9PEZI/1-260      AC A0A4T0VYB0.1
#=GS A0A4Y7IV14_PAPSO/52-121     AC A0A4Y7IV14.1
#=GS A0A550CUG8_9AGAR/1-256      AC A0A550CUG8.1
#=GS A0A484CA57_PERFV/1-254      AC A0A484CA57.1
#=GS A0A093I9G8_STRCA/1-202      AC A0A093I9G8.1
#=GS D8UII1_VOLCA/1-104          AC D8UII1.1
#=GS M7Z8K2_TRIUA/1-267          AC M7Z8K2.1
#=GS A0A0D9ZEC4_9ORYZ/1-255      AC A0A0D9ZEC4.1
#=GS A0A0R0FS92_SOYBN/1-254      AC A0A0R0FS92.1
#=GS A0A671WM50_SPAAU/1-227      AC A0A671WM50.1
#=GS B7XJY1_ENTBH/1-204          AC B7XJY1.1
#=GS A0A0L0VTW8_9BASI/1-260      AC A0A0L0VTW8.1
#=GS A0A1Y1JE13_PLAGO/22-161     AC A0A1Y1JE13.1
#=GS A0A084FXZ5_PSEDA/1-228      AC A0A084FXZ5.1
#=GS G0VD45_NAUCC/1-227          AC G0VD45.1
#=GS S9WEA7_CAMFR/1-168          AC S9WEA7.1
#=GS A0A6A6KG91_HEVBR/1-255      AC A0A6A6KG91.1
#=GS A0A1A8VUR8_PLAMA/23-252     AC A0A1A8VUR8.1
#=GS A0A367LM06_9HYPO/1-266      AC A0A367LM06.1
#=GS A1C524_ASPCL/1-227          AC A1C524.1
#=GS A0A087RGH4_APTFO/1-202      AC A0A087RGH4.1
#=GS A0A0V0U8P2_9BILA/1-255      AC A0A0V0U8P2.1
#=GS A0A4T0J2Z4_WALIC/4-221      AC A0A4T0J2Z4.1
#=GS B7FQA4_PHATC/1-152          AC B7FQA4.1
#=GS A0A1U7Z8U9_NELNU/1-254      AC A0A1U7Z8U9.1
#=GS K1W114_TRIAC/1-168          AC K1W114.1
#=GS A0A0G4IZ37_PLABS/1-253      AC A0A0G4IZ37.1
#=GS M3IPA5_CANMX/1-250          AC M3IPA5.1
#=GS A0A4X2KUJ9_VOMUR/1-227      AC A0A4X2KUJ9.1
#=GS A0A2G3DGX1_CAPCH/1-254      AC A0A2G3DGX1.1
#=GS A0A446NWR6_TRITD/1-254      AC A0A446NWR6.1
#=GS L8G8F6_PSED2/1-259          AC L8G8F6.1
#=GS A0A4S4NCM9_9APHY/1-101      AC A0A4S4NCM9.1
#=GS A0A6A5CES6_NAEFO/1-285      AC A0A6A5CES6.1
#=GS A0A663EAB3_AQUCH/1-254      AC A0A663EAB3.1
#=GS A0A4U6U4Q2_SETVI/1-254      AC A0A4U6U4Q2.1
#=GS G4NC70_MAGO7/1-260          AC G4NC70.1
#=GS W6V9J7_ECHGR/1-134          AC W6V9J7.1
#=GS A0A2Y9IM12_ENHLU/1-254      AC A0A2Y9IM12.1
#=GS A0A421DB08_9EURO/1-227      AC A0A421DB08.1
#=GS A0A484EFE5_BRELC/1-255      AC A0A484EFE5.1
#=GS H2XSM0_CIOIN/1-255          AC H2XSM0.1
#=GS A0A2P5DKS7_PARAD/1-105      AC A0A2P5DKS7.1
#=GS A0A0N4SYY4_BRUPA/49-302     AC A0A0N4SYY4.1
#=GS A0A093H8F0_TYTAL/3-233      AC A0A093H8F0.1
#=GS A0A2A2KKM4_9BILA/6-216      AC A0A2A2KKM4.1
#=GS A0A498J8S4_MALDO/1-254      AC A0A498J8S4.1
#=GS Q558Y5_DICDI/1-236          AC Q558Y5.1
#=GS K5W0X3_AGABU/1-259          AC K5W0X3.1
#=GS A0A660KNS2_9ROSI/1-252      AC A0A660KNS2.1
#=GS A0A0L0CUC5_PLAFA/1-272      AC A0A0L0CUC5.1
#=GS L5JX81_PTEAL/127-219        AC L5JX81.1
#=GS A0A0L7KAC7_PLAFX/1-210      AC A0A0L7KAC7.1
#=GS A0A1E3HDQ9_9TREE/22-281     AC A0A1E3HDQ9.1
#=GS A0A183T6Q8_SCHSO/1-257      AC A0A183T6Q8.1
#=GS A0A0D2K296_9CHLO/1-262      AC A0A0D2K296.1
#=GS A0A1X7QZ72_9SACH/1-227      AC A0A1X7QZ72.1
#=GS A0A517KY16_9PEZI/1-258      AC A0A517KY16.1
#=GS W5P8Q5_SHEEP/1-227          AC W5P8Q5.1
#=GS A0A0D2DNU9_9EURO/1-227      AC A0A0D2DNU9.1
#=GS A0A4W6BZ28_LATCA/1-227      AC A0A4W6BZ28.1
#=GS A0A2K2ALL7_POPTR/1-254      AC A0A2K2ALL7.1
#=GS U6KCD0_9EIME/1-158          AC U6KCD0.1
#=GS A0A3P7LSZ5_DIBLA/1-257      AC A0A3P7LSZ5.1
#=GS A0A328DNX1_9ASTE/1-254      AC A0A328DNX1.1
#=GS A0A249Y6U7_9VIRU/1-237      AC A0A249Y6U7.1
#=GS A0A667Y090_9TELE/1-254      AC A0A667Y090.1
#=GS A0A433PLT8_9FUNG/1-46       AC A0A433PLT8.1
#=GS A0A3L6QZ96_PANMI/1-129      AC A0A3L6QZ96.1
#=GS A0A2P6N9N7_9EUKA/1-234      AC A0A2P6N9N7.1
#=GS F0Y1B0_AURAN/182-402        AC F0Y1B0.1
#=GS A2QUD7_ASPNC/1-227          AC A2QUD7.1
#=GS A0A2P5ENK5_TREOI/107-238    AC A0A2P5ENK5.1
#=GS A0A446Q6S0_TRITD/1-46       AC A0A446Q6S0.1
#=GS A0A0W0FL13_9AGAR/66-325     AC A0A0W0FL13.1
#=GS A0A6A2YS11_HIBSY/1-99       AC A0A6A2YS11.1
#=GS A0A1U8PZG4_NELNU/1-248      AC A0A1U8PZG4.1
#=GS A0A1R1XJ91_9FUNG/1-193      AC A0A1R1XJ91.1
#=GS A0A0D2CHQ5_9EURO/1-227      AC A0A0D2CHQ5.1
#=GS A0A0A1U836_ENTIV/1-110      AC A0A0A1U836.1
#=GS A0A286ULT8_9AGAM/1-261      AC A0A286ULT8.1
#=GS A0A504YA35_FASGI/1-224      AC A0A504YA35.1
#=GS A0A3B6FTG6_WHEAT/1-235      AC A0A3B6FTG6.1
#=GS A0A0B7FRI0_THACB/1-259      AC A0A0B7FRI0.1
#=GS A0A267FMI6_9PLAT/1-255      AC A0A267FMI6.1
#=GS A0A1E3BC98_9EURO/1-259      AC A0A1E3BC98.1
#=GS G8ZWC4_TORDC/1-227          AC G8ZWC4.1
#=GS A0A251R8Q6_PRUPE/1-254      AC A0A251R8Q6.1
#=GS K2M149_TRYCR/95-232         AC K2M149.1
#=GS A0A1S8VS20_9FUNG/1-218      AC A0A1S8VS20.1
#=GS A0A2C9VBI4_MANES/1-253      AC A0A2C9VBI4.1
#=GS A0A421JBP9_9ASCO/1-191      AC A0A421JBP9.1
#=GS A0A2R9ATM4_PANPA/1-254      AC A0A2R9ATM4.1
#=GS A0A674EFK0_SALTR/1-227      AC A0A674EFK0.1
#=GS Q0UPQ0_PHANO/1-260          AC Q0UPQ0.2
#=GS A0A094H0Q9_9PEZI/1-259      AC A0A094H0Q9.1
#=GS A0A6H5GKT7_9HEMI/1-252      AC A0A6H5GKT7.1
#=GS A0A674EGM9_SALTR/1-227      AC A0A674EGM9.1
#=GS A0A1G4JCC4_9SACH/1-227      AC A0A1G4JCC4.1
#=GS A0A1U7WD35_NICSY/1-103      AC A0A1U7WD35.1
#=GS A0A091IAE7_CALAN/1-254      AC A0A091IAE7.1
#=GS A0A0D2DV31_9EURO/1-261      AC A0A0D2DV31.1
#=GS A0A1E7FMM7_9STRA/1-175      AC A0A1E7FMM7.1
#=GS A0A3B6ARN9_WHEAT/1-255      AC A0A3B6ARN9.1
#=GS A0A1R1XFH9_9FUNG/1-253      AC A0A1R1XFH9.1
#=GS A0A5M6BW65_9TREE/1-229      AC A0A5M6BW65.1
#=GS A0A550CJ65_9AGAR/1-227      AC A0A550CJ65.1
#=GS A0A3Q7WR48_URSAR/1-227      AC A0A3Q7WR48.1
#=GS A0A2J7ZLY4_9CHLO/1-216      AC A0A2J7ZLY4.1
#=GS A4RZ74_OSTLU/1-227          AC A4RZ74.1
#=GS A0A448YLG1_BRENA/1-226      AC A0A448YLG1.1
#=GS A0A0E9NEC4_SAICN/36-147     AC A0A0E9NEC4.1
#=GS A0A0M9FX96_9TRYP/79-244     AC A0A0M9FX96.1
#=GS A0A2I0XGS9_9ASPA/1-254      AC A0A2I0XGS9.1
#=GS A0A0G4ITK3_PLABS/26-213     AC A0A0G4ITK3.1
#=GS A0A446NWP2_TRITD/1-254      AC A0A446NWP2.1
#=GS R9AQA1_WALI9/9-226          AC R9AQA1.1
#=GS C4R5R1_KOMPG/1-254          AC C4R5R1.1
#=GS A0A1U8B1T8_NELNU/1-253      AC A0A1U8B1T8.1
#=GS A0A3M2TBS3_9EURO/1-259      AC A0A3M2TBS3.1
#=GS A2DLG3_TRIVA/1-251          AC A2DLG3.1
#=GS A0A5N5K9K7_9PEZI/1-260      AC A0A5N5K9K7.1
#=GS A0A1E3HSR3_9TREE/1-229      AC A0A1E3HSR3.1
#=GS J9PAD8_CANLF/1-227          AC J9PAD8.1
#=GS A0A1D6MQ25_MAIZE/1-254      AC A0A1D6MQ25.1
#=GS F2U2K6_SALR5/284-530        AC F2U2K6.1
#=GS A0A4D9AME0_SALSN/4-140      AC A0A4D9AME0.1
#=GS A0A023B566_GRENI/1-252      AC A0A023B566.1
#=GS W7U4G2_9STRA/1-229          AC W7U4G2.1
#=GS A0A1Z5K000_FISSO/400-716    AC A0A1Z5K000.1
#=GS A0A177WX52_BATDL/1-227      AC A0A177WX52.1
#=GS A0A094C1V5_9PEZI/1-259      AC A0A094C1V5.1
#=GS A0A180FWV0_PUCT1/1-88       AC A0A180FWV0.1
#=GS A0A4Q4W8J9_9PEZI/1-227      AC A0A4Q4W8J9.1
#=GS A0A1W4WK62_AGRPL/1-255      AC A0A1W4WK62.1
#=GS A0A314L5A7_NICAT/1-254      AC A0A314L5A7.1
#=GS A0A0S3R3V5_PHAAN/1-254      AC A0A0S3R3V5.1
#=GS A0A2K6PSL8_RHIRO/1-103      AC A0A2K6PSL8.1
#=GS A0A674PMA7_TAKRU/1-227      AC A0A674PMA7.1
#=GS A0A423WRT0_9PEZI/1-227      AC A0A423WRT0.1
#=GS A0A507QS60_MONPU/1-227      AC A0A507QS60.1
#=GS A0A383WG32_TETOB/1-245      AC A0A383WG32.1
#=GS A0A669DWB5_ORENI/1-254      AC A0A669DWB5.1
#=GS A8QCM1_MALGO/1-173          AC A8QCM1.1
#=GS A0A553P1D1_TIGCA/1-268      AC A0A553P1D1.1
#=GS A0A446UQM5_TRITD/1-200      AC A0A446UQM5.1
#=GS A0A673CEE9_9TELE/1-192      AC A0A673CEE9.1
#=GS D6WLE1_TRICA/1-227          AC D6WLE1.2
#=GS S2JEY1_MUCC1/1-254          AC S2JEY1.1
#=GS A0A087WQN7_MOUSE/1-227      AC A0A087WQN7.1
#=GS A0A1D6GFM4_MAIZE/1-255      AC A0A1D6GFM4.1
#=GS A0A1R3HEY5_COCAP/1-222      AC A0A1R3HEY5.1
#=GS U6K0I7_9EIME/98-249         AC U6K0I7.1
#=GS A0A4W3HGW2_CALMI/2-205      AC A0A4W3HGW2.1
#=GS A0A091NPN8_APAVI/1-202      AC A0A091NPN8.1
#=GS A0A0E9NL40_SAICN/1-255      AC A0A0E9NL40.1
#=GS A0A3P4RZN8_GULGU/1-200      AC A0A3P4RZN8.1
#=GS A0A446TB09_TRITD/1-267      AC A0A446TB09.1
#=GS A0A452QNQ0_URSAM/1-212      AC A0A452QNQ0.1
#=GS A0A0S7E080_9EURO/1-259      AC A0A0S7E080.1
#=GS A0A1E5WG57_9POAL/1-104      AC A0A1E5WG57.1
#=GS A2XMV3_ORYSI/1-255          AC A2XMV3.1
#=GS A0A3B6ER42_WHEAT/1-254      AC A0A3B6ER42.1
#=GS A0A446Q6Y7_TRITD/1-243      AC A0A446Q6Y7.1
#=GS A0A1W4WDF9_AGRPL/1-227      AC A0A1W4WDF9.1
#=GS A0A3B6MVH2_WHEAT/1-261      AC A0A3B6MVH2.1
#=GS A0A1X0NZ48_9TRYP/1-254      AC A0A1X0NZ48.1
#=GS A0A0B1TLD6_OESDE/183-239    AC A0A0B1TLD6.1
#=GS A0A024VFX3_PLAFA/1-272      AC A0A024VFX3.1
#=GS A0A0V0RLS4_9BILA/402-628    AC A0A0V0RLS4.1
#=GS A0A1Y1V9F2_9FUNG/1-227      AC A0A1Y1V9F2.1
#=GS Q4QBB9_LEIMA/1-270          AC Q4QBB9.1
#=GS A0A226PSN6_COLVI/1-227      AC A0A226PSN6.1
#=GS W7TB93_9STRA/98-180         AC W7TB93.1
#=GS A0A2H3ZI17_PHODC/1-155      AC A0A2H3ZI17.1
#=GS A0A2A9NZM1_9HYPO/1-260      AC A0A2A9NZM1.1
#=GS A0A177BCN1_9BILA/1-254      AC A0A177BCN1.1
#=GS A0A4W4G5L5_ELEEL/1-227      AC A0A4W4G5L5.1
#=GS A0A2P0VML8_9PHYC/1-195      AC A0A2P0VML8.1
#=GS A0A2H2ITA1_CAEJA/1-193      AC A0A2H2ITA1.1
#=GS A0A446NWM5_TRITD/1-71       AC A0A446NWM5.1
#=GS A0A0L0C3V2_LUCCU/5-230      AC A0A0L0C3V2.1
#=GS A0A0C9M2W9_9FUNG/1-256      AC A0A0C9M2W9.1
#=GS A0A1U7QF62_MESAU/1-254      AC A0A1U7QF62.1
#=GS A0A0V0QDK4_PSEPJ/10-112     AC A0A0V0QDK4.1
#=GS A0A3R7KY45_TRYRA/1-228      AC A0A3R7KY45.1
#=GS A0A3B0K960_DROGU/1-256      AC A0A3B0K960.1
#=GS A0A158QWJ3_NIPBR/1-77       AC A0A158QWJ3.1
#=GS A0A0E0Q606_ORYRU/1-98       AC A0A0E0Q606.1
#=GS A0A2V0NRI1_9CHLO/1-226      AC A0A2V0NRI1.1
#=GS A0A1U8A0R7_NELNU/1-254      AC A0A1U8A0R7.1
#=GS E2AEG9_CAMFO/1-226          AC E2AEG9.1
#=GS A0A0A1UAI0_ENTIV/1-121      AC A0A0A1UAI0.1
#=GS A0A2S6CKX1_9PEZI/1-228      AC A0A2S6CKX1.1
#=GS A0A142CKC6_9VIRU/127-221    AC A0A142CKC6.1
#=GS A0A0V0USX1_9BILA/6-260      AC A0A0V0USX1.1
#=GS A0A1S2Y6C2_CICAR/1-254      AC A0A1S2Y6C2.1
#=GS A0A674PFW5_TAKRU/15-259     AC A0A674PFW5.1
#=GS A0A1Q3BIQ1_CEPFO/1-254      AC A0A1Q3BIQ1.1
#=GS A2E007_TRIVA/105-192        AC A2E007.1
#=GS A0A4W6FTE6_LATCA/1-254      AC A0A4W6FTE6.1
#=GS A2D951_TRIVA/1-114          AC A2D951.1
#=GS A0A427YCA9_9TREE/35-261     AC A0A427YCA9.1
#=GS A0A158QPM4_HAEPC/1-255      AC A0A158QPM4.1
#=GS A5KBJ4_PLAVS/22-171         AC A5KBJ4.1
#=GS A1D245_NEOFI/1-259          AC A1D245.1
#=GS A0A395S2N1_FUSSP/1-260      AC A0A395S2N1.1
#=GS A0A0D2MKZ2_9CHLO/113-161    AC A0A0D2MKZ2.1
#=GS A0A0D2A0X3_EXOME/1-227      AC A0A0D2A0X3.1
#=GS K7HAT7_CAEJA/1-227          AC K7HAT7.1
#=GS A0A1V9ZV87_9STRA/1-254      AC A0A1V9ZV87.1
#=GS A0A446TAR0_TRITD/1-267      AC A0A446TAR0.1
#=GS A0A3R7JYB8_CLOSI/6-164      AC A0A3R7JYB8.1
#=GS A0A446NWR1_TRITD/1-233      AC A0A446NWR1.1
#=GS A0A397GYH8_9EURO/1-259      AC A0A397GYH8.1
#=GS H0VEJ7_CAVPO/1-254          AC H0VEJ7.1
#=GS G7JH90_MEDTR/1-243          AC G7JH90.2
#=GS D8M0K7_BLAHO/1-221          AC D8M0K7.1
#=GS A0A446TIE3_TRITD/1-255      AC A0A446TIE3.1
#=GS A0A667XQA5_9TELE/3-134      AC A0A667XQA5.1
#=GS A4S9F6_OSTLU/1-211          AC A4S9F6.1
#=GS A0A3Q3LRK3_9TELE/1-254      AC A0A3Q3LRK3.1
#=GS A0A1C7MPM0_GRIFR/1-260      AC A0A1C7MPM0.1
#=GS A0A4Z2DVY8_SCHJA/2-194      AC A0A4Z2DVY8.1
#=GS A0A5N6PTI1_9ASTR/1-118      AC A0A5N6PTI1.1
#=GS A0A287S1G2_HORVV/1-193      AC A0A287S1G2.1
#=GS A0A0V0RLS7_9BILA/402-628    AC A0A0V0RLS7.1
#=GS A0A2Y9HXL5_NEOSC/1-254      AC A0A2Y9HXL5.1
#=GS A0A3P9D740_9CICH/1-254      AC A0A3P9D740.1
#=GS E9EHF1_METAQ/1-260          AC E9EHF1.1
#=GS A0A0V1P1S8_9BILA/1-255      AC A0A0V1P1S8.1
#=GS A0A5A8CT50_CAFRO/1-255      AC A0A5A8CT50.1
#=GS F2UEL5_SALR5/1-229          AC F2UEL5.1
#=GS A0A0V1A355_9BILA/39-265     AC A0A0V1A355.1
#=GS A0A166J9X6_9AGAM/173-367    AC A0A166J9X6.1
#=GS A0A1Z5TM59_HORWE/1-228      AC A0A1Z5TM59.1
#=GS A0A0V1AZQ3_TRISP/6-261      AC A0A0V1AZQ3.1
#=GS A0A1S7HCN0_9SACH/1-254      AC A0A1S7HCN0.1
#=GS A0A2P5WX02_GOSBA/1-255      AC A0A2P5WX02.1
#=GS A0A2Y9Q304_DELLE/1-254      AC A0A2Y9Q304.1
#=GS A0A103XT59_CYNCS/3-271      AC A0A103XT59.1
#=GS A0A287S1T1_HORVV/1-193      AC A0A287S1T1.1
#=GS W9VXQ9_9EURO/1-227          AC W9VXQ9.1
#=GS A0A433PT64_9FUNG/1-227      AC A0A433PT64.1
#=GS G8BSB6_TETPH/1-232          AC G8BSB6.1
#=GS A0A0V1BW43_TRISP/454-680    AC A0A0V1BW43.1
#=GS G1PVM9_MYOLU/1-227          AC G1PVM9.1
#=GS A0A0L9VJ43_PHAAN/1-255      AC A0A0L9VJ43.1
#=GS A0A4S2KAP7_9HYME/233-301    AC A0A4S2KAP7.1
#=GS W6LGP5_9TRYP/1-296          AC W6LGP5.1
#=GS A0A392NRP7_9FABA/1-88       AC A0A392NRP7.1
#=GS A0A0M0JCA1_9EUKA/1-241      AC A0A0M0JCA1.1
#=GS C5M1V8_CANTT/1-250          AC C5M1V8.1
#=GS A0A2L2T1A3_9HYPO/1-228      AC A0A2L2T1A3.1
#=GS A0A1Y1IA99_KLENI/1-254      AC A0A1Y1IA99.1
#=GS A0A4U5UYT2_COLLU/1-227      AC A0A4U5UYT2.1
#=GS A0A1D6MQ26_MAIZE/1-254      AC A0A1D6MQ26.1
#=GS A0A2P5ENK5_TREOI/1-106      AC A0A2P5ENK5.1
#=GS N1JDW8_BLUG1/1-227          AC N1JDW8.1
#=GS A0A367KKW2_RHIST/3-184      AC A0A367KKW2.1
#=GS A0A024WWX7_PLAFA/28-160     AC A0A024WWX7.1
#=GS H3GND3_PHYRM/1-240          AC H3GND3.1
#=GS A0A0V0QRU1_PSEPJ/1-254      AC A0A0V0QRU1.1
#=GS A0A401TLU1_CHIPU/1-44       AC A0A401TLU1.1
#=GS A0A0L0SVM6_ALLM3/1-213      AC A0A0L0SVM6.1
#=GS F0XG72_GROCL/1-227          AC F0XG72.1
#=GS A0A0M8MVX9_9HYPO/1-228      AC A0A0M8MVX9.1
#=GS G3GSY8_CRIGR/1-227          AC G3GSY8.1
#=GS A0A5F8H4P8_MONDO/1-254      AC A0A5F8H4P8.1
#=GS A0A2P8XHJ3_BLAGE/116-232    AC A0A2P8XHJ3.1
#=GS A0A444FCP7_ENSVE/158-193    AC A0A444FCP7.1
#=GS A0A4U1F719_MONMO/1-199      AC A0A4U1F719.1
#=GS A0A446NWQ3_TRITD/1-254      AC A0A446NWQ3.1
#=GS A0A0C3AXI3_PILCF/1-117      AC A0A0C3AXI3.1
#=GS A0A287S1L7_HORVV/1-193      AC A0A287S1L7.1
#=GS A0A075AS68_ROZAC/1-88       AC A0A075AS68.1
#=GS A0A1D6GFN4_MAIZE/1-144      AC A0A1D6GFN4.1
#=GS A0A2I2FNX3_9EURO/1-227      AC A0A2I2FNX3.1
#=GS A0A074S0Z7_9AGAM/1-227      AC A0A074S0Z7.1
#=GS A0A4Y9ZH77_9AGAM/1-167      AC A0A4Y9ZH77.1
#=GS A0A1J1ITU8_9DIPT/1-256      AC A0A1J1ITU8.1
#=GS A0A2P5XYG1_GOSBA/1-254      AC A0A2P5XYG1.1
#=GS XRN2_ASHGO/1-254            AC Q74ZA0.4
#=GS A0A4C1TTD8_EUMVA/1-103      AC A0A4C1TTD8.1
#=GS A0A2J6L5T3_LACSA/1-254      AC A0A2J6L5T3.1
#=GS S8B8U2_DACHA/1-254          AC S8B8U2.1
#=GS A0A2A4JDB6_HELVI/1-227      AC A0A2A4JDB6.1
#=GS C6LT28_GIAIB/1-264          AC C6LT28.1
#=GS A0A194RGT2_PAPMA/1-255      AC A0A194RGT2.1
#=GS A0A183EG75_9BILA/137-202    AC A0A183EG75.1
#=GS A0A1J5WMM0_9MICR/116-225    AC A0A1J5WMM0.1
#=GS A0A4U6UDU7_SETVI/1-254      AC A0A4U6UDU7.1
#=GS A0A5C7IVW5_9ROSI/1-74       AC A0A5C7IVW5.1
#=GS A0A1S3UST5_VIGRR/1-254      AC A0A1S3UST5.1
#=GS A0A0V0ZDX2_9BILA/6-260      AC A0A0V0ZDX2.1
#=GS A0A0L9TNI8_PHAAN/1-233      AC A0A0L9TNI8.1
#=GS A0A409YLE1_9AGAR/1-257      AC A0A409YLE1.1
#=GS A0A178EPI2_TRIRU/1-259      AC A0A178EPI2.1
#=GS A0A0F0IHE2_ASPPU/1-257      AC A0A0F0IHE2.1
#=GS A0A182Y764_ANOST/1-255      AC A0A182Y764.1
#=GS A0A0E0N5N4_ORYRU/1-254      AC A0A0E0N5N4.1
#=GS A0A0L7KWG2_9NEOP/66-164     AC A0A0L7KWG2.1
#=GS A0A287LYH7_HORVV/30-283     AC A0A287LYH7.1
#=GS A0A5B6X2W0_9ROSI/1-255      AC A0A5B6X2W0.1
#=GS R7QEZ6_CHOCR/1-219          AC R7QEZ6.1
#=GS A0A5N5NCB1_9ROSI/22-128     AC A0A5N5NCB1.1
#=GS V5BDQ7_TRYCR/1-243          AC V5BDQ7.1
#=GS G8DHA4_9PHYC/1-204          AC G8DHA4.1
#=GS A0A422Q9P7_9TRYP/1-250      AC A0A422Q9P7.1
#=GS I2H761_TETBL/1-229          AC I2H761.1
#=GS A0A238FHR8_9BASI/1-260      AC A0A238FHR8.1
#=GS C4M8Y2_ENTHI/1-109          AC C4M8Y2.1
#=GS A0A0J7K6X8_LASNI/1-106      AC A0A0J7K6X8.1
#=GS A0A6I8R6P5_XENTR/1-227      AC A0A6I8R6P5.1
#=GS A0A1E4S6T1_CYBJN/1-139      AC A0A1E4S6T1.1
#=GS A0A5A8CBE2_CAFRO/1-226      AC A0A5A8CBE2.1
#=GS F7DU20_XENTR/1-227          AC F7DU20.3
#=GS F4QE37_CAVFA/202-424        AC F4QE37.1
#=GS A0A1X6P210_PORUM/1-240      AC A0A1X6P210.1
#=GS K2MY70_TRYCR/1-235          AC K2MY70.1
#=GS A0A5F8GCR9_MONDO/1-227      AC A0A5F8GCR9.1
#=GS A0A2R6QXN9_ACTCC/1-174      AC A0A2R6QXN9.1
#=GS A0A3P6SUJ2_CYLGO/1-46       AC A0A3P6SUJ2.1
#=GS A0A0L6UG65_9BASI/13-251     AC A0A0L6UG65.1
#=GS D3AY96_POLPP/1-145          AC D3AY96.1
#=GS A0A287S1N7_HORVV/1-193      AC A0A287S1N7.1
#=GS A0A0V0USQ5_9BILA/6-260      AC A0A0V0USQ5.1
#=GS A0A674PQC0_TAKRU/15-259     AC A0A674PQC0.1
#=GS A0A395J3Z2_9HELO/2-77       AC A0A395J3Z2.1
#=GS W2RZ58_9EURO/1-260          AC W2RZ58.1
#=GS A0A439D6C3_9PEZI/1-287      AC A0A439D6C3.1
#=GS A0A5D2UYL0_GOSMU/1-254      AC A0A5D2UYL0.1
#=GS A0A553Q3H4_9TELE/1-236      AC A0A553Q3H4.1
#=GS A0A3Q3FYV5_9LABR/10-137     AC A0A3Q3FYV5.1
#=GS A0A453M1Q4_AEGTS/3-235      AC A0A453M1Q4.1
#=GS A0A0F9WQP2_9MICR/1-231      AC A0A0F9WQP2.1
#=GS A0A6Q2YRR6_ESOLU/1-227      AC A0A6Q2YRR6.1
#=GS A0A4W5PXS4_9TELE/2-139      AC A0A4W5PXS4.1
#=GS B0XA08_CULQU/111-152        AC B0XA08.1
#=GS F7VPD4_SORMK/1-251          AC F7VPD4.1
#=GS A0A3Q7TAZ4_VULVU/1-227      AC A0A3Q7TAZ4.1
#=GS C0NTH6_AJECG/1-227          AC C0NTH6.1
#=GS A0A5F7Z8G3_MACMU/110-240    AC A0A5F7Z8G3.1
#=GS G3JPV5_CORMM/1-260          AC G3JPV5.1
#=GS Q7PQ65_ANOGA/1-227          AC Q7PQ65.5
#=GS K4A5C6_SETIT/1-255          AC K4A5C6.1
#=GS A0A437A291_9PEZI/1-254      AC A0A437A291.1
#=GS W6LCY1_9TRYP/61-171         AC W6LCY1.1
#=GS A0A0R3T1Y8_RODNA/1-257      AC A0A0R3T1Y8.1
#=GS A0A077ZP35_STYLE/1-231      AC A0A077ZP35.1
#=GS A0A1D6Y7E9_9VIRU/116-189    AC A0A1D6Y7E9.1
#=GS A0A421JSI5_9ASCO/476-701    AC A0A421JSI5.1
#=GS A0A2K6LM35_RHIBE/1-254      AC A0A2K6LM35.1
#=GS A0A061HH87_BLUGR/1-227      AC A0A061HH87.1
#=GS H2MCL0_ORYLA/1-227          AC H2MCL0.2
#=GS A0A4V6AP50_COLLU/1-237      AC A0A4V6AP50.1
#=GS A0A2P5W966_GOSBA/1-241      AC A0A2P5W966.1
#=GS K1WVE2_TRIAC/1-199          AC K1WVE2.1
#=GS A0A1Y3AYG2_EURMA/1-243      AC A0A1Y3AYG2.1
#=GS A0A4S4DAF4_CAMSI/149-376    AC A0A4S4DAF4.1
#=GS A0A316W2C0_9BASI/1-158      AC A0A316W2C0.1
#=GS A0A3P7NCK7_DIBLA/1-76       AC A0A3P7NCK7.1
#=GS A0A0D2WRW6_CAPO3/1-239      AC A0A0D2WRW6.1
#=GS A0A423WH31_9PEZI/1-227      AC A0A423WH31.1
#=GS A0A2H9TJJ2_9FUNG/51-142     AC A0A2H9TJJ2.1
#=GS R1CT44_EMIHU/107-184        AC R1CT44.1
#=GS B6K211_SCHJY/1-255          AC B6K211.1
#=GS A0A2I4GWU9_JUGRE/1-248      AC A0A2I4GWU9.1
#=GS A0A6P9E9X8_JUGRE/5-114      AC A0A6P9E9X8.1
#=GS A0A420XYL1_9PEZI/1-227      AC A0A420XYL1.1
#=GS A0A5N5KH63_9ROSI/1-252      AC A0A5N5KH63.1
#=GS A0A392NHI0_9FABA/1-62       AC A0A392NHI0.1
#=GS D3BMB2_POLPP/1-306          AC D3BMB2.1
#=GS A0A507CE40_9FUNG/1-253      AC A0A507CE40.1
#=GS A0A0L1KQ77_9EUGL/1-231      AC A0A0L1KQ77.1
#=GS A0A164UEG2_9CRUS/1-222      AC A0A164UEG2.1
#=GS A0A5K4EPZ7_SCHMA/1-187      AC A0A5K4EPZ7.1
#=GS A0A5B6WY25_9ROSI/1-197      AC A0A5B6WY25.1
#=GS A0A2J8A1E8_9CHLO/1-193      AC A0A2J8A1E8.1
#=GS A0A653BTP8_CALMS/1-255      AC A0A653BTP8.1
#=GS A0A3P9P999_POERE/1-254      AC A0A3P9P999.1
#=GS V8NLT7_OPHHA/254-315        AC V8NLT7.1
#=GS A0A4Q9Q7B3_9APHY/1-227      AC A0A4Q9Q7B3.1
#=GS A0A1D6GFN8_MAIZE/1-255      AC A0A1D6GFN8.1
#=GS A0A150GP34_GONPE/92-199     AC A0A150GP34.1
#=GS A0A0B1P181_UNCNE/1-227      AC A0A0B1P181.1
#=GS A0A2Z6Q956_9GLOM/1-223      AC A0A2Z6Q956.1
#=GS A0A2H3ZI25_PHODC/4-75       AC A0A2H3ZI25.1
#=GS A0A1V6PNX3_PENDC/1-260      AC A0A1V6PNX3.1
#=GS A0A1R3IKY2_9ROSI/1-246      AC A0A1R3IKY2.1
#=GS A0A5J4NUB9_9TREM/1-257      AC A0A5J4NUB9.1
#=GS A0A2T7D470_9POAL/1-254      AC A0A2T7D470.1
#=GS A0A4V4LU03_9BASI/1-264      AC A0A4V4LU03.1
#=GS A0A1S4AAR2_TOBAC/1-84       AC A0A1S4AAR2.1
#=GS A0A484FYR6_COLOR/1-260      AC A0A484FYR6.1
#=GS A0A667YQ49_9TELE/1-254      AC A0A667YQ49.1
#=GS A0A0D1Y3G1_EXOME/1-257      AC A0A0D1Y3G1.1
#=GS A0A3B3H643_ORYLA/1-227      AC A0A3B3H643.1
#=GS A0A3P8SB29_AMPPE/1-227      AC A0A3P8SB29.1
#=GS A0A4Y7L238_PAPSO/1-67       AC A0A4Y7L238.1
#=GS V9SGR6_9VIRU/22-140         AC V9SGR6.1
#=GS A0A6D2JET1_9BRAS/1-255      AC A0A6D2JET1.1
#=GS A0A1Y2EI86_9PEZI/1-227      AC A0A1Y2EI86.1
#=GS A0A5A7PPP6_STRAF/1-255      AC A0A5A7PPP6.1
#=GS A0A5P1FTY8_ASPOF/1-248      AC A0A5P1FTY8.1
#=GS A0A179TUW9_AJEDR/1-149      AC A0A179TUW9.1
#=GS E1C8R7_CHICK/1-227          AC E1C8R7.2
#=GS A0A5N6RBM3_9ROSI/1-254      AC A0A5N6RBM3.1
#=GS XRN2_CANGA/1-254            AC Q6FKN6.3
#=GS A0A1D6JAP8_MAIZE/1-231      AC A0A1D6JAP8.1
#=GS G0S7R0_CHATD/1-227          AC G0S7R0.1
#=GS A0A1E1KRL0_9HELO/1-227      AC A0A1E1KRL0.1
#=GS A0A4W4GA43_ELEEL/1-227      AC A0A4W4GA43.1
#=GS L8IYC4_9CETA/1-227          AC L8IYC4.1
#=GS M9PEY6_DROME/1-256          AC M9PEY6.1
#=GS A0A2P6PZ35_ROSCH/1-253      AC A0A2P6PZ35.1
#=GS A0A059B6A6_EUCGR/1-255      AC A0A059B6A6.1
#=GS B3MPT4_DROAN/1-226          AC B3MPT4.2
#=GS A0A4W3JP88_CALMI/1-254      AC A0A4W3JP88.1
#=GS A0A337SCP6_FELCA/1-254      AC A0A337SCP6.1
#=GS A0A421GU26_9STRA/1-240      AC A0A421GU26.1
#=GS A0A5F4CSI4_CANLF/162-224    AC A0A5F4CSI4.1
#=GS W9VPD3_9EURO/1-265          AC W9VPD3.1
#=GS A0A0B1T0A9_OESDE/1-88       AC A0A0B1T0A9.1
#=GS J3N667_ORYBR/1-185          AC J3N667.1
#=GS A0A0V1DI15_TRIBR/413-617    AC A0A0V1DI15.1
#=GS A0A024W6F7_PLAFA/45-259     AC A0A024W6F7.1
#=GS A0A1S4DKE9_TOBAC/1-254      AC A0A1S4DKE9.1
#=GS A0A0G4MT81_9PEZI/1-260      AC A0A0G4MT81.1
#=GS A0A653DS92_CALMS/1-56       AC A0A653DS92.1
#=GS A0A2S4VF23_9BASI/93-254     AC A0A2S4VF23.1
#=GS A0A0F8B6P3_CERFI/1-228      AC A0A0F8B6P3.1
#=GS G0PMR8_CAEBE/1-227          AC G0PMR8.1
#=GS I1BWL2_RHIO9/479-703        AC I1BWL2.1
#=GS A0A1D6PUT7_MAIZE/1-200      AC A0A1D6PUT7.1
#=GS A0A0P1BND4_9BASI/1-227      AC A0A0P1BND4.1
#=GS J3PD63_GAET3/1-260          AC J3PD63.1
#=GS A0A445I2V0_GLYSO/1-114      AC A0A445I2V0.1
#=GS J7S0V4_KAZNA/1-228          AC J7S0V4.1
#=GS Q38AY4_TRYB2/1-250          AC Q38AY4.1
#=GS A0A1F7ZZG7_9EURO/1-227      AC A0A1F7ZZG7.1
#=GS A0A2U1P612_ARTAN/1-250      AC A0A2U1P612.1
#=GS A0A2I2L5K3_9PHYC/1-124      AC A0A2I2L5K3.1
#=GS A0A397SL48_9GLOM/1-191      AC A0A397SL48.1
#=GS A0A453G1Q3_AEGTS/1-126      AC A0A453G1Q3.1
#=GS H3AIE6_LATCH/14-255         AC H3AIE6.1
#=GS A0A2H3Z671_PHODC/1-254      AC A0A2H3Z671.1
#=GS A0A1S3DIT5_DIACI/20-218     AC A0A1S3DIT5.2
#=GS F4NZ30_BATDJ/1-219          AC F4NZ30.1
#=GS A0A1Y2W4B5_9PEZI/1-260      AC A0A1Y2W4B5.1
#=GS A0A091SF34_NESNO/3-233      AC A0A091SF34.1
#=GS A0A2I4C096_9TELE/1-254      AC A0A2I4C096.1
#=GS A0A485NM96_LYNPA/1-254      AC A0A485NM96.1
#=GS A0A0D0E497_9AGAM/1-88       AC A0A0D0E497.1
#=GS A0A4Z2IH85_9TELE/1-227      AC A0A4Z2IH85.1
#=GS A0A0V0USP8_9BILA/6-260      AC A0A0V0USP8.1
#=GS A0A674C043_SALTR/1-254      AC A0A674C043.1
#=GS A0A2K3NZR6_TRIPR/8-181      AC A0A2K3NZR6.1
#=GS A0A059LID8_9CHLO/5-131      AC A0A059LID8.1
#=GS A0A401S609_CHIPU/3-231      AC A0A401S609.1
#=GS H2SH04_TAKRU/1-227          AC H2SH04.3
#=GS F7APA3_MACMU/1-227          AC F7APA3.2
#=GS A0A0D2J1S8_9EURO/1-227      AC A0A0D2J1S8.1
#=GS A0A044VFR5_ONCVO/3-229      AC A0A044VFR5.1
#=GS A0A2G5CKH8_AQUCA/1-255      AC A0A2G5CKH8.1
#=GS U6JV20_9EIME/1-200          AC U6JV20.1
#=GS A0A671ENB3_RHIFE/133-180    AC A0A671ENB3.1
#=GS B7G7J6_PHATC/1-149          AC B7G7J6.1
#=GS A0A1Q3DX79_LENED/1-260      AC A0A1Q3DX79.1
#=GS A0A060SHJ3_PYCCI/1-260      AC A0A060SHJ3.1
#=GS A0A3Q1MSZ5_BOVIN/1-200      AC A0A3Q1MSZ5.1
#=GS A0A4W6BRF0_LATCA/1-192      AC A0A4W6BRF0.1
#=GS A0A2P6Q0H7_ROSCH/6-69       AC A0A2P6Q0H7.1
#=GS A0A183M274_9TREM/2-118      AC A0A183M274.1
#=GS A0A452I8V6_9SAUR/1-227      AC A0A452I8V6.1
#=GS A0A087Y8E7_POEFO/1-227      AC A0A087Y8E7.2
#=GS A0A5N7AZA0_9EURO/1-257      AC A0A5N7AZA0.1
#=GS EXON_IIV6/1-258             AC Q9QSK5.1
#=GS A0A1R1PHT7_ZANCU/1-264      AC A0A1R1PHT7.1
#=GS A0A2A9M3F0_9APIC/1-290      AC A0A2A9M3F0.1
#=GS G2YL90_BOTF4/1-254          AC G2YL90.1
#=GS A0A4S2LEP8_OPIFE/1-224      AC A0A4S2LEP8.1
#=GS A0A1Y2ESL7_9BASI/1-262      AC A0A1Y2ESL7.1
#=GS G5BJL6_HETGA/1-176          AC G5BJL6.1
#=GS F6UH56_HORSE/1-254          AC F6UH56.3
#=GS G0QJS6_ICHMG/1-248          AC G0QJS6.1
#=GS A0A0E0AHH3_9ORYZ/1-101      AC A0A0E0AHH3.1
#=GS A0A0V1BW80_TRISP/454-680    AC A0A0V1BW80.1
#=GS A4HFL7_LEIBR/1-238          AC A4HFL7.2
#=GS A0A287SKM0_HORVV/5-72       AC A0A287SKM0.1
#=GS A0A672V5T8_STRHB/1-227      AC A0A672V5T8.1
#=GS A0A067H1N2_CITSI/1-254      AC A0A067H1N2.1
#=GS A0A1X0NSR6_9TRYP/189-366    AC A0A1X0NSR6.1
#=GS Q2UA72_ASPOR/1-227          AC Q2UA72.1
#=GS A0A6I8QRE6_XENTR/1-254      AC A0A6I8QRE6.1
#=GS A0A4D8Z937_SALSN/1-250      AC A0A4D8Z937.1
#=GS D8UII1_VOLCA/104-249        AC D8UII1.1
#=GS A0A091WJG0_OPIHO/2-230      AC A0A091WJG0.1
#=GS A0A671WK51_SPAAU/1-227      AC A0A671WK51.1
#=GS A0A3Q3F2Y8_9LABR/1-254      AC A0A3Q3F2Y8.1
#=GS A0A061JAQ9_TRYRA/1-233      AC A0A061JAQ9.1
#=GS A0A507F7B1_9FUNG/1-233      AC A0A507F7B1.1
#=GS B4I753_DROSE/1-226          AC B4I753.1
#=GS A0A094D3W9_9PEZI/1-259      AC A0A094D3W9.1
#=GS U1GP14_ENDPU/1-227          AC U1GP14.1
#=GS A0A2U1Q2B6_ARTAN/1-152      AC A0A2U1Q2B6.1
#=GS A0A180GXA4_PUCT1/1-227      AC A0A180GXA4.1
#=GS A0A673C803_9TELE/1-227      AC A0A673C803.1
#=GS A0A1U8PZH5_NELNU/1-248      AC A0A1U8PZH5.1
#=GS A0A446NWL7_TRITD/1-254      AC A0A446NWL7.1
#=GS A0A087XFF6_POEFO/1-254      AC A0A087XFF6.2
#=GS A0A1V8TTG5_9PEZI/1-262      AC A0A1V8TTG5.1
#=GS A0A4Q2DD11_9AGAR/1-227      AC A0A4Q2DD11.1
#=GS A0A2K5NLE1_CERAT/1-227      AC A0A2K5NLE1.1
#=GS A0A5J5D2B5_9PERO/1-227      AC A0A5J5D2B5.1
#=GS T1LG03_TRIUA/1-255          AC T1LG03.1
#=GS A0A1V1SW03_9FUNG/1-227      AC A0A1V1SW03.1
#=GS J4U342_SACK1/1-227          AC J4U342.1
#=GS A0A0R3ST04_HYMDI/1-257      AC A0A0R3ST04.1
#=GS A0A2K3QII8_9HYPO/1-260      AC A0A2K3QII8.1
#=GS A0A0L0DI72_THETB/1-245      AC A0A0L0DI72.1
#=GS W7HPT2_9PEZI/1-254          AC W7HPT2.1
#=GS A0A4Q4Y0J2_9PEZI/1-227      AC A0A4Q4Y0J2.1
#=GS A0A1X7S104_ZYMTR/1-228      AC A0A1X7S104.1
#=GS A0A498NE07_LABRO/1-227      AC A0A498NE07.1
#=GS A0A660KLX9_9ROSI/1-159      AC A0A660KLX9.1
#=GS A4H4J2_LEIBR/1-228          AC A4H4J2.1
#=GS A0A0V1H5Y9_9BILA/10-264     AC A0A0V1H5Y9.1
#=GS A0A453LG73_AEGTS/1-269      AC A0A453LG73.1
#=GS D7MS35_ARALL/1-255          AC D7MS35.1
#=GS B8BJ72_ORYSI/1-255          AC B8BJ72.1
#=GS A0A446TIE9_TRITD/1-255      AC A0A446TIE9.1
#=GS A0A2G2VHX4_CAPBA/1-254      AC A0A2G2VHX4.1
#=GS G1XLW3_ARTOA/46-299         AC G1XLW3.1
#=GS A0A2A3ER15_APICC/1-255      AC A0A2A3ER15.1
#=GS A0A0B7FAP6_THACB/1-227      AC A0A0B7FAP6.1
#=GS A0A2P5YFV5_GOSBA/1-229      AC A0A2P5YFV5.1
#=GS A0A340X5K6_LIPVE/1-178      AC A0A340X5K6.1
#=GS A0A5J9UGH7_9POAL/86-339     AC A0A5J9UGH7.1
#=GS A0A1J4JI93_9EUKA/1-210      AC A0A1J4JI93.1
#=GS A0A383UV16_BLUGH/1-227      AC A0A383UV16.1
#=GS X6LH99_RETFI/1-40           AC X6LH99.1
#=GS A0A093EQN0_TAUER/4-233      AC A0A093EQN0.1
#=GS A0A662XPQ0_9STRA/1-193      AC A0A662XPQ0.1
#=GS A0A151TXT7_CAJCA/1-249      AC A0A151TXT7.1
#=GS A0A1U8PBU7_GOSHI/1-254      AC A0A1U8PBU7.1
#=GS A0A1Y2MGB6_EPING/1-260      AC A0A1Y2MGB6.1
#=GS W4G3K4_9STRA/1-234          AC W4G3K4.1
#=GS F2SNK9_TRIRC/1-227          AC F2SNK9.1
#=GS A0A4E0RJH1_FASHE/1-257      AC A0A4E0RJH1.1
#=GS A0A0D2TW25_GOSRA/1-254      AC A0A0D2TW25.1
#=GS A0A1F5LW22_9EURO/1-227      AC A0A1F5LW22.1
#=GS D8TGU8_VOLCA/109-199        AC D8TGU8.1
#=GS A0A250X8M9_9CHLO/124-377    AC A0A250X8M9.1
#=GS A0A099ZYY1_CHAVO/1-202      AC A0A099ZYY1.1
#=GS A0A674DJR4_SALTR/1-227      AC A0A674DJR4.1
#=GS A0A3B6BZA0_WHEAT/3-134      AC A0A3B6BZA0.1
#=GS A0A4Z2GM52_9TELE/1-254      AC A0A4Z2GM52.1
#=GS A0A5N6PW14_9ASTR/1-230      AC A0A5N6PW14.1
#=GS A0A068S6H1_9FUNG/1-254      AC A0A068S6H1.1
#=GS A0A060WVA8_ONCMY/1-254      AC A0A060WVA8.1
#=GS A0A553HN94_9PEZI/1-260      AC A0A553HN94.1
#=GS A0A142CKC6_9VIRU/11-129     AC A0A142CKC6.1
#=GS A0A4Q9LNZ2_9MICR/1-269      AC A0A4Q9LNZ2.1
#=GS A0A175Y9F6_DAUCS/1-73       AC A0A175Y9F6.1
#=GS A0A397GV43_9EURO/1-227      AC A0A397GV43.1
#=GS A0A391P223_9EUKA/1-47       AC A0A391P223.1
#=GS A0A653DCG9_CALMS/1-91       AC A0A653DCG9.1
#=GS L2G1Z4_COLFN/1-228          AC L2G1Z4.1
#=GS A0A1J9PJI1_9EURO/1-259      AC A0A1J9PJI1.1
#=GS W9XEI4_9EURO/1-227          AC W9XEI4.1
#=GS A0A5E4EB07_PRUDU/1-255      AC A0A5E4EB07.1
#=GS Q28E00_XENTR/1-254          AC Q28E00.1
#=GS F4QEC0_CAVFA/1-259          AC F4QEC0.1
#=GS A0A1D6MQ23_MAIZE/1-254      AC A0A1D6MQ23.1
#=GS A0A3L6RIK0_PANMI/1-254      AC A0A3L6RIK0.1
#=GS A0A287S1H6_HORVV/1-158      AC A0A287S1H6.1
#=GS K8F4V0_9CHLO/1-257          AC K8F4V0.1
#=GS F1SKG4_PIG/1-227            AC F1SKG4.3
#=GS A0A392SJB9_9FABA/1-26       AC A0A392SJB9.1
#=GS A0A3B6EMZ0_WHEAT/1-233      AC A0A3B6EMZ0.1
#=GS A0A4U0UNF3_9PEZI/1-263      AC A0A4U0UNF3.1
#=GS A0A0R0GG90_SOYBN/1-254      AC A0A0R0GG90.1
#=GS A0A5F9DCS7_RABIT/21-174     AC A0A5F9DCS7.1
#=GS A0A0D3HIF2_9ORYZ/1-194      AC A0A0D3HIF2.1
#=GS U6MNF4_9EIME/86-130         AC U6MNF4.1
#=GS C9SFV6_VERA1/1-228          AC C9SFV6.1
#=GS A0A4V1IR82_9FUNG/61-167     AC A0A4V1IR82.1
#=GS A0A2P6Q4G9_ROSCH/1-254      AC A0A2P6Q4G9.1
#=GS V4T9Q7_9ROSI/1-46           AC V4T9Q7.1
#=GS A0A444FCP7_ENSVE/18-165     AC A0A444FCP7.1
#=GS A0A4W6FTE8_LATCA/1-254      AC A0A4W6FTE8.1
#=GS A0A287EK94_HORVV/76-154     AC A0A287EK94.1
#=GS A0A444UMJ1_ACIRT/1-221      AC A0A444UMJ1.1
#=GS A0A0C9YA35_9AGAM/1-62       AC A0A0C9YA35.1
#=GS A0A151R7Y4_CAJCA/1-272      AC A0A151R7Y4.1
#=GS A0A2K5JHS5_COLAP/1-227      AC A0A2K5JHS5.1
#=GS A0A5N6JYD6_9HELO/1-254      AC A0A5N6JYD6.1
#=GS R0IBX6_9BRAS/1-255          AC R0IBX6.1
#=GS A0A391P5R0_9EUKA/1-96       AC A0A391P5R0.1
#=GS G8BWV7_TETPH/1-228          AC G8BWV7.1
#=GS A0A1Y1UMP7_9TREE/1-260      AC A0A1Y1UMP7.1
#=GS U6GHL0_EIMAC/18-372         AC U6GHL0.1
#=GS A0A068U8X2_COFCA/1-184      AC A0A068U8X2.1
#=GS G2Q9H6_MYCTT/1-192          AC G2Q9H6.1
#=GS H2URP0_TAKRU/15-259         AC H2URP0.3
#=GS A0A665UMB4_ECHNA/1-230      AC A0A665UMB4.1
#=GS I1MC52_SOYBN/1-254          AC I1MC52.1
#=GS S9X4Q7_SCHCR/1-256          AC S9X4Q7.1
#=GS S7Z5A6_PENO1/1-260          AC S7Z5A6.1
#=GS A0A251NQ86_PRUPE/20-268     AC A0A251NQ86.1
#=GS A0A0V1H5S0_9BILA/10-264     AC A0A0V1H5S0.1
#=GS A0A151ZBH7_9MYCE/1-224      AC A0A151ZBH7.1
#=GS A0A1S3R3N7_SALSA/1-227      AC A0A1S3R3N7.1
#=GS A0A4W5R368_9TELE/1-254      AC A0A4W5R368.1
#=GS A0A225WL50_9STRA/1-255      AC A0A225WL50.1
#=GS A0A5D2SXJ4_GOSMU/1-255      AC A0A5D2SXJ4.1
#=GS A0A4Z2DVX1_SCHJA/1-218      AC A0A4Z2DVX1.1
#=GS A0A428QJN0_9HYPO/1-260      AC A0A428QJN0.1
#=GS A0A453LGA4_AEGTS/1-269      AC A0A453LGA4.1
#=GS A0A077ZGF5_TRITR/129-213    AC A0A077ZGF5.1
#=GS A0A0S6XWQ5_9FUNG/1-256      AC A0A0S6XWQ5.1
#=GS A0A251U9V7_HELAN/1-226      AC A0A251U9V7.1
#=GS A0A4S3JML0_9EURO/1-227      AC A0A4S3JML0.1
#=GS A0A2S4VUL4_9BASI/1-260      AC A0A2S4VUL4.1
#=GS F0ZL32_DICPU/1-171          AC F0ZL32.1
#=GS D2W0C3_NAEGR/84-303         AC D2W0C3.1
#=GS D7FME5_ECTSI/1-229          AC D7FME5.1
#=GS A0A2R5GPB9_9STRA/1-250      AC A0A2R5GPB9.1
#=GS A0A2K1Y0I1_POPTR/1-255      AC A0A2K1Y0I1.1
#=GS A0A4W4G5M8_ELEEL/9-149      AC A0A4W4G5M8.1
#=GS A0A2H5NS13_CITUN/1-254      AC A0A2H5NS13.1
#=GS YR528_MIMIV/2-128           AC Q5UQ94.1
#=GS A0A2T4AS54_TRIHA/1-260      AC A0A2T4AS54.1
#=GS A0A2R8FDC5_9VIRU/1-88       AC A0A2R8FDC5.1
#=GS A0A4P9ZQS2_9FUNG/1-249      AC A0A4P9ZQS2.1
#=GS A0A0V1LRE5_9BILA/1-255      AC A0A0V1LRE5.1
#=GS A0A3P8X5A2_CYNSE/1-227      AC A0A3P8X5A2.1
#=GS A0A4W6FTE1_LATCA/1-254      AC A0A4W6FTE1.1
#=GS A0A1Q2YM50_9ASCO/1-191      AC A0A1Q2YM50.1
#=GS A0A397TZI1_9GLOM/1-241      AC A0A397TZI1.1
#=GS A0A1Y2BLI7_9TREE/1-141      AC A0A1Y2BLI7.1
#=GS U5GE84_POPTR/1-255          AC U5GE84.1
#=GS A0A443I8C5_BYSSP/1-227      AC A0A443I8C5.1
#=GS A0A328DBF2_9ASTE/1-248      AC A0A328DBF2.1
#=GS A0A0D0AFN5_9AGAM/1-126      AC A0A0D0AFN5.1
#=GS W7LZ67_GIBM7/1-193          AC W7LZ67.1
#=GS A0A0R3U4W6_9CEST/1-257      AC A0A0R3U4W6.2
#=GS B0E4C7_LACBS/1-218          AC B0E4C7.1
#=GS XRN2_DEBHA/1-251            AC Q6BNU7.4
#=GS S4RC84_PETMA/5-112          AC S4RC84.1
#=GS A0A6A5CAY3_NAEFO/88-312     AC A0A6A5CAY3.1
#=GS A0A2H4UVI0_9VIRU/94-190     AC A0A2H4UVI0.1
#=GS L8GMZ2_ACACA/1-244          AC L8GMZ2.1
#=GS A0A1U7UBV0_CARSF/1-254      AC A0A1U7UBV0.1
#=GS A0A4P9XH60_9FUNG/1-134      AC A0A4P9XH60.1
#=GS A0A1S3M9B1_SALSA/1-254      AC A0A1S3M9B1.1
#=GS M1US37_CYAM1/1-208          AC M1US37.1
#=GS A0A2K1Y2A3_POPTR/1-252      AC A0A2K1Y2A3.2
#=GS U7Q3Y8_SPOS1/1-227          AC U7Q3Y8.1
#=GS A0A287S1I9_HORVV/1-193      AC A0A287S1I9.1
#=GS A0A090M2M2_OSTTA/1-227      AC A0A090M2M2.1
#=GS A0A665UM36_ECHNA/1-254      AC A0A665UM36.1
#=GS A0A310SG13_9HYME/1-227      AC A0A310SG13.1
#=GS A0A2H3JII3_WOLCO/1-249      AC A0A2H3JII3.1
#=GS A0A672GCS8_SALFA/1-186      AC A0A672GCS8.1
#=GS A0A1I7VYI3_LOALO/232-485    AC A0A1I7VYI3.1
#=GS F6USM9_HORSE/1-227          AC F6USM9.2
#=GS A0A1V6QQ29_9EURO/1-260      AC A0A1V6QQ29.1
#=GS R1DHU3_EMIHU/1-196          AC R1DHU3.1
#=GS A0A1J4JEH2_9EUKA/1-251      AC A0A1J4JEH2.1
#=GS A0A446UQK6_TRITD/1-255      AC A0A446UQK6.1
#=GS A0A287S1C7_HORVV/1-255      AC A0A287S1C7.1
#=GS A0A1J4KWS9_9EUKA/1-208      AC A0A1J4KWS9.1
#=GS A0A0D2SSN5_GOSRA/1-255      AC A0A0D2SSN5.1
#=GS A0A2A2LTU2_9BILA/1-227      AC A0A2A2LTU2.1
#=GS H1VHK7_COLHI/1-260          AC H1VHK7.1
#=GS A0A1U8AQ07_NELNU/1-253      AC A0A1U8AQ07.1
#=GS A0A0N4XW73_NIPBR/1-255      AC A0A0N4XW73.2
#=GS A0A1U8D0V1_ALLSI/1-254      AC A0A1U8D0V1.1
#=GS A0A6Q2YYI0_ESOLU/1-227      AC A0A6Q2YYI0.1
#=GS A0A0L0UYR7_9BASI/1-226      AC A0A0L0UYR7.1
#=GS A0A453LG93_AEGTS/1-162      AC A0A453LG93.1
#=GS A0A485NXP3_LYNPA/1-254      AC A0A485NXP3.1
#=GS A0A0L9VD23_PHAAN/1-251      AC A0A0L9VD23.1
#=GS A0A103XBY4_CYNCS/1-100      AC A0A103XBY4.1
#=GS A0A183JJH3_9TREM/1-78       AC A0A183JJH3.1
#=GS A0A5D6XP65_9STRA/7-235      AC A0A5D6XP65.1
#=GS A0A0J8QLE2_COCIT/88-160     AC A0A0J8QLE2.1
#=GS A0A3N0Z2C4_ANAGA/1-237      AC A0A3N0Z2C4.1
#=GS A0A287S1I3_HORVV/1-193      AC A0A287S1I3.1
#=GS A0A2V3ILM0_9FLOR/1-241      AC A0A2V3ILM0.1
#=GS C5XGF0_SORBI/1-254          AC C5XGF0.1
#=GS A0A3B6D682_WHEAT/1-255      AC A0A3B6D682.1
#=GS A0A1X0RSJ7_RHIZD/1-227      AC A0A1X0RSJ7.1
#=GS A0A143ZZN7_PLAF7/45-259     AC A0A143ZZN7.1
#=GS A0A4U0UF73_9PEZI/1-264      AC A0A4U0UF73.1
#=GS A0A4S4NCM9_9APHY/99-212     AC A0A4S4NCM9.1
#=GS A0A2K6RNF5_RHIRO/102-355    AC A0A2K6RNF5.1
#=GS A0A2V1AQX2_9ASCO/1-252      AC A0A2V1AQX2.1
#=GS A0A662XPQ0_9STRA/191-222    AC A0A662XPQ0.1
#=GS A0A154PBK2_DUFNO/1-227      AC A0A154PBK2.1
#=GS A0A0D0APF9_9AGAM/1-227      AC A0A0D0APF9.1
#=GS A0A671X0P3_SPAAU/1-254      AC A0A671X0P3.1
#=GS T0QIM0_SAPDV/1-254          AC T0QIM0.1
#=GS A0A453M1S1_AEGTS/8-262      AC A0A453M1S1.1
#=GS A0A1D6MQ08_MAIZE/1-133      AC A0A1D6MQ08.1
#=GS A0A0V1LSQ0_9BILA/1-227      AC A0A0V1LSQ0.1
#=GS Q5CVZ1_CRYPI/1-249          AC Q5CVZ1.1
#=GS M5XM80_PRUPE/1-254          AC M5XM80.1
#=GS H3CZE5_TETNG/1-256          AC H3CZE5.1
#=GS F6W8W0_CIOIN/1-227          AC F6W8W0.2
#=GS A0A665UM22_ECHNA/1-229      AC A0A665UM22.1
#=GS A0A0A1TY07_ENTIV/5-227      AC A0A0A1TY07.1
#=GS A0A669C8J7_ORENI/1-228      AC A0A669C8J7.1
#=GS A0A565C1U2_9BRAS/1-253      AC A0A565C1U2.1
#=GS A0A448YUY7_9STRA/1-178      AC A0A448YUY7.1
#=GS A0A151Z6R5_9MYCE/1-259      AC A0A151Z6R5.1
#=GS H2ATA3_KAZAF/1-254          AC H2ATA3.1
#=GS A0A5F9C7H4_RABIT/1-254      AC A0A5F9C7H4.1
#=GS A0A2Y9G9S5_NEOSC/1-227      AC A0A2Y9G9S5.1
#=GS A5K6G3_PLAVS/1-286          AC A5K6G3.1
#=GS A0A0S4ILZ5_BODSA/43-159     AC A0A0S4ILZ5.1
#=GS A0A0V0USN8_9BILA/6-260      AC A0A0V0USN8.1
#=GS A0A158QSQ7_9CEST/1-102      AC A0A158QSQ7.1
#=GS L8WPX4_THACA/369-560        AC L8WPX4.1
#=GS A0A6P9ES08_JUGRE/1-144      AC A0A6P9ES08.1
#=GS W3WZI7_PESFW/1-260          AC W3WZI7.1
#=GS A0A1J4J1F1_9EUKA/1-208      AC A0A1J4J1F1.1
#=GS A0A183LNY6_9TREM/1-255      AC A0A183LNY6.1
#=GS A0A452SJ77_URSAM/1-254      AC A0A452SJ77.1
#=GS A0A498MV12_LABRO/107-333    AC A0A498MV12.1
#=GS A0A5N6Z7I7_9EURO/1-257      AC A0A5N6Z7I7.1
#=GS B8BQQ9_THAPS/1-177          AC B8BQQ9.1
#=GS U6MZ34_9EIME/1-215          AC U6MZ34.1
#=GS A0A3P8YGQ7_ESOLU/1-254      AC A0A3P8YGQ7.1
#=GS A0A3M2SXN8_9EURO/1-227      AC A0A3M2SXN8.1
#=GS A0A1B9HZG5_9TREE/1-259      AC A0A1B9HZG5.1
#=GS A0A3B6GYV2_WHEAT/1-254      AC A0A3B6GYV2.1
#=GS A0A3B6MZA0_WHEAT/1-255      AC A0A3B6MZA0.1
#=GS A0A0C4F5Y0_PUCT1/1-46       AC A0A0C4F5Y0.1
#=GS A0A0D2SK83_GOSRA/1-144      AC A0A0D2SK83.1
#=GS K1XQ96_MARBU/1-227          AC K1XQ96.1
#=GS S0DW41_GIBF5/1-228          AC S0DW41.1
#=GS A0A1Q3AW82_CEPFO/1-254      AC A0A1Q3AW82.1
#=GS A0A0J7NVB9_LASNI/1-226      AC A0A0J7NVB9.1
#=GS A0A2K1QK25_9PEZI/1-257      AC A0A2K1QK25.1
#=GS A0A287LYF7_HORVV/1-254      AC A0A287LYF7.1
#=GS A0A4W6FS03_LATCA/1-254      AC A0A4W6FS03.1
#=GS W6MNF8_9ASCO/1-211          AC W6MNF8.1
#=GS A0A1E7FEM9_9STRA/1-167      AC A0A1E7FEM9.1
#=GS A0A059LJ77_9CHLO/1-140      AC A0A059LJ77.1
#=GS A0A2T7DP90_9POAL/1-254      AC A0A2T7DP90.1
#=GS A0A1U7Z150_NELNU/1-248      AC A0A1U7Z150.1
#=GS A0A1S3R2H3_SALSA/1-227      AC A0A1S3R2H3.1
#=GS A0A1D2NBX7_ORCCI/1-255      AC A0A1D2NBX7.1
#=GS R1DES6_EMIHU/66-146         AC R1DES6.1
#=GS A0A2I0MBE6_COLLI/1-192      AC A0A2I0MBE6.1
#=GS A0A397UBY3_9GLOM/1-72       AC A0A397UBY3.1
#=GS A0A1Y2B1R4_9TREE/1-260      AC A0A1Y2B1R4.1
#=GS A0A251RBF6_PRUPE/1-254      AC A0A251RBF6.1
#=GS A0A653H9Q2_9APIC/41-311     AC A0A653H9Q2.1
#=GS A0A2H3X1K9_PHODC/1-155      AC A0A2H3X1K9.1
#=GS A0A392R0C1_9FABA/1-57       AC A0A392R0C1.1
#=GS A0A4P1R0K3_LUPAN/59-185     AC A0A4P1R0K3.1
#=GS A0A0A1U836_ENTIV/105-205    AC A0A0A1U836.1
#=GS A4HCS1_LEIBR/1-270          AC A4HCS1.2
#=GS A0A267GAR4_9PLAT/1-255      AC A0A267GAR4.1
#=GS G3WUI7_SARHA/1-202          AC G3WUI7.1
#=GS A0A2U3ZCQ3_ODORO/1-227      AC A0A2U3ZCQ3.1
#=GS D3BRW5_POLPP/1-250          AC D3BRW5.1
#=GS A0A507CCB8_9FUNG/1-205      AC A0A507CCB8.1
#=GS E2RMS9_CANLF/1-254          AC E2RMS9.2
#=GS A0A316ZJH8_9BASI/1-244      AC A0A316ZJH8.1
#=GS A0A0C9M7F1_9FUNG/466-690    AC A0A0C9M7F1.1
#=GS A0A061J4L0_TRYRA/1-237      AC A0A061J4L0.1
#=GS A0A2H9TJJ2_9FUNG/1-53       AC A0A2H9TJJ2.1
#=GS A5DD76_PICGU/1-179          AC A5DD76.2
#=GS A0A4Y9ZR28_9AGAM/1-227      AC A0A4Y9ZR28.1
#=GS A0A6Q2Y583_ESOLU/1-254      AC A0A6Q2Y583.1
#=GS A0A1Q9DG36_SYMMI/1888-1998  AC A0A1Q9DG36.1
#=GS A0A4Q1BSU9_TREME/14-239     AC A0A4Q1BSU9.1
#=GS A0A5B8MKG5_9CHLO/1-254      AC A0A5B8MKG5.1
#=GS A0A177UEN3_9BASI/1-261      AC A0A177UEN3.1
#=GS A0A6P9E2Q3_JUGRE/1-254      AC A0A6P9E2Q3.1
#=GS XRN2_DROME/1-256            AC Q9VM71.2
#=GS A0A163KP85_ABSGL/1-265      AC A0A163KP85.1
#=GS A0A183ALY8_9TREM/1-205      AC A0A183ALY8.1
#=GS A0A4Y9Y6J5_9APHY/1-227      AC A0A4Y9Y6J5.1
#=GS A0A453M1U9_AEGTS/1-255      AC A0A453M1U9.1
#=GS W1NWB9_AMBTC/1-144          AC W1NWB9.1
#=GS A0A151TNS8_CAJCA/1-234      AC A0A151TNS8.1
#=GS A0A421JPR8_9ASCO/1-250      AC A0A421JPR8.1
#=GS A0A2H3GW79_FUSOX/1-260      AC A0A2H3GW79.1
#=GS A0A068U8S6_COFCA/1-46       AC A0A068U8S6.1
#=GS A0A674DK66_SALTR/1-227      AC A0A674DK66.1
#=GS A0A4P6XLD9_9ASCO/1-252      AC A0A4P6XLD9.1
#=GS C4VAN4_NOSCE/1-231          AC C4VAN4.1
#=GS A0A2I0RHV4_9PEZI/1-228      AC A0A2I0RHV4.1
#=GS A0A164ZUH4_9AGAM/1-192      AC A0A164ZUH4.1
#=GS E3QFY4_COLGM/1-228          AC E3QFY4.1
#=GS A0A061H5A2_9BASI/1-261      AC A0A061H5A2.1
#=GS A0A3Q4BQ90_MOLML/1-254      AC A0A3Q4BQ90.1
#=GS F7W4L4_SORMK/1-227          AC F7W4L4.1
#=GS F7CRU3_XENTR/1-254          AC F7CRU3.2
#=GS A0A2K5NLK3_CERAT/1-227      AC A0A2K5NLK3.1
#=GS B8PH00_POSPM/15-239         AC B8PH00.1
#=GS A0A2K3DPK1_CHLRE/1-226      AC A0A2K3DPK1.1
#=GS A0A251NQ70_PRUPE/20-268     AC A0A251NQ70.1
#=GS A0A388JQC5_CHABU/125-190    AC A0A388JQC5.1
#=GS U6L939_9EIME/14-225         AC U6L939.1
#=GS A0A4W3HBT8_CALMI/2-205      AC A0A4W3HBT8.1
#=GS B9SD01_RICCO/1-235          AC B9SD01.1
#=GS A0A2C6KNR6_9APIC/1-245      AC A0A2C6KNR6.1
#=GS A0A1V6QTU2_9EURO/1-227      AC A0A1V6QTU2.1
#=GS A0A059J8R4_TRIIM/1-259      AC A0A059J8R4.1
#=GS A0A384DG25_URSMA/1-227      AC A0A384DG25.1
#=GS A0A287X5P7_HORVV/1-210      AC A0A287X5P7.1
#=GS A0A1S7I081_9SACH/1-227      AC A0A1S7I081.1
#=GS A0A0M0JRM3_9EUKA/105-204    AC A0A0M0JRM3.1
#=GS A0A673TH03_SURSU/1-254      AC A0A673TH03.1
#=GS Q4DFX3_TRYCC/1-236          AC Q4DFX3.1
#=GS A0A5N5LBD4_PANHP/1-254      AC A0A5N5LBD4.1
#=GS A0A175WCE2_9PEZI/1-227      AC A0A175WCE2.1
#=GS A0A1S8VLV5_9FUNG/1-192      AC A0A1S8VLV5.1
#=GS A0A3A3A6P5_9EURO/1-259      AC A0A3A3A6P5.1
#=GS A0A401H0J4_9APHY/1-227      AC A0A401H0J4.1
#=GS A0A3B6INT8_WHEAT/1-247      AC A0A3B6INT8.1
#=GS A0A504Y4J1_FASGI/1-257      AC A0A504Y4J1.1
#=GS A0A6P9E9X3_JUGRE/1-248      AC A0A6P9E9X3.1
#=GS A0A4X2KSJ1_VOMUR/1-227      AC A0A4X2KSJ1.1
#=GS D5GM15_TUBMM/1-254          AC D5GM15.1
#=GS A0A422N1U3_TRYRA/36-268     AC A0A422N1U3.1
#=GS A0A1L0DQK2_9ASCO/1-252      AC A0A1L0DQK2.1
#=GS A0A0D2Y8M0_FUSO4/1-260      AC A0A0D2Y8M0.1
#=GS A0A3L6Q1T8_PANMI/1-248      AC A0A3L6Q1T8.1
#=GS A0A1A6FWR0_NEOLE/1-140      AC A0A1A6FWR0.1
#=GS A0A1J9QND1_9EURO/1-227      AC A0A1J9QND1.1
#=GS A0A402FVK1_9SAUR/1-254      AC A0A402FVK1.1
#=GS A0A2V0PGL9_9CHLO/1-254      AC A0A2V0PGL9.1
#=GS G3J984_CORMM/1-228          AC G3J984.1
#=GS B1N3S5_ENTHI/1-246          AC B1N3S5.1
#=GS Q57U81_TRYB2/1-269          AC Q57U81.1
#=GS G4USW5_NEUT9/1-260          AC G4USW5.1
#=GS A0A2K3CV53_CHLRE/1-254      AC A0A2K3CV53.1
#=GS A0A087ZZT3_APIME/1-255      AC A0A087ZZT3.1
#=GS W6LBF4_9TRYP/1-236          AC W6LBF4.1
#=GS A0A5N7BGE3_9EURO/1-227      AC A0A5N7BGE3.1
#=GS A0A5B8MQC6_9CHLO/1-226      AC A0A5B8MQC6.1
#=GS A0A669CU25_ORENI/1-254      AC A0A669CU25.1
#=GS H2URN9_TAKRU/1-254          AC H2URN9.3
#=GS F9FTF6_FUSOF/1-193          AC F9FTF6.1
#=GS A0A0C3E4X7_9AGAM/1-200      AC A0A0C3E4X7.1
#=GS A0A5N6JT66_9HELO/1-227      AC A0A5N6JT66.1
#=GS A0A1U8J6M8_GOSHI/1-254      AC A0A1U8J6M8.1
#=GS A0A3L6TQ24_PANMI/1-255      AC A0A3L6TQ24.1
#=GS A0A453M1N6_AEGTS/9-263      AC A0A453M1N6.1
#=GS E9GTH8_DAPPU/1-183          AC E9GTH8.1
#=GS A0A0V0TVM9_9BILA/30-272     AC A0A0V0TVM9.1
#=GS A0A674AM47_SALTR/1-254      AC A0A674AM47.1
#=GS A0A0L0C179_LUCCU/1-256      AC A0A0L0C179.1
#=GS W5MMR2_LEPOC/1-227          AC W5MMR2.1
#=GS A0A1Z5JRL2_FISSO/1-255      AC A0A1Z5JRL2.1
#=GS A0A367JQW1_RHIST/1-192      AC A0A367JQW1.1
#=GS A0A397GGI4_9GLOM/1-227      AC A0A397GGI4.1
#=GS S3D7Q9_GLAL2/1-227          AC S3D7Q9.1
#=GS A0A1G4AU29_9PEZI/1-228      AC A0A1G4AU29.1
#=GS A0A446Q789_TRITD/1-254      AC A0A446Q789.1
#=GS W9YWG8_9EURO/1-227          AC W9YWG8.1
#=GS A0A4U6TPB0_SETVI/1-246      AC A0A4U6TPB0.1
#=GS A0A1L0BD92_9ASCO/1-226      AC A0A1L0BD92.1
#=GS A0A498K975_MALDO/1-262      AC A0A498K975.1
#=GS A0A087H0H7_ARAAL/1-250      AC A0A087H0H7.1
#=GS A0A3Q0F4C0_VIGRR/1-254      AC A0A3Q0F4C0.1
#=GS M3B2B4_PSEFD/1-263          AC M3B2B4.1
#=GS A0A4Z2DW18_SCHJA/2-194      AC A0A4Z2DW18.1
#=GS A0A0K0DTB2_STRER/1-255      AC A0A0K0DTB2.1
#=GS J9DGU0_EDHAE/142-301        AC J9DGU0.1
#=GS A0A3B1JFE0_ASTMX/1-254      AC A0A3B1JFE0.1
#=GS T1I0L7_RHOPR/1-257          AC T1I0L7.1
#=GS A0A6A5C585_NAEFO/1-227      AC A0A6A5C585.1
#=GS A0A674AMP0_SALTR/1-254      AC A0A674AMP0.1
#=GS E4XDC7_OIKDI/1-255          AC E4XDC7.1
#=GS I3KIQ9_ORENI/1-193          AC I3KIQ9.2
#=GS V5AZC6_TRYCR/2-288          AC V5AZC6.1
#=GS A0A093ZTW4_9PEZI/1-227      AC A0A093ZTW4.1
#=GS A0A0G4L1G6_9PEZI/1-169      AC A0A0G4L1G6.1
#=GS A0A078FMK5_BRANA/1-254      AC A0A078FMK5.1
#=GS A0A6A4X092_AMPAM/1-218      AC A0A6A4X092.1
#=GS A0A1Y2HX03_9FUNG/1-255      AC A0A1Y2HX03.1
#=GS Q57XA6_TRYB2/1-228          AC Q57XA6.1
#=GS A0A3P6TWN4_LITSI/7-231      AC A0A3P6TWN4.1
#=GS A0A5N5KLQ6_9PEZI/1-227      AC A0A5N5KLQ6.1
#=GS A0A0V1LSM7_9BILA/1-227      AC A0A0V1LSM7.1
#=GS A0A1A8VVG0_9APIC/104-318    AC A0A1A8VVG0.1
#=GS M7TVK2_BOTF1/1-227          AC M7TVK2.1
#=GS U3CD29_CALJA/1-227          AC U3CD29.1
#=GS A0A251NZJ6_PRUPE/4-114      AC A0A251NZJ6.1
#=GS A0A0B0PJD9_GOSAR/1-254      AC A0A0B0PJD9.1
#=GS A0A388JQC5_CHABU/1-128      AC A0A388JQC5.1
#=GS A0A3M6VX39_9STRA/1-255      AC A0A3M6VX39.1
#=GS A0A0A0AIX9_CHAVO/2-230      AC A0A0A0AIX9.1
#=GS A0A067C1J5_SAPPC/1-232      AC A0A067C1J5.1
#=GS A0A2P6QEF5_ROSCH/1-257      AC A0A2P6QEF5.1
#=GS A0A2I0IL85_PUNGR/1-46       AC A0A2I0IL85.1
#=GS A0A1E3BJG9_9EURO/1-227      AC A0A1E3BJG9.1
#=GS E2A7U7_CAMFO/1-255          AC E2A7U7.1
#=GS A0A2J8AJ33_9CHLO/46-128     AC A0A2J8AJ33.1
#=GS A0A4U5UKY0_COLLU/1-254      AC A0A4U5UKY0.1
#=GS B2VWF2_PYRTR/1-260          AC B2VWF2.1
#=GS B0DS07_LACBS/4-59           AC B0DS07.1
#=GS A0A674NKX9_TAKRU/15-259     AC A0A674NKX9.1
#=GS A0A103XIA7_CYNCS/40-174     AC A0A103XIA7.1
#=GS A0A5E4B618_MARMO/630-883    AC A0A5E4B618.1
#=GS A0A6I8N8P1_ORNAN/1-227      AC A0A6I8N8P1.1
#=GS A0A5C3L2S5_9AGAR/1-203      AC A0A5C3L2S5.1
#=GS E3T575_CROVB/1-224          AC E3T575.1
#=GS A0A667Y9K8_9TELE/1-254      AC A0A667Y9K8.1
#=GS A0A5N7AD65_9EURO/1-227      AC A0A5N7AD65.1
#=GS A0A2P6NRV0_9EUKA/22-261     AC A0A2P6NRV0.1
#=GS C4MB40_ENTHI/31-276         AC C4MB40.1
#=GS A0A0R4IYZ5_DANRE/8-138      AC A0A0R4IYZ5.2
#=GS Q4Q1P5_LEIMA/1-251          AC Q4Q1P5.1
#=GS A0A3Q3BHP1_KRYMA/1-227      AC A0A3Q3BHP1.1
#=GS A0A1D6FJL9_MAIZE/14-108     AC A0A1D6FJL9.1
#=GS A0A3A2ZPK1_9EURO/1-227      AC A0A3A2ZPK1.1
#=GS I6NDT9_ERECY/1-254          AC I6NDT9.1
#=GS A0A165Y2T5_DAUCS/1-233      AC A0A165Y2T5.1
#=GS A0A5A7V8W9_CUCME/1-255      AC A0A5A7V8W9.1
#=GS A0A2S4PMC0_9PEZI/1-244      AC A0A2S4PMC0.1
#=GS A0A671WJG2_SPAAU/1-227      AC A0A671WJG2.1
#=GS A0A1V9Y4Z8_9STRA/1-233      AC A0A1V9Y4Z8.1
#=GS W7KBB8_PLAFO/22-296         AC W7KBB8.1
#=GS A0A4Y7J233_PAPSO/1-254      AC A0A4Y7J233.1
#=GS E2C5N3_HARSA/1-227          AC E2C5N3.1
#=GS A0A5F9CZ93_RABIT/1-254      AC A0A5F9CZ93.1
#=GS A0A0G4J757_PLABS/1-227      AC A0A0G4J757.1
#=GS W8W1T0_9VIRU/127-237        AC W8W1T0.1
#=GS A0A1R3J2K5_COCAP/1-249      AC A0A1R3J2K5.1
#=GS K7BLV9_PANTR/1-227          AC K7BLV9.1
#=GS W1NDT9_AMBTC/1-255          AC W1NDT9.1
#=GS A0A103YET5_CYNCS/111-307    AC A0A103YET5.1
#=GS F6H077_VITVI/1-254          AC F6H077.1
#=GS W1QLE1_OGAPD/1-254          AC W1QLE1.1
#=GS G1NVU4_MYOLU/1-254          AC G1NVU4.1
#=GS A0A3Q0IC73_PHODC/1-248      AC A0A3Q0IC73.1
#=GS A0A0L0SXJ3_ALLM3/1-257      AC A0A0L0SXJ3.1
#=GS A9UQH2_MONBE/1-227          AC A9UQH2.1
#=GS A0A2G8SSW1_9APHY/1-260      AC A0A2G8SSW1.1
#=GS I0YWX7_COCSC/1-167          AC I0YWX7.1
#=GS A0A1S2ZW12_ERIEU/1-254      AC A0A1S2ZW12.1
#=GS A0A287LYH2_HORVV/1-254      AC A0A287LYH2.1
#=GS A0A0E9NIC2_SAICN/1-225      AC A0A0E9NIC2.1
#=GS A0A2Z7AEJ6_9LAMI/3-202      AC A0A2Z7AEJ6.1
#=GS A0A0R3WDX9_TAEAS/1-257      AC A0A0R3WDX9.2
#=GS A0A2Y9I2K2_NEOSC/1-254      AC A0A2Y9I2K2.1
#=GS A0A507FM16_9FUNG/69-323     AC A0A507FM16.1
#=GS A5DCP5_PICGU/1-191          AC A5DCP5.2
#=GS A0A4W4F642_ELEEL/1-254      AC A0A4W4F642.1
#=GS X6NH22_RETFI/3-122          AC X6NH22.1
#=GS A0A674EFE8_SALTR/1-227      AC A0A674EFE8.1
#=GS A0A238C6V6_9BILA/61-314     AC A0A238C6V6.1
#=GS A0A287S1F7_HORVV/1-193      AC A0A287S1F7.1
#=GS F1SAU5_PIG/1-258            AC F1SAU5.3
#=GS A0A2I4EZW0_JUGRE/1-250      AC A0A2I4EZW0.2
#=GS A0A2K3M4B6_TRIPR/1-168      AC A0A2K3M4B6.1
#=GS A0A1D6MQ19_MAIZE/1-254      AC A0A1D6MQ19.1
#=GS K7HAT8_CAEJA/1-227          AC K7HAT8.1
#=GS A0A2G9TQ23_TELCI/12-144     AC A0A2G9TQ23.1
#=GS A0A3Q2ZGG6_KRYMA/1-99       AC A0A3Q2ZGG6.1
#=GS A0A446UHP9_TRITD/4-130      AC A0A446UHP9.1
#=GS A0A091JAD3_EGRGA/1-202      AC A0A091JAD3.1
#=GS A0A1V8V6S2_9PEZI/1-227      AC A0A1V8V6S2.1
#=GS A0A0J8RGM0_COCIT/1-227      AC A0A0J8RGM0.1
#=GS A0A0C2WW74_9AGAM/1-247      AC A0A0C2WW74.1
#=GS A0A061D4T9_BABBI/1-255      AC A0A061D4T9.1
#=GS A0A0K3CBL7_RHOTO/1-260      AC A0A0K3CBL7.1
#=GS A0A091N3V3_9PASS/3-230      AC A0A091N3V3.1
#=GS A0A669CIM2_ORENI/1-254      AC A0A669CIM2.1
#=GS A0A0D9RFT3_CHLSB/1-227      AC A0A0D9RFT3.1
#=GS A0A1R3IXZ4_COCAP/1-254      AC A0A1R3IXZ4.1
#=GS A0A1X7QWR6_9SACH/1-254      AC A0A1X7QWR6.1
#=GS A0A2P4ZIB1_9HYPO/1-228      AC A0A2P4ZIB1.1
#=GS A0A6Q2ZQ13_ESOLU/1-227      AC A0A6Q2ZQ13.1
#=GS A0A328DC15_9ASTE/1-247      AC A0A328DC15.1
#=GS A0A287LYF2_HORVV/1-254      AC A0A287LYF2.1
#=GS F0XTD1_GROCL/182-211        AC F0XTD1.1
#=GS A0A0D3FQ39_9ORYZ/67-321     AC A0A0D3FQ39.1
#=GS A0A4Z2D786_SCHJA/1-255      AC A0A4Z2D786.1
#=GS U5H529_USTV1/1-227          AC U5H529.1
#=GS F6UP03_CALJA/1-254          AC F6UP03.2
#=GS W5NJQ5_LEPOC/1-200          AC W5NJQ5.1
#=GS A0A446NWL9_TRITD/1-254      AC A0A446NWL9.1
#=GS W5MMT7_LEPOC/1-227          AC W5MMT7.1
#=GS U1HZB0_ENDPU/1-260          AC U1HZB0.1
#=GS A0A3Q7UM81_VULVU/1-227      AC A0A3Q7UM81.1
#=GS A0A1Z5RHS3_SORBI/1-29       AC A0A1Z5RHS3.1
#=GS A0A2U3ZDQ2_ODORO/1-227      AC A0A2U3ZDQ2.1
#=GS A0A099ZN78_TINGU/2-230      AC A0A099ZN78.1
#=GS L1JQ07_GUITC/65-164         AC L1JQ07.1
#=GS A0A3P8S923_AMPPE/1-227      AC A0A3P8S923.1
#=GS A0A6P9EJ19_JUGRE/1-244      AC A0A6P9EJ19.1
#=GS N4UC50_FUSC1/1-260          AC N4UC50.1
#=GS G1T5H2_RABIT/1-254          AC G1T5H2.1
#=GS A0A1I7W1Q5_LOALO/1-227      AC A0A1I7W1Q5.1
#=GS A0A0F4YQ11_TALEM/1-273      AC A0A0F4YQ11.1
#=GS A0A6A3MVS2_9STRA/1-240      AC A0A6A3MVS2.1
#=GS D4ALN0_ARTBC/1-259          AC D4ALN0.1
#=GS A0A4V2K9K2_9APHY/1-260      AC A0A4V2K9K2.1
#=GS A0A250XPC0_9CHLO/13-101     AC A0A250XPC0.1
#=GS A0A1S3G115_DIPOR/1-254      AC A0A1S3G115.1
#=GS A0A401GB69_9APHY/1-260      AC A0A401GB69.1
#=GS A0A0B2W5Q9_TOXCA/1-227      AC A0A0B2W5Q9.1
#=GS A4HWT8_LEIIN/78-248         AC A4HWT8.1
#=GS A0A3N6Q471_BRACR/1-225      AC A0A3N6Q471.1
#=GS A0A4S4ENB1_CAMSI/294-358    AC A0A4S4ENB1.1
#=GS T1KTQ9_TETUR/1-246          AC T1KTQ9.2
#=GS A0A0G4EQS0_VITBC/1-252      AC A0A0G4EQS0.1
#=GS A0A1B8E4X1_9PEZI/1-259      AC A0A1B8E4X1.1
#=GS A0A443HJT2_BYSSP/1-259      AC A0A443HJT2.1
#=GS A0A139I591_9PEZI/1-263      AC A0A139I591.1
#=GS I7MMX2_TETTS/1-229          AC I7MMX2.2
#=GS A0A446UR01_TRITD/1-255      AC A0A446UR01.1
#=GS A0A445HN19_GLYSO/1-244      AC A0A445HN19.1
#=GS A0A4S2LI95_OPIFE/1-257      AC A0A4S2LI95.1
#=GS A0A6G0YIY8_APHCR/1-227      AC A0A6G0YIY8.1
#=GS A0A498NK02_LABRO/1-215      AC A0A498NK02.1
#=GS A0A2X0M3P3_9BASI/1-227      AC A0A2X0M3P3.1
#=GS A0A2T9YWF9_9FUNG/1-228      AC A0A2T9YWF9.1
#=GS I2JX35_DEKBR/1-254          AC I2JX35.2
#=GS A0A179G6E9_METCM/1-149      AC A0A179G6E9.2
#=GS R0JPE8_ANAPL/2-230          AC R0JPE8.1
#=GS A0A6A2XM87_HIBSY/133-276    AC A0A6A2XM87.1
#=GS D3BP61_POLPP/1-259          AC D3BP61.1
#=GS A0A367L142_9HYPO/1-228      AC A0A367L142.1
#=GS H1VJW9_COLHI/1-228          AC H1VJW9.1
#=GS A5E3H5_LODEL/1-250          AC A5E3H5.1
#=GS A0A673CC85_9TELE/1-227      AC A0A673CC85.1
#=GS A0A151ZD91_9MYCE/1-37       AC A0A151ZD91.1
#=GS A0A6I8TS81_AEDAE/1-255      AC A0A6I8TS81.1
#=GS A0A5C7GVE6_9ROSI/1-240      AC A0A5C7GVE6.1
#=GS A0A091KFU4_EGRGA/2-230      AC A0A091KFU4.1
#=GS A0A446TIG5_TRITD/1-255      AC A0A446TIG5.1
#=GS A0A2R6P726_ACTCC/1-246      AC A0A2R6P726.1
#=GS A0A2I4GWX4_JUGRE/1-248      AC A0A2I4GWX4.1
#=GS A0A151NAP6_ALLMI/1-227      AC A0A151NAP6.1
#=GS A0A2K5NC52_CERAT/1-254      AC A0A2K5NC52.1
#=GS A0A0L7KFI2_PLAFX/22-389     AC A0A0L7KFI2.1
#=GS A0A0R0LW26_9MICR/1-230      AC A0A0R0LW26.1
#=GS A0A6P9EJE5_JUGRE/1-244      AC A0A6P9EJE5.1
#=GS A0A0D2AFZ6_9EURO/1-262      AC A0A0D2AFZ6.1
#=GS K6V7H7_9APIC/147-266        AC K6V7H7.1
#=GS A0A674MJY2_TAKRU/15-259     AC A0A674MJY2.1
#=GS A0A6Q2X9E6_ESOLU/1-227      AC A0A6Q2X9E6.1
#=GS M1V6Y2_CYAM1/1-235          AC M1V6Y2.1
#=GS A0A3Q0J3Q3_DIACI/1-227      AC A0A3Q0J3Q3.1
#=GS A0A674C0I4_SALTR/1-254      AC A0A674C0I4.1
#=GS F9F338_FUSOF/1-260          AC F9F338.1
#=GS A0A166QQZ3_9PEZI/1-260      AC A0A166QQZ3.1
#=GS H0WFW2_OTOGA/1-227          AC H0WFW2.1
#=GS G7L0T8_MEDTR/1-256          AC G7L0T8.2
#=GS A0A2G5DN37_AQUCA/1-188      AC A0A2G5DN37.1
#=GS A0A287LYD8_HORVV/37-290     AC A0A287LYD8.1
#=GS D3BCJ4_POLPP/262-484        AC D3BCJ4.1
#=GS A0A2V1B2N2_9ASCO/454-645    AC A0A2V1B2N2.1
#=GS E2LJZ2_MONPE/1-165          AC E2LJZ2.1
#=GS A0A2B7X5R1_9EURO/1-227      AC A0A2B7X5R1.1
#=GS A0A1D6GFM9_MAIZE/1-255      AC A0A1D6GFM9.1
#=GS Q4WEI4_ASPFU/1-227          AC Q4WEI4.1
#=GS A0A4Q4YCL5_9PEZI/1-260      AC A0A4Q4YCL5.1
#=GS A0A370TNZ1_9HELO/1-255      AC A0A370TNZ1.1
#=GS A0A663EAP4_AQUCH/1-159      AC A0A663EAP4.1
#=GS A0A0C2CA05_9BILA/1-221      AC A0A0C2CA05.1
#=GS A0A061J6R9_TRYRA/1-228      AC A0A061J6R9.1
#=GS A0A2G5CKC9_AQUCA/2-31       AC A0A2G5CKC9.1
#=GS A0A397T3R9_9GLOM/1-238      AC A0A397T3R9.1
#=GS D2UYF9_NAEGR/8-137          AC D2UYF9.1
#=GS A0A2N3N375_9PEZI/1-259      AC A0A2N3N375.1
#=GS A0A3Q2DAQ1_CYPVA/1-254      AC A0A3Q2DAQ1.1
#=GS A0A1Q1PNA9_9VIRU/11-130     AC A0A1Q1PNA9.1
#=GS A4H8G4_LEIBR/76-249         AC A4H8G4.2
#=GS A0A3Q7TWY9_VULVU/1-227      AC A0A3Q7TWY9.1
#=GS A0A2N1JC78_9BASI/1-259      AC A0A2N1JC78.1
#=GS A0A443SQ31_9ACAR/1-227      AC A0A443SQ31.1
#=GS A0A1L8G7M9_XENLA/1-254      AC A0A1L8G7M9.1
#=GS W4YDI2_STRPU/1-227          AC W4YDI2.1
#=GS A0A2R6WDJ0_MARPO/1-254      AC A0A2R6WDJ0.1
#=GS A0A665UM33_ECHNA/1-254      AC A0A665UM33.1
#=GS A0A0R3WR98_HYDTA/1-102      AC A0A0R3WR98.1
#=GS A0A4Q4Y3Y8_9PEZI/1-227      AC A0A4Q4Y3Y8.1
#=GS A0A3Q3XBK8_MOLML/1-254      AC A0A3Q3XBK8.1
#=GS C5E437_ZYGRC/1-227          AC C5E437.1
#=GS H6BSI2_EXODN/1-227          AC H6BSI2.1
#=GS A0A090LFU1_STRRB/1-255      AC A0A090LFU1.1
#=GS A0A6P9DZF5_JUGRE/1-248      AC A0A6P9DZF5.1
#=GS A0A0C9SPS4_PAXIN/1-220      AC A0A0C9SPS4.1
#=GS A0A118JT72_CYNCS/1-72       AC A0A118JT72.1
#=GS A0A2G5CKS5_AQUCA/1-255      AC A0A2G5CKS5.1
#=GS A0A1V1TMC0_9FUNG/1-260      AC A0A1V1TMC0.1
#=GS A0A5J9USP1_9POAL/1-269      AC A0A5J9USP1.1
#=GS E1ZTK0_CHLVA/2-250          AC E1ZTK0.1
#=GS A0A0D9RFB4_CHLSB/1-254      AC A0A0D9RFB4.1
#=GS S9W0Q4_SCHCR/1-226          AC S9W0Q4.1
#=GS T2AX49_9VIRU/116-211        AC T2AX49.1
#=GS A0A1Y1W2M0_9FUNG/1-54       AC A0A1Y1W2M0.1
#=GS A0A1Q1PNA9_9VIRU/127-221    AC A0A1Q1PNA9.1
#=GS A0A3L6QZ96_PANMI/126-190    AC A0A3L6QZ96.1
#=GS A0A2K5RZW3_CEBCA/1-227      AC A0A2K5RZW3.1
#=GS A0A0A2J1X6_PENEN/1-260      AC A0A0A2J1X6.1
#=GS A0A444YGA3_ARAHY/1-254      AC A0A444YGA3.1
#=GS A0A453M1M4_AEGTS/1-196      AC A0A453M1M4.1
#=GS A0A218ZCE4_9HELO/1-227      AC A0A218ZCE4.1
#=GS A0A654HIX8_9CEST/966-1222   AC A0A654HIX8.1
#=GS L0B236_THEEQ/1-255          AC L0B236.1
#=GS A0A6I8QCT5_XENTR/1-227      AC A0A6I8QCT5.1
#=GS A0A5B6X0V8_9ROSI/1-255      AC A0A5B6X0V8.1
#=GS A0A5E4C9L0_MARMO/1-222      AC A0A5E4C9L0.1
#=GS A0A087ZYA0_APIME/1-39       AC A0A087ZYA0.1
#=GS A0A2S4VUJ0_9BASI/1-227      AC A0A2S4VUJ0.1
#=GS W1PWV6_AMBTC/1-245          AC W1PWV6.1
#=GS A0A179UAA1_BLAGS/1-227      AC A0A179UAA1.1
#=GS A0A4W4F7E8_ELEEL/1-254      AC A0A4W4F7E8.1
#=GS A0A024TMH9_9STRA/1-228      AC A0A024TMH9.1
#=GS F7BS67_MONDO/1-254          AC F7BS67.2
#=GS A0A2Y9TFD4_PHYMC/1-227      AC A0A2Y9TFD4.1
#=GS A0A3M0JM71_HIRRU/1-222      AC A0A3M0JM71.1
#=GS A0A1D6MQ07_MAIZE/1-254      AC A0A1D6MQ07.1
#=GS A0A669EB48_ORENI/1-228      AC A0A669EB48.1
#=GS U6LJ00_9EIME/1-128          AC U6LJ00.1
#=GS A0A673TU47_SURSU/1-254      AC A0A673TU47.1
#=GS A0A287LYF3_HORVV/1-144      AC A0A287LYF3.1
#=GS A0A2K5C6D8_AOTNA/1-254      AC A0A2K5C6D8.1
#=GS A0A0E0G6L9_ORYNI/1-193      AC A0A0E0G6L9.1
#=GS A0A0C2TBH4_AMAMU/1-116      AC A0A0C2TBH4.1
#=GS H3E611_PRIPA/1-255          AC H3E611.2
#=GS A8BQ99_GIAIC/1-264          AC A8BQ99.1
#=GS A0A2P4Y311_9STRA/1-213      AC A0A2P4Y311.1
#=GS A0A5P1E4D4_ASPOF/80-198     AC A0A5P1E4D4.1
#=GS A0A4U5PJ65_STECR/1-254      AC A0A4U5PJ65.1
#=GS A0A2K6MIP5_RHIBE/1-227      AC A0A2K6MIP5.1
#=GS A0A446UQM8_TRITD/1-200      AC A0A446UQM8.1
#=GS A0A086TE92_ACRC1/1-228      AC A0A086TE92.1
#=GS A0A392RI46_9FABA/2-61       AC A0A392RI46.1
#=GS A0A4W5R7E2_9TELE/1-254      AC A0A4W5R7E2.1
#=GS A0A091KV50_9GRUI/3-233      AC A0A091KV50.1
#=GS A0A2S7QLU3_9HELO/1-254      AC A0A2S7QLU3.1
#=GS C4M8Y2_ENTHI/105-205        AC C4M8Y2.1
#=GS F4Q1L3_CAVFA/136-230        AC F4Q1L3.1
#=GS A0A1J4KNW9_9EUKA/1-105      AC A0A1J4KNW9.1
#=GS A0A0G4EF62_VITBC/1-242      AC A0A0G4EF62.1
#=GS W7JMI6_PLAFA/45-259         AC W7JMI6.1
#=GS A0A670K037_PODMU/1-254      AC A0A670K037.1
#=GS A0A1E5RU55_HANUV/1-273      AC A0A1E5RU55.1
#=GS M7ZDB9_TRIUA/1-233          AC M7ZDB9.1
#=GS A0A0V0USR1_9BILA/6-260      AC A0A0V0USR1.1
#=GS A0A182DX65_ONCOC/1-227      AC A0A182DX65.1
#=GS H2SH05_TAKRU/1-125          AC H2SH05.2
#=GS A0A291B0L2_9VIRU/1-237      AC A0A291B0L2.1
#=GS A0A446TAP6_TRITD/1-267      AC A0A446TAP6.1
#=GS A0A673B0I1_9TELE/1-254      AC A0A673B0I1.1
#=GS A0A2U1PSJ6_ARTAN/1-248      AC A0A2U1PSJ6.1
#=GS A0A2H6KCY9_9APIC/1-270      AC A0A2H6KCY9.1
#=GS A0A446TAS8_TRITD/1-67       AC A0A446TAS8.1
#=GS A0A0R0KP83_SOYBN/1-256      AC A0A0R0KP83.1
#=GS A0A0S4IZP1_BODSA/1-228      AC A0A0S4IZP1.1
#=GS A0A177ECI0_9MICR/1-209      AC A0A177ECI0.1
#=GS A0A093GLP5_DRYPU/1-227      AC A0A093GLP5.1
#=GS Q55CS4_DICDI/1-259          AC Q55CS4.1
#=GS H3FFL4_PRIPA/1-227          AC H3FFL4.2
#=GS A0A452DTY1_CAPHI/1-254      AC A0A452DTY1.1
#=GS A0A0L6WXB0_9AGAR/1-119      AC A0A0L6WXB0.1
#=GS A0A699ZZ65_HAELA/14-122     AC A0A699ZZ65.1
#=GS A0A1M2V4C9_TRAPU/1-194      AC A0A1M2V4C9.1
#=GS Q8I358_PLAF7/1-272          AC Q8I358.1
#=GS A0A397G7V7_9GLOM/9-231      AC A0A397G7V7.1
#=GS A0A0D2EEK0_9EURO/1-227      AC A0A0D2EEK0.1
#=GS A2E1Q4_TRIVA/1-212          AC A2E1Q4.1
#=GS A0A446UQL9_TRITD/1-255      AC A0A446UQL9.1
#=GS A0A1U7LJ67_NEOID/1-257      AC A0A1U7LJ67.1
#=GS A0A4S8K1V1_MUSBA/11-109     AC A0A4S8K1V1.1
#=GS A0A182Y8Z1_ANOST/1-227      AC A0A182Y8Z1.1
#=GS A0A2T9Z7W4_9FUNG/1-253      AC A0A2T9Z7W4.1
#=GS A0A1A8WG65_9APIC/27-275     AC A0A1A8WG65.1
#=GS A0A167RR69_CORFA/1-260      AC A0A167RR69.1
#=GS A0A667Y9K5_9TELE/1-254      AC A0A667Y9K5.1
#=GS A0A1S4BL85_TOBAC/1-254      AC A0A1S4BL85.1
#=GS A0A2K6CB41_MACNE/1-227      AC A0A2K6CB41.1
#=GS A0A673B4R9_9TELE/1-254      AC A0A673B4R9.1
#=GS A0A2A4J6W4_HELVI/1-105      AC A0A2A4J6W4.1
#=GS Q6CJ09_KLULA/1-227          AC Q6CJ09.1
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIE B; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIE C; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIF B; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIE D; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIF C; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIF D; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIE A; 3-227;
#=GS Q6CJ09_KLULA/1-227          DR PDB; 3PIF A; 3-227;
#=GS G7E5Y8_MIXOS/1-281          AC G7E5Y8.1
#=GS A0A6G0WCS2_9STRA/1-229      AC A0A6G0WCS2.1
#=GS A0A0V0X8C8_9BILA/1-227      AC A0A0V0X8C8.1
#=GS A0A446Q6Y1_TRITD/1-174      AC A0A446Q6Y1.1
#=GS Q7RR39_PLAYO/22-332         AC Q7RR39.1
#=GS A0A0F4GWH6_9PEZI/1-264      AC A0A0F4GWH6.1
#=GS A0A3Q1N603_BOVIN/1-254      AC A0A3Q1N603.1
#=GS A0A179FGL4_METCM/1-228      AC A0A179FGL4.1
#=GS A0A1U8PE96_GOSHI/1-254      AC A0A1U8PE96.1
#=GS A0A0L0NJI4_TOLOC/1-260      AC A0A0L0NJI4.1
#=GS A0A428NNP5_9HYPO/1-228      AC A0A428NNP5.1
#=GS A0A5N4EJK2_CAMDR/1-220      AC A0A5N4EJK2.1
#=GS A0A1V6NQ20_9EURO/1-260      AC A0A1V6NQ20.1
#=GS A0A5J4Z7H5_PORPP/1-255      AC A0A5J4Z7H5.1
#=GS A0A4T0WY60_9ASCO/1-226      AC A0A4T0WY60.1
#=GS A0A1R2BZ47_9CILI/1-218      AC A0A1R2BZ47.1
#=GS G3TR92_LOXAF/1-249          AC G3TR92.1
#=GS A0A150H0Y4_GONPE/1-254      AC A0A150H0Y4.1
#=GS A0A0R3PGI5_ANGCS/1-255      AC A0A0R3PGI5.2
#=GS A0A3M9YGP1_9PEZI/1-260      AC A0A3M9YGP1.1
#=GS S7XIZ0_SPRLO/1-280          AC S7XIZ0.1
#=GS A0A059BQ10_EUCGR/1-254      AC A0A059BQ10.1
#=GS V4SZL8_9ROSI/1-255          AC V4SZL8.1
#=GS A0A453LG87_AEGTS/1-62       AC A0A453LG87.1
#=GS A0A2H0ZHN5_CANAR/1-226      AC A0A2H0ZHN5.1
#=GS V4KZA8_EUTSA/1-258          AC V4KZA8.1
#=GS A0A1S7UM85_ROSNE/1-192      AC A0A1S7UM85.1
#=GS A0A669DM79_ORENI/1-228      AC A0A669DM79.1
#=GS B0DJE2_LACBS/1-112          AC B0DJE2.1
#=GS A0A453G1N8_AEGTS/1-46       AC A0A453G1N8.1
#=GS A0A195FBV9_9HYME/1-226      AC A0A195FBV9.1
#=GS A0A669C5I3_ORENI/1-254      AC A0A669C5I3.1
#=GS B9QM92_TOXGV/1-274          AC B9QM92.1
#=GS A0A1E5WG57_9POAL/104-228    AC A0A1E5WG57.1
#=GS A0A1X1BMS0_9APIC/1-255      AC A0A1X1BMS0.1
#=GS N4W242_COLOR/1-228          AC N4W242.1
#=GS A0A6A3W291_9STRA/1-240      AC A0A6A3W291.1
#=GS J8LI80_SACAR/1-254          AC J8LI80.1
#=GS A0A5N4A033_PHOPY/1-255      AC A0A5N4A033.1
#=GS A0A1W0WN69_HYPDU/1-227      AC A0A1W0WN69.1
#=GS A0A4U5MXC0_POPAL/1-252      AC A0A4U5MXC0.1
#=GS A0A4U0Y180_9PEZI/81-338     AC A0A4U0Y180.1
#=GS A6QSX9_AJECN/1-106          AC A6QSX9.1
#=GS I3KR23_ORENI/1-254          AC I3KR23.2
#=GS A0A446UQK9_TRITD/1-255      AC A0A446UQK9.1
#=GS A0A287S1K1_HORVV/1-193      AC A0A287S1K1.1
#=GS A0A0D0A8N9_9AGAM/1-111      AC A0A0D0A8N9.1
#=GS A0A444YK97_ARAHY/84-340     AC A0A444YK97.1
#=GS A0A674EEG6_SALTR/1-227      AC A0A674EEG6.1
#=GS M9LZE8_PSEA3/150-376        AC M9LZE8.1
#=GS A0A058ZGR4_FONAL/1-255      AC A0A058ZGR4.1
#=GS A0A663E9T5_AQUCH/1-159      AC A0A663E9T5.1
#=GS A0A507AFH3_9PEZI/1-227      AC A0A507AFH3.1
#=GS A0A196S5F3_BLAHN/1-264      AC A0A196S5F3.1
#=GS A0A2T7PPQ5_POMCA/342-573    AC A0A2T7PPQ5.1
#=GS A0A158RB82_THECL/1-255      AC A0A158RB82.1
#=GS A0A166TLU3_9PEZI/1-228      AC A0A166TLU3.1
#=GS A0A2H3IC71_9EURO/1-227      AC A0A2H3IC71.1
#=GS A0A673B1F9_9TELE/1-254      AC A0A673B1F9.1
#=GS A0A4Q1BMC1_TREME/10-269     AC A0A4Q1BMC1.1
#=GS A0A022RF37_ERYGU/1-254      AC A0A022RF37.1
#=GS A0A024TZJ4_9STRA/1-254      AC A0A024TZJ4.1
#=GS A0A1Y2FSH6_PROLT/1-204      AC A0A1Y2FSH6.1
#=GS I1NIU2_SOYBN/1-255          AC I1NIU2.1
#=GS V7CRE4_PHAVU/1-254          AC V7CRE4.1
#=GS XRN2_CHAGB/1-261            AC Q2GNZ6.3
#=GS EX0N_IIV3/1-129             AC Q197A1.1
#=GS G3WUI6_SARHA/1-202          AC G3WUI6.1
#=GS C5FQ74_ARTOC/1-271          AC C5FQ74.1
#=GS A0A5N5HRS1_9ROSA/1-254      AC A0A5N5HRS1.1
#=GS A0A059JA80_TRIIM/1-227      AC A0A059JA80.1
#=GS A0A2G4T5Y0_RHIZD/1-103      AC A0A2G4T5Y0.1
#=GS W9YDD3_9EURO/1-263          AC W9YDD3.1
#=GS A0A2Y9P4V0_DELLE/1-227      AC A0A2Y9P4V0.1
#=GS A0A1V2L7M1_CYBFA/63-156     AC A0A1V2L7M1.1
#=GS N1JLE1_BLUG1/1-256          AC N1JLE1.1
#=GS A0A0G2H5N1_9PEZI/1-227      AC A0A0G2H5N1.1
#=GS A0A2G5CP38_AQUCA/14-269     AC A0A2G5CP38.1
#=GS A0A1S3S7N8_SALSA/1-254      AC A0A1S3S7N8.1
#=GS O96143_PLAF7/22-297         AC O96143.3
#=GS A0A0K9PNS8_ZOSMR/1-252      AC A0A0K9PNS8.1
#=GS A0A669EPG4_ORENI/1-254      AC A0A669EPG4.1
#=GS J9DGU0_EDHAE/1-146          AC J9DGU0.1
#=GS A0A1Q5TLH7_9EURO/1-227      AC A0A1Q5TLH7.1
#=GS A0A509ANH7_PLABA/1-272      AC A0A509ANH7.1
#=GS A0A1S3C1K3_CUCME/1-255      AC A0A1S3C1K3.1
#=GS A0A2I0AFS2_9ASPA/1-254      AC A0A2I0AFS2.1
#=GS A0A1B8G7T1_9PEZI/1-259      AC A0A1B8G7T1.1
#=GS A0A0D0DR37_9AGAM/1-139      AC A0A0D0DR37.1
#=GS A0A5M9J850_MONFR/1-227      AC A0A5M9J850.1
#=GS G2WUB1_VERDV/1-228          AC G2WUB1.1
#=GS A0A287S1G7_HORVV/1-193      AC A0A287S1G7.1
#=GS L1JQ07_GUITC/1-72           AC L1JQ07.1
#=GS A0A444UUL6_ACIRT/1-106      AC A0A444UUL6.1
#=GS A0A163ICQ1_DIDRA/1-260      AC A0A163ICQ1.1
#=GS A0A093XUC2_9PEZI/1-227      AC A0A093XUC2.1
#=GS A0A3Q1HBQ5_9TELE/1-254      AC A0A3Q1HBQ5.1
#=GS A0A3Q3FVB5_9LABR/1-227      AC A0A3Q3FVB5.1
#=GS A0A1L8G1K6_XENLA/1-138      AC A0A1L8G1K6.1
#=GS A0A6I8PY77_XENTR/1-227      AC A0A6I8PY77.1
#=GS Q802V7_DANRE/1-254          AC Q802V7.1
#=GS E9I623_DAPPU/1-74           AC E9I623.1
#=GS A0A672FH58_SALFA/1-254      AC A0A672FH58.1
#=GS A0A0L6VCZ5_9BASI/1-260      AC A0A0L6VCZ5.1
#=GS A2DQZ7_TRIVA/1-210          AC A2DQZ7.1
#=GS A0A6G0I4H3_LARCR/1-82       AC A0A6G0I4H3.1
#=GS A0A2U4AQM0_TURTR/1-200      AC A0A2U4AQM0.1
#=GS K3ZNJ9_SETIT/1-246          AC K3ZNJ9.1
#=GS A0A672H024_SALFA/1-227      AC A0A672H024.1
#=GS Q0CAJ2_ASPTN/1-227          AC Q0CAJ2.1
#=GS A0A6I8Q9Y2_XENTR/1-254      AC A0A6I8Q9Y2.1
#=GS A0A058Z4A9_FONAL/1-183      AC A0A058Z4A9.1
#=GS A0A3Q0HU68_PHODC/1-155      AC A0A3Q0HU68.1
#=GS K0R8I2_THAOC/213-485        AC K0R8I2.1
#=GS A0A5F9DTC1_RABIT/1-254      AC A0A5F9DTC1.1
#=GS A0A2H5TG28_RHIID/1-246      AC A0A2H5TG28.1
#=GS A0A478EDD3_9EURO/1-262      AC A0A478EDD3.1
#=GS W4IYI3_PLAFP/1-272          AC W4IYI3.1
#=GS A0A5D2V1U8_GOSMU/1-254      AC A0A5D2V1U8.1
#=GS A0A0D2VHN3_CAPO3/1-199      AC A0A0D2VHN3.1
#=GS A0A6G1DK51_9ORYZ/1-255      AC A0A6G1DK51.1
#=GS U6GNU3_EIMAC/1-237          AC U6GNU3.1
#=GS A0A1J4JV28_9EUKA/1-215      AC A0A1J4JV28.1
#=GS A0A0V1LSW2_9BILA/1-227      AC A0A0V1LSW2.1
#=GS A0A0N4UVD1_ENTVE/1-255      AC A0A0N4UVD1.1
#=GS A0A5E4R330_9NEOP/1-255      AC A0A5E4R330.1
#=GS A0A2H3YEM6_PHODC/1-255      AC A0A2H3YEM6.1
#=GS A0A5N6L020_9ROSI/1-260      AC A0A5N6L020.1
#=GS A0A2G7G2K7_9EURO/1-227      AC A0A2G7G2K7.1
#=GS A0A1X0Q9A5_9MICR/1-228      AC A0A1X0Q9A5.1
#=GS Q5CX86_CRYPI/1-233          AC Q5CX86.1
#=GS N1RBN8_FUSC4/1-228          AC N1RBN8.1
#=GS I1JRL0_SOYBN/1-256          AC I1JRL0.2
#=GS A0A1Y1Z1H6_9PLEO/1-261      AC A0A1Y1Z1H6.1
#=GS D8TGU8_VOLCA/1-110          AC D8TGU8.1
#=GS A0A376B8N0_9ASCO/1-248      AC A0A376B8N0.1
#=GS A0A0P7TSG1_SCLFO/3-229      AC A0A0P7TSG1.1
#=GS A0A5D2XBS3_GOSMU/1-255      AC A0A5D2XBS3.1
#=GS A0A1J4JNJ0_9EUKA/1-210      AC A0A1J4JNJ0.1
#=GS A0A2H5RZS6_RHIID/1-216      AC A0A2H5RZS6.1
#=GS V7AFU3_PHAVU/1-243          AC V7AFU3.1
#=GS L1I795_GUITC/105-215        AC L1I795.1
#=GS W6L1D0_9TRYP/1-251          AC W6L1D0.1
#=GS A0A2P6N6C9_9EUKA/1-110      AC A0A2P6N6C9.1
#=GS A0A2V3J5K0_9FLOR/1-221      AC A0A2V3J5K0.1
#=GS R9P1H8_PSEHS/1-261          AC R9P1H8.1
#=GS C4JYG7_UNCRE/1-259          AC C4JYG7.1
#=GS A0A0P0VB49_ORYSJ/4-229      AC A0A0P0VB49.1
#=GS A0A6Q2ZE25_ESOLU/1-227      AC A0A6Q2ZE25.1
#=GS U6M4E7_EIMMA/54-305         AC U6M4E7.1
#=GS T1G6A0_HELRO/105-208        AC T1G6A0.1
#=GS C5GI48_AJEDR/1-227          AC C5GI48.1
#=GS A0A6P9EY48_JUGRE/1-244      AC A0A6P9EY48.1
#=GS A0A4X2KDA0_VOMUR/1-61       AC A0A4X2KDA0.1
#=GS A0A3B6MUF7_WHEAT/1-261      AC A0A3B6MUF7.1
#=GS A0A368F3K2_ANCCA/1-88       AC A0A368F3K2.1
#=GS W4YBR7_STRPU/19-251         AC W4YBR7.1
#=GS A0A4W3JP97_CALMI/1-108      AC A0A4W3JP97.1
#=GS A0A2B4S4P0_STYPI/1-72       AC A0A2B4S4P0.1
#=GS A0A364KRI8_9EURO/1-262      AC A0A364KRI8.1
#=GS A0A559MK36_9HELO/1-254      AC A0A559MK36.1
#=GS A0A158NKN8_ATTCE/1-255      AC A0A158NKN8.1
#=GS A0A2B7XV02_9EURO/1-227      AC A0A2B7XV02.1
#=GS M4EXU9_BRARP/1-253          AC M4EXU9.1
#=GS A0A091VEU1_NIPNI/1-202      AC A0A091VEU1.1
#=GS S9V051_9TRYP/1-257          AC S9V051.1
#=GS F4NX74_BATDJ/1-207          AC F4NX74.1
#=GS M3ZDG7_XIPMA/1-254          AC M3ZDG7.2
#=GS A0A0V1CMC3_TRIBR/6-260      AC A0A0V1CMC3.1
#=GS A0A0B2VGD9_TOXCA/1-255      AC A0A0B2VGD9.1
#=GS A0A5C2SEY1_9APHY/1-260      AC A0A5C2SEY1.1
#=GS A0A2G9TTQ8_TELCI/81-252     AC A0A2G9TTQ8.1
#=GS A0A509AD01_PLABA/27-180     AC A0A509AD01.1
#=GS A0A151I0L3_9HYME/1-226      AC A0A151I0L3.1
#=GS A0A340WEG5_LIPVE/1-227      AC A0A340WEG5.1
#=GS A0A2K0VTU8_GIBNY/1-260      AC A0A2K0VTU8.1
#=GS A0A183WSW5_TRIRE/1-43       AC A0A183WSW5.1
#=GS A0A0L1JEK4_ASPNO/1-227      AC A0A0L1JEK4.1
#=GS A0A2C9VFT2_MANES/1-255      AC A0A2C9VFT2.1
#=GS S0E960_GIBF5/1-260          AC S0E960.1
#=GS A0A4W3HGM6_CALMI/2-205      AC A0A4W3HGM6.1
#=GS A0A5N6LEW0_9ASTR/1-88       AC A0A5N6LEW0.1
#=GS A0A6P9DT66_JUGRE/1-254      AC A0A6P9DT66.1
#=GS E1JJR3_DROME/1-226          AC E1JJR3.1
#=GS E1JJR3_DROME/1-226          DR PDB; 2Y35 A; 1-226;
#=GS G2QMX3_MYCTT/1-261          AC G2QMX3.1
#=GS A0A2G3CQH0_CAPCH/1-188      AC A0A2G3CQH0.1
#=GS A0A098VPQ9_9MICR/1-267      AC A0A098VPQ9.1
#=GS A0A103XIA8_CYNCS/1-274      AC A0A103XIA8.1
#=GS A0A1L9TU67_9EURO/1-258      AC A0A1L9TU67.1
#=GS A0A072P6C6_9EURO/1-227      AC A0A072P6C6.1
#=GS A0A4U0W7M8_9BASI/1-227      AC A0A4U0W7M8.1
#=GS A0A674DJJ5_SALTR/1-227      AC A0A674DJJ5.1
#=GS A0A2J6L276_LACSA/1-253      AC A0A2J6L276.1
#=GS A0A4W2D5A6_BOBOX/1-254      AC A0A4W2D5A6.1
#=GS A5E1D0_LODEL/1-191          AC A5E1D0.1
#=GS A0A0V0RLT8_9BILA/402-628    AC A0A0V0RLT8.1
#=GS A0A6P9DTH1_JUGRE/1-88       AC A0A6P9DTH1.1
#=GS A0A1Y1S9A8_9MICR/1-224      AC A0A1Y1S9A8.1
#=GS A0A091CUZ0_FUKDA/1-227      AC A0A091CUZ0.1
#=GS A0A225WMS6_9STRA/1-217      AC A0A225WMS6.1
#=GS G2X1E8_VERDV/1-260          AC G2X1E8.1
#=GS A0A5E4M5J6_9HEMI/1-227      AC A0A5E4M5J6.1
#=GS A0A3S2ML78_ORYJA/1-227      AC A0A3S2ML78.1
#=GS A0A177VWG6_9BASI/266-502    AC A0A177VWG6.1
#=GS A0A0D2K225_9EURO/1-262      AC A0A0D2K225.1
#=GS XRN2_ARATH/1-256            AC Q9FQ02.1
#=GS I3KR22_ORENI/1-254          AC I3KR22.2
#=GS A0A3R7FR24_9EURO/1-259      AC A0A3R7FR24.1
#=GS A0A151GWS5_9HYPO/597-824    AC A0A151GWS5.1
#=GS A0A2U1MZ30_ARTAN/1-254      AC A0A2U1MZ30.1
#=GS K8YT85_NANGC/98-157         AC K8YT85.1
#=GS A0A0U1M2G7_TALIS/1-263      AC A0A0U1M2G7.1
#=GS A0A453M1V4_AEGTS/1-184      AC A0A453M1V4.1
#=GS A0A103YET5_CYNCS/1-76       AC A0A103YET5.1
#=GS R1F8E7_EMIHU/1-230          AC R1F8E7.1
#=GS A0A059LEQ3_9CHLO/1-225      AC A0A059LEQ3.1
#=GS A0A0C9UNE1_SPHS4/2-64       AC A0A0C9UNE1.1
#=GS A0A4T0FFW9_9BASI/457-675    AC A0A4T0FFW9.1
#=GS A0A662WSR6_9STRA/1-240      AC A0A662WSR6.1
#=GS A0A1J9R5D8_9EURO/1-227      AC A0A1J9R5D8.1
#=GS A0A3Q0KM62_SCHMA/1-255      AC A0A3Q0KM62.1
#=GS A0A699YY14_HAELA/1-58       AC A0A699YY14.1
#=GS A0A1J1H3H6_PLARL/1-272      AC A0A1J1H3H6.1
#=GS A0A0D2J2I5_9EURO/1-263      AC A0A0D2J2I5.1
#=GS A0A1R4ACC0_BABMR/35-267     AC A0A1R4ACC0.1
#=GS A0A5C7IAZ6_9ROSI/1-274      AC A0A5C7IAZ6.1
#=GS A0A287S1F8_HORVV/1-255      AC A0A287S1F8.1
#=GS A0A0D9YI26_9ORYZ/1-254      AC A0A0D9YI26.1
#=GS A0A340WHL9_LIPVE/1-227      AC A0A340WHL9.1
#=GS A0A2S5BAL3_9BASI/22-280     AC A0A2S5BAL3.1
#=GS A0A0K0FXY2_STRVS/1-255      AC A0A0K0FXY2.1
#=GS A0A446TID5_TRITD/1-255      AC A0A446TID5.1
#=GS C5L4L6_PERM5/1-263          AC C5L4L6.1
#=GS A0A0A1U3U9_ENTIV/1-246      AC A0A0A1U3U9.1
#=GS A0A195DG40_9HYME/1-255      AC A0A195DG40.1
#=GS A0A250XPC0_9CHLO/96-183     AC A0A250XPC0.1
#=GS A0A2H5PP85_CITUN/1-255      AC A0A2H5PP85.1
#=GS J9J940_9SPIT/1-231          AC J9J940.1
#=GS W7KFV7_PLAFO/1-272          AC W7KFV7.1
#=GS X6M175_RETFI/1-190          AC X6M175.1
#=GS A4HXJ2_LEIIN/1-339          AC A4HXJ2.1
#=GS A0A5F4CAE5_CANLF/1-227      AC A0A5F4CAE5.1
#=GS A0A250WZT9_9CHLO/1-227      AC A0A250WZT9.1
#=GS A0A445H9B0_GLYSO/1-254      AC A0A445H9B0.1
#=GS A0A3P6TDV6_CYLGO/1-97       AC A0A3P6TDV6.1
#=GS A0A392S9G0_9FABA/1-62       AC A0A392S9G0.1
#=GS A0A540M2M6_MALBA/544-747    AC A0A540M2M6.1
#=GS G7L0T7_MEDTR/1-256          AC G7L0T7.1
#=GS A0A2G3CQF4_CAPCH/1-73       AC A0A2G3CQF4.1
#=GS A0A250WZP1_9CHLO/19-243     AC A0A250WZP1.1
#=GS XRN2_CAEEL/1-255            AC Q9U299.2
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR C; 4-255;
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR K; 4-255;
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR G; 4-255;
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR A; 4-255;
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR E; 4-255;
#=GS XRN2_CAEEL/1-255            DR PDB; 5FIR I; 4-255;
#=GS E5LBH0_SOLLC/1-250          AC E5LBH0.1
#=GS A0A0E0MCN4_ORYPU/100-226    AC A0A0E0MCN4.1
#=GS A0A2S7QBB8_9HELO/1-227      AC A0A2S7QBB8.1
#=GS A0A4W4F6N7_ELEEL/1-254      AC A0A4W4F6N7.1
#=GS A0A674NXE1_TAKRU/1-192      AC A0A674NXE1.1
#=GS A0A4Z1I9H4_9HELO/1-254      AC A0A4Z1I9H4.1
#=GS G7XMJ6_ASPKW/1-227          AC G7XMJ6.1
#=GS G3PMT1_GASAC/1-227          AC G3PMT1.1
#=GS A0A446Q6S3_TRITD/1-233      AC A0A446Q6S3.1
#=GS A0A2U1P6M5_ARTAN/1-174      AC A0A2U1P6M5.1
#=GS A0A0D2X383_CAPO3/1-227      AC A0A0D2X383.1
#=GS A0A0V1NQL7_9BILA/1-227      AC A0A0V1NQL7.1
#=GS A0A4Z1P3B7_9PEZI/1-227      AC A0A4Z1P3B7.1
#=GS A0A195CJV0_9HYME/1-271      AC A0A195CJV0.1
#=GS A0A5N7ABW2_9EURO/1-257      AC A0A5N7ABW2.1
#=GS A0A168EPA8_CORFA/1-228      AC A0A168EPA8.1
#=GS A0A5B0M2J3_PUCGR/1-260      AC A0A5B0M2J3.1
#=GS A0A0L7KS40_9NEOP/161-202    AC A0A0L7KS40.1
#=GS A0A4W4G9K4_ELEEL/1-227      AC A0A4W4G9K4.1
#=GS A0A2P5XWR8_GOSBA/1-254      AC A0A2P5XWR8.1
#=GS A0A5N6DMG7_ASPPA/1-227      AC A0A5N6DMG7.1
#=GS A0A443S2N9_9ACAR/1-201      AC A0A443S2N9.1
#=GS A0A672GG90_SALFA/1-227      AC A0A672GG90.1
#=GS A0A0V0R0K4_PSEPJ/1-239      AC A0A0V0R0K4.1
#=GS A0A4T0IMD1_WALIC/22-282     AC A0A4T0IMD1.1
#=GS A0A0K9P6W8_ZOSMR/1-254      AC A0A0K9P6W8.1
#=GS A0A0V0U8V8_9BILA/1-255      AC A0A0V0U8V8.1
#=GS A0A094A2G7_9PEZI/1-227      AC A0A094A2G7.1
#=GS A0A1B8CJK0_9PEZI/1-259      AC A0A1B8CJK0.1
#=GS A0A453G1M9_AEGTS/5-230      AC A0A453G1M9.1
#=GS A0A4Y7RQB8_9AGAR/1-260      AC A0A4Y7RQB8.1
#=GS A0A1Z5R981_SORBI/1-254      AC A0A1Z5R981.1
#=GS A0A545VNG8_9HYPO/1-260      AC A0A545VNG8.1
#=GS A0A5F4CKN1_CANLF/1-254      AC A0A5F4CKN1.1
A0A1Y2C8V8_9FUNG/1-177                 ..............................................................MGI..P..A...LF.R..W..L.S.NKY.....PKVTSQCVEekprehng.....................................................................................iiipvdysQPN.....................PNGC..EFD.N...LYLDM......NG..IIHPCC.................................HP-........................----ED...KPAPN.SE....DEM.M......V.E.I.FK..Y.IDR.I.L.G.....II...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASQEAAEK-...........................-GG...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-KKAAFDS.N........CIT......P.............G...........TPFMANL..AVALRY.YISD......RLN....K.D..............PA.............................................W..K.......D...VS.F-..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------sicy......................................................................................................................................................
A0A673C7Z9_9TELE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVYN......KLS....T.D..............KM.............................................W..Q.......K...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....A....EK....................................................................AK.....P.GH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A026VVA8_OOCBI/1-255                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSVIVECIE.....................................................................................................QKQistdgvcv.....pvnsadpnPNGI..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.DE....DEM.M......E.A.I.FE..C.IDR.L.F.R.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETTEKI...........................NEI...........-...-GRI.RS..EL..V..L...K...G...A...S..LPp....................................................................................................................ekPKEEHFDS.N........CIT......P.............G...........TPFMARL..SACLHY.YIHE......RLN....N.D..............PG.............................................W..R.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................SQ.....P.DH..D.P.NTQ.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A493U3T8_ANAPP/1-227                 ..............................................................MGV..P..K...FY.R..W..V.S.ERY.....P-CLSQVLK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.HH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFALLREE..........................................................................................................................................................
A0A0L7QSP1_9HYME/1-226                 ..............................................................MGI..P..K...FF.R..Y..I.S.ERY.....PCLTEKLK-.....................................................................................................--D.....................HQIP..EFD.N...LYLDV......NG..IIHSCS.................................HP-........................---DED...ILFRI.TE....ENI.F......K.N.I.FC..Y.LEL.L.F.R.....MI...Q.........P....Q....K......L..FFIA...........................I......D..............GV................APR.AKIN.NQ........R.SRR...FRSAKYAETQ-...........................-EA...........K...L-K-.--..--..-..-...A...K...G...V..IL.......................................................................................................................PEQPKFDS.N........CIT......P.............G...........TIFMAKL..DDYLKY.FISY......KIS....T.D..............KF.............................................W..Q.......K...CK.II..FSGS......Q...........V.........PGEGEHKIM.DYI.R....Y....MK....................................................................AQ.....P.DY..D.I.NTK.....................HCLYG.............L............D...AD.L................I..M.LGLC........T.H.E..IHFTLLREE..........................................................................................................................................................
A0A428TB95_9HYPO/1-228                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...VSFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...A--I.R-..--..-..-...-...E...G...V..EL.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SQQLRY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2Y9I4D0_NEOSC/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkvpvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A4W4G9L5_ELEEL/1-107                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.VEV.L.F.R.....IV...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRG--------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------sgc.......................................................................................................................................................
B9R871_RICCO/1-254                     ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVVDAIEeepvvidg.....................................................................................vkipvdasRPN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....EEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDREEA-...........................-AA...........E...EERL.RQ..EF..E..R...E...G...R...K..LPp.....................................................................................................................kESSQVFDS.N........IIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....N.D..............PG.............................................W..K.......K...VK.VI..LSDA......N...........V.........PGEGEHKVM.SYI.R....L....QR....................................................................NL.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..IHFSILRE-i.........................................................................................................................................................
A0A2I0RIT6_9PEZI/1-263                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIISPVVEeha..............................................................................................qkvqN-Adgsetvi......pidargpnPNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......I.A.I.FE..Y.TER.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKD...........................AEA...........-...-AEF.HA..RM..V..A...N...G...E...R..SAdge.................................................................................................................gadKPKKTWDS.N........SIT......P.............G...........TPFMDLL..AQSLRY.WISY......KLS....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.DH..D.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRILRE-d.........................................................................................................................................................
A0A0C3BBY3_PILCF/1-109                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIIYPVVEdeeie..........................................................................................vpdeneN-Nikvpv..........nmasanPNGT..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPE.TE....EEM.M......V.E.I.FN..Y.TER.I.V.N.....MI...R.........P....R....K......L..LFLA...........................M......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------as........................................................................................................................................................
A0A2G5CMU8_AQUCA/14-269                ..............................................................MGI..P..A...FY.R..L..L.L.EKY.....PNTVVDVIEesscwing.....................................................................................vevpvdltNQN.....................PNGF..EFD.N...LYLDM......NG..IIHPCF.................................HPS........................----GP...DPPPN.SY....EEV.F......K.A.I.FK..Y.IDR.I.F.S.....IV...R.........P....R....K......V..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAADAA...........................AEE...........E...--KL.RS..AF..E..T...E...R...E...K..LSv....................................................................................................................lqNNSQCMDS.N........IIT......P.............G...........TEFMASL..SSALQY.YIHL......RMN....T.D..............PG.............................................W..H.......D...IK.VI..LSDA......N...........V.........AGEGEHKIM.AYI.R....L....QR....................................................................NL.....R.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..IHFSILRE-d.........................................................................................................................................................
K7ILW6_NASVI/1-227                     ..............................................................MGV..P..K...FF.R..Y..I.S.ERY.....PCLSEKLKE.....................................................................................................-YQ.....................--IP..EFD.N...LYLDM......NG..IIHNCS.................................HP-........................--NDAD...ATFRI.TE....ETI.F......K.N.I.FH..Y.IEI.L.F.R.....II...Q.........P....Q....K......L..FFMA...........................V......D..............GV................APR.AKIN.QQ........R.GRR...FRAAKEAEVL-...........................-EA...........K...AR--.--..--..-..-...A...K...G...Q..EI.......................................................................................................................PKEARFDS.N........CIT......P.............G...........TVFMSKL..NEQLKY.FITY......KIS....T.D..............KL.............................................W..Q.......K...CK.II..LSGS......E...........V.........PGEGEHKIM.DYI.R....Y....MK....................................................................AQ.....P.DY..E.G.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A1S2Y4K7_CICAR/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVIVDAVEeepvvieg.....................................................................................vsipidtsKEN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....EEV.F......Q.L.M.FD..Y.IDR.L.F.N.....MV...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDATDA-...........................-AA...........E...ESRL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kEESQTFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....N.D..............PG.............................................W..T.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....E.GC..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A383W1T1_TETOB/1-224                 ..............................................................MGI..P..G...FN.T..W..F.Y.ENN.....KAAYQPLA-.....................................................................................................---.....................--QT..TVD.H...VYIDM......NS..VLHNVL.................................RK-........................------...---AE.NY....DKY.H......A.L.L.HK..R.LDA.I.L.R.....LT...N.........P....R....K......S..VMLA...........................I......D..............GP................APL.AKLI.TQ........R.ERR...KKTFSVESRK-...........................-KG...........Q...QQQG.GG..SS..S..G...S...S...K...G..KK.......................................................................................................................ARSNVVSS.T........ALT......P.............G...........TPFMHDV..CVSCCY.YVCA......RLA....-.N..............RK.............................................W..Q.......H...LE.WE..LSGP......T...........V.........AGEGEVKIL.GRL.A....R....PR....................................................................HD.....D.SV..S.P.ADT.....................HMIVG.............D............D...AD.L................I..L.MALV........S.S.T..PRLHILN--sa........................................................................................................................................................
A0A1S8W4B0_9FUNG/1-255                 ..............................................................MGI..P..A...LF.R..W..L.S.TKY.....PKVTSQCVEetpvtigd.....................................................................................qtipvdasQPN.....................PNGA..EYD.C...LYLDM......NG..IIHPCC.................................HP-........................----ED...RPAPT.TE....DEM.Y......I.E.I.FK..Y.IDR.I.M.S.....II...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEEQLKN...........................EA-...........-...EDRI.RK..EL..E..E...K...G...H...M..AQd....................................................................................................................pvTKKQHFDS.N........CIT......P.............G...........TPFMDQL..AICLRY.YVAK......KLN....E.D..............AG.............................................W..D.......G...LK.VI..ISDA......S...........I.........PGEGEHKIM.DYI.R....R....QR....................................................................NQ.....P.GY..D.P.QTH.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..PHFNILRE-d.........................................................................................................................................................
A0A6A6MC68_HEVBR/1-254                 ..............................................................MGI..P..A...FY.R..W..L.A.EKY.....PMVVVDVIEeesvvieg.....................................................................................vkipvdtsKSN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPA.SF....EEV.F......Q.C.M.FD..Y.IDR.L.F.A.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-EA...........E...EARL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kEGSQVFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YVHL......RLN....Y.D..............PG.............................................W..K.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GY..N.A.NTH.....................HCLYS.............L............D...AD.L................I..M.FALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A2C5XDE6_9HYPO/1-104                 ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISSVVEeqpvtled....................................................................................gttipvdttSRN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPK.DE....EAM.M......L.E.V.FR..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------a.........................................................................................................................................................
G1SGA9_RABIT/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................KKA...........-...V---.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A1Y1Y0N8_9FUNG/11-229                ............................................................lt---..-..A...FF.E..T..N.S.QKY.....PQCFQHVNE.....................................................................................................NRV.....................CNYL.kNID.N...LYVDL......NG..IIHSSC.................................QA-........................--RLAA...PKTKF.SE....ETV.F......G.A.V.TS..Y.LAY.L.V.K.....RI...K.........P....K....K......L..LFVA...........................I......D..............GV................SPR.AKLN.QQ........R.ARR...FSSVQSLARN-...........................-SK...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-NTRAFDT.N........SIT......P.............G...........TEFMNDL..SSHLED.FVRR......QVS....K.D..............AD.............................................W..Q.......K...LQ.VL..VSNH......E...........V.........PGEGEHKIL.EFL.R....N....AS....................................................................ES.....S.DY..S.P.DHR.....................HCLYG.............S............D...SD.L................I..I.LGLL........S.H.E..PNFVVMKE-k.........................................................................................................................................................
C1N8M8_MICPC/71-315                    ..........................................................gvgs---..-..G...FG.K..W..M.Q.KTY.....PECFETHGGlrgqgdggggrggrg.......................................................................rggrgtagrgggrpvDPQ.....................RTQL.gTYD.H...VYVDV......NN..VLHVAA.................................HH-........................------...---TK.TE....EAF.F......K.K.L.FA..L.LDR.T.M.R.....LT...R.........P....Q....Y......T..VTLA...........................L......D..............GP................API.AKTI.TQ........R.RRR...IRLSSGEKVP-...........................-LS...........E...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-DAPRLLK.I........GLT......P.............G...........STLALRI..DRALEY.YAAT......RLL....S.R..............NH.............................................L.pR.......G...VL.FE..ISGT......R...........V.........PGEGEVKVL.RSM.K....T....RE....................................................................KN.....A.RF..K.G.-HS.....................HLIVS.............E............D...SD.A................L..L.LALT........A.E.P..ANVFVLS--sk........................................................................................................................................................
A0A2C5ZEF6_9HYPO/1-222                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQVIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...ATFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..AM.......................................................................................................................PKEEPFDR.-........---......-.............-...........TVFMAKL..SQQLRY.FVNK......KIS....E.D..............TE.............................................W..Q.......G...CE.VV..LSGH......D...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.GY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A6P9E6Q2_JUGRE/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVVDVIEeepvvieg.....................................................................................vqipvdtsKPN.....................PNNM..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TY....TEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASDA-...........................-AA...........E...EARL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kQESQVFDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHL......RLN....N.D..............PG.............................................W..E.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYV.R....L....QR....................................................................NL.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..IHFSILRE-i.........................................................................................................................................................
A0A367JYG0_RHIAZ/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.DKF.....PKVVTPAVEerpkivng.....................................................................................tvipvdttKPN.....................PNNE..EFD.N...LYLDM......NG..IIHPCC.................................HP-........................----EN...KPAPA.TE....DEM.M......V.E.I.FN..Y.LDR.I.V.D.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQLAQIEQ...........................EA-...........-...NERV.AQ..EL..A..Ai.gQ...E...H...Q..LK.......................................................................................................................KKEEHFDS.N........CIT......P.............G...........TPFMAHL..ATCLRY.HIAS......KQN....T.D..............PL.............................................W..K.......N...LK.VI..LSDA......T...........V.........PGEGEHKVM.EFI.R....V....ER....................................................................SR.....P.EH..N.P.NTS.....................HVMYG.............L............D...AD.L................I..M.LALG........T.H.E..PHFKIIRE-d.........................................................................................................................................................
A0A669CGX0_ORENI/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KSRV.RE..EV..I..Q...K...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AQCLRY.YVAE......RLT....N.D..............PG.............................................W..K.......N...IV.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................GQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
S8A7I2_DACHA/3-228                     ...................................................sislnqwakpp---..-..-...--.-..-..-.-.-RY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.A...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....EKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDNEKAY...........................QKA...........-...-LK-.--..--..-..-...-...D...G...V..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TVFMAKL..SRQLQY.FVNK......KVS....E.D..............VD.............................................W..Q.......G...VE.II..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....AK....................................................................AQ.....P.GY..D.P.NLR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A1J1H2Q3_PLARL/22-284                .............................................................c-GI..P..G...LH.K..W..L.I.NNF.....PSCVKVVHKnnlldikn....................................................................................fkrnikintTKK.....................KENI.fEVD.N...LLFDL......NQ..LLHKAN.................................V--........................------...--KFI.SY....DNY.F......F.K.L.SI..L.IKN.V.L.K.....KF...H.........P....S....K......N..VIFA...........................I......D..............GI................CPF.SKLK.LQ........I.KRR...AKVKSQENEN-...........................-LH...........-...---I.--..--..-..-...-...-...-...-..--.......................................................................................................................-SENDKYI.N........DIT......C.............G...........SIFINKI..SYFLVN.FVKY......L-S....S.L..............QK.............................................Y..E.......N...VK.FF..VSTD......K...........E.........IGEGELKLM.NWI.N....N....YVyieknkkktnnknn.......................................dnsnkpqrdinifagD-.....-.--..-.-.--Nkkyyk..........nveeesFVIVG.............A............D...AD.L................L..L.QCLA........L.D.N..---------ihnifiyty.................................................................................................................................................
A0A1L8GAL1_XENLA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.TE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................KKA...........-...----.--..--..-..V...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMVRL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VS.IY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....QK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..VQFSLLREE..........................................................................................................................................................
A0A2P8YJ30_BLAGE/1-131                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....ASVIVPCIE.....................................................................................................EK-.....................----..VC-.-...----L......NL..FIPHIS.................................---........................------...---PK.DE....DEM.M......V.A.I.FE..C.IDR.L.F.R.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETVEK-...........................-IQ...........E...VARI.RS..EL..A..A...K...G...C...H..LPp....................................................................................................................ekPKGSHFDS.N........CIT......P.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------pd........................................................................................................................................................
A0A559M6Q3_9HELO/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDD...ATFRM.SE....EQM.F......L.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVENA-...........................-RE...........K...AIR-.--..--..-..-...-...E...G...K..EM.......................................................................................................................PKEEAFDS.N........SIT......P.............G...........TEFMHKL..TQQLKY.FINK......KVS....E.D..............VE.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKVM.EYI.R....L....AK....................................................................AQ.....P.DY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
G9MDR0_HYPVG/1-170                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCT.................................HKD........................--AGED...ATFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...--AI.RE..--..-..-...-...-...G...I..EL.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SQQLRY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..D.P.NAR.....................-----.............-............-...--.-................-..-.----........-.-.-..---------ngfgv.....................................................................................................................................................
A0A673CHZ9_9TELE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVYN......KLS....T.D..............KM.............................................W..Q.......K...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....A....EK....................................................................AK.....P.GH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
D2VA46_NAEGR/1-277                     ..............................................................MGV..P..F...LF.S..F..L.L.SEC.....PEMIKEIIP.....................................................................................................SSSas.................ssSNTT.mTID.H...LYLDM......NG..IIHTFKdtnlqtkll...............erlvsssssS-Ss.....................ssSSNNEE...VEIPM.TM....EKF.I......F.S.I.LL..Y.LEE.V.I.Y.....RF...R.........P....S....K......T..LMFA...........................L......D..............GS................APC.AKIN.QQ........R.ERR...WVSFNNHSGLPkrh.....................hhhH-Qhg.......nhH...GEQH.DL..HH..G..E...E...N...R...K..KK.......................................................................................................................EDESLFDS.I........SIT......S.............G...........TSFMKEL..SEHLQF.FIKR......KLQ....D.D..............PN.............................................W..R.......N..iEN.II..FSDS......S...........V.........FGEGEHKIM.SHI.R....K....VQ....................................................................QI.....P.NR..K.S.-EK.....................FMIYG.............M............D...SD.L................I..L.LSLV........T.H.E..EDIYVLRD-w.........................................................................................................................................................
A0A2B7XT24_9EURO/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEMA-...........................-KE...........K...AIN-.--..--..-..-...-...Q...G...I..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMAKL..TQQLKY.FINK......KVS....E.D..............VE.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.GY..H.P.DIR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2I4GWW7_JUGRE/1-248                 ..............................................................MGV..P..A...FY.R..W..L.I.QKY.....PKALVEATEetgv............................................................................................sidtaSPN.....................PNGI..EFD.H...LYLDM......NG..IIHPCF.................................HP-........................---EDH...PCPPK.TF....EDV.F......N.N.I.FL..Y.IDH.L.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRL...FRTAKDREIAE...........................AEE...........D...RLRI.QF..KM..D..G...K...P...V...L..PK.......................................................................................................................HECEVEDS.N........VIT......P.............G...........TEFMYKL..SEALRS.YISS......RIN....N.D..............PG.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFV.R....Q....QR....................................................................RV.....A.GY..N.P.DTR.....................HCIYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A1D6JAP9_MAIZE/1-231                 ..............................................................MGI..P..S...FY.K..W..V.V.SKY.....PSIISPVKD.....................................................................................................EPEe...................cPDGI..IYD.N...LYLDM......NC..IIHCCF.................................HPQd.....................qlTHADID...VRPPT.TA....NEV.F......E.S.M.FE..Y.MDR.L.F.R.....IV...R.........P....T....S......L..LYLA...........................V......D..............GV................APF.AKMN.RI........R.RGR...FHSAMERLAE-...........................-EP...........P...----.--..--..-..-...-...-...-...-..-R.......................................................................................................................EISEVSDP.N........VIS......P.............G...........TEFMEKV..SEALEY.YIRA......RFN....S.D..............PW.............................................W..R.......D...IM.VI..LSDA......S...........V.........PGEGEHKIM.SFI.R....A....QC....................................................................SM.....E.GY..D.P.NTR.....................HCLFG.............H............D...AD.L................I..M.LALA........S.H.E..VYFSILRE-d.........................................................................................................................................................
A0A067HAI5_CITSI/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVADVIEeepvvidg.....................................................................................vkipvdtsKPN.....................PNGL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPAPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKDAADS-...........................-AA...........E...EERL.RQ..EF..E..R...E...G...R...K..LPp.....................................................................................................................kSDSQVFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....N.D..............PG.............................................W..E.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYV.R....L....QR....................................................................NL.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
V7BMD8_PHAVU/1-248                     ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSIVDVVE.....................................................................................................EDAggavd...........vskpnPNGM..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----DG...KPAPA.TY....EDV.F......K.I.M.FD..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LFLA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAAEAA...........................AEK...........-...-ERL.RE..EF..E..G...Em.eL...L...S..SK.......................................................................................................................DKPETYDS.N........VIT......P.............G...........TPFMAVL..SVALQY.YIQT......RLN....Y.N..............PG.............................................W..Q.......N...TK.VI..LSDS......N...........V.........PGEGEHKIM.EYI.R....S....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A0M9G179_9TRYP/1-251                 ..............................................................MGI..A..G...FF.L..W..L.Q.RWY.....ADCIDNIPQevvdaa.........................................................................................lhgnalP-P....................dHCSA.yAYD.N...LYVDM......NG..LIHPCC.................................HD-........................---TAP...LPEPE.NE....EEM.F......E.R.M.FE..Q.LDL.L.V.K.....VV...R.........P....K....K......C..LVLC...........................I......D..............GV................APR.SKMN.QQ........R.SRR...FRAADERLESD...........................-AI...........S...NACA.DR..IV..T..E...F...K...L...P..RP.......................................................................................................................RVRERWDH.N........VIT......P.............S...........TAFMERV..ALALEW.YIMK......KLN....E.D..............EN.............................................W..R.......H...LT.VV..FSDA......H...........V.........PGEGEHKIM.QYI.R....G....LR....................................................................SQ.....P.GY..D.F.HTT.....................HVIHG.............M............D...AD.L................I..C.LGLS........T.H.E..QHVSILRN-q.........................................................................................................................................................
A0A1M2VSK3_TRAPU/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIILPVVEaeatkvpgdd................................................................................gnevtvpvlmtDPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......I.E.I.FT..Y.TER.V.V.N.....MV...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAQEAKEKE...........................EAH...........K..eSVIL.WE..AM..G..K...T...L...S...E..DE.......................................................................................................................KSKKPWDS.N........AIT......P.............G...........TPFMDIL..SASLRY.WVVN......KMN....T.D..............PG.............................................W..A.......D...IQ.VI..ISDA......S...........V.........PGEGEHKIM.DWI.R....R....QR....................................................................SN.....P.GH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A2P6UZ56_9CHLO/344-447               .............................................................t-GI..P..K...FY.R..W..L.S.ERY.....P-LVNQPGG.....................................................................................................ATV.....................--VP..IID.N...LYLDM......NG..IIHNCT.................................HG-........................----NN...PEVTL.SE....DEM.I......M.K.I.FT..Y.LDK.L.F.H.....IV...K.........P....Q....K......L..LFMA...........................I......D..............GS................APR.AKMN.QQ........R.ARR...FKSA-------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------f.........................................................................................................................................................
A0A663E2T5_AQUCH/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSQVLK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.HH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFALLREE..........................................................................................................................................................
A0A195EHK9_9HYME/1-226                 ..............................................................MGV..P..K...FF.R..Y..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.Y...LYLDM......NG..IIHTCS.................................HP-........................---NDD...VCFRI.SE....EMI.F......K.N.I.FH..Y.IEV.L.F.N.....MI...R.........P....Q....K......L..FFMA...........................I......D..............GV................APR.AKIN.QQ........R.GRR...FRAAKDAEVQ-...........................-EA...........K...A---.--..--..-..K...S...K...G...I..PI.......................................................................................................................PKEKRFDS.N........CIT......P.............G...........TLFMAKL..GEQLKC.FVEH......KVS....T.D..............DA.............................................W..K.......K...CK.IL..FSGS......E...........V.........PGEGEHKIM.DYI.R....Y....MK....................................................................AS.....K.NY..D.N.DSS.....................HCLYG.............L............D...AD.L................I..M.LGLC........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A2Y9JH29_ENHLU/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A2K5JHP2_COLAP/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A545VTQ3_9HYPO/1-228                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PPISQLIA-.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...TTFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALEVEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TDFMAKL..SRQLQY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................SQ.....P.GY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFSLLREE..........................................................................................................................................................
A0A5D2WM57_GOSMU/1-89                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........--FMYRL..SKKLEG.YIES......RMN....D.D..............SS.............................................W..K.......G...IQ.VI..VSDA......N...........V.........PGEGEHKIM.SFI.R....Y....QQ....................................................................CL.....P.GY..D.C.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-d.........................................................................................................................................................
A0A2U1MB98_ARTAN/1-202                 ..............................................................MGV..P..A...FY.R..W..L.A.ERY.....PLVISDVIEeqpveing.....................................................................................ikipvdttNPN.....................PNNI..EYD.N...LYLDI......NN..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADVA...........................--A...........E...EEKL.RE..EF..E..R...E...G...R...K..LPr.....................................................................................................................kQESQTFDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YENK......SKD....K.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------egrvieigeeefngevin........................................................................................................................................
XRN1_SCHPO/1-226                       ..............................................................MGI..P..K...FF.R..W..M.S.ERY.....P-LCSQLIE.....................................................................................................NDR.....................-IP-..EFD.N...LYLDM......NG..ILHNCT.................................HK-........................--NDDH...SSPPL.PE....EEM.Y......I.A.I.FN..Y.IEH.L.F.E.....KI...K.........P....K....K......L..LYMA...........................V......D..............GC................APR.AKMN.QQ........R.SRR...FRTAKDAHDA-...........................-RL...........K...AER-.--..--..-..-...-...-...N...G..ED.......................................................................................................................FPEEQFDS.N........CIT......P.............G...........TTFMERV..SRQLYY.FIHK......KVT....N.D..............SQ.............................................W..Q.......N...IE.VI..FSGH......D...........C.........PGEGEHKIM.EYI.R....T....QK....................................................................AQ.....P.SY..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
XRN2_USTMA/1-261                       ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PRIVSSVQEedpktapgpd................................................................................gteitlpldtsTPN.....................PNGE..EFD.C...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......V.E.V.FA..Y.TER.V.V.N.....MV...R.........P....R....R......L..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKEAREKH...........................EEEq.........aA...LAEW.KA..KG..L..G...A...T...D...D..EK.......................................................................................................................KSKRAWDS.N........AIT......P.............G...........TPFMDLL..AASLRY.WVAQ......KIN....S.D..............PG.............................................W..K.......D...IQ.VI..ISDA......S...........V.........PGEGEHKIM.EHI.R....R....QR....................................................................SH.....P.EH..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PYFKVLRE-d.........................................................................................................................................................
A0A0A1UAI0_ENTIV/116-220               ..........................................................gnsg---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................---TSFDS.N........CIT......P.............G...........TPFMERL..SVALHA.YVTN......RMD....T.N..............LY.............................................W..S.......S...LS.VI..LSNP......N...........V.........PGEGEHKIF.DFL.R....K....ES....................................................................KN.....T.DF..-.A.NLK.....................HCVYG.............M............D...AD.L................I..M.LTLA........S.N.L..PFVYIIREE..........................................................................................................................................................
A0A2R6RBF7_ACTCC/67-116                ............................................................dg---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........------KIM.SYI.R....L....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
B4LVQ4_DROVI/1-256                     ..............................................................MGV..P..A...FF.R..W..L.S.KKY.....PCVIIECNE.....................................................................................................NKRvdvetgkt....ifedstlpnPNGV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....EEM.M......V.A.I.FD..C.IDR.L.F.G.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKETIEKR...........................--L...........E...IERI.RN..EL..L..T...R...G...C...K..LPp....................................................................................................................ekEKGEHFDS.N........CIT......P.............G...........TPFMDRL..SKCLHY.YIHD......RLN....N.N..............PA.............................................W..K.......G...IQ.VI..LSDA......N...........V.........PGEGEHKIM.DYI.R....K....QR....................................................................AQ.....P.DH..N.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A699ZN34_HAELA/1-109                 ..............................................................MGI..P..K...FY.R..W..L.S.ERY.....PLLNQKVT-.....................................................................................................-AT.....................EGPP..EID.N...LYLDM......NG..IIHNCT.................................HAN........................-----Q...REVKL.GE....DDM.M......L.R.I.FD..Y.IDK.L.I.Q.....II...K.........P....Q....K......L..LFMA...........................I......D..............GC................APR.AKMN.QQ........R.SRR...FKSAKEAE---...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------e.........................................................................................................................................................
Q6FL64_CANGA/1-228                     ..............................................................MGI..P..K...FF.R..Y..I.S.ERW.....PMILQ-LIE.....................................................................................................GTQ.....................-IP-..EFD.N...LYLDM......NS..FIHTCT.................................HGN........................--DDEG...VTQKM.SD....EEL.Y......S.R.I.FT..Y.IDH.L.F.L.....MI...K.........P....K....K......V..FYMS...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAMDTEKA-...........................-LQ...........K...AMD-.--..--..-..-...-...E...G...E..EI.......................................................................................................................PKGDAFDS.N........CIT......P.............G...........TEFMAQL..TRNLNY.YIHD......KVT....N.D..............AN.............................................W..R.......D...IE.VI..LSGH......E...........V.........PGEGEHKIM.DFI.R....N....IT....................................................................AQ.....E.DY..D.V.NTR.....................HCIYG.............L............D...AD.L................I..M.LGLS........T.H.A..PHFALLREE..........................................................................................................................................................
A0A507C155_9FUNG/1-227                 ..............................................................MGI..P..K...FF.R..W..M.S.ERY.....PLCSQLVT-.....................................................................................................-ET.....................-NIP..EFD.N...LYLDM......NG..IIHSCS.................................HP-........................--NDGD...VHFRM.SE....EAV.F......L.A.I.FN..Y.IDA.L.F.G.....KI...K.........P....K....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTAKDAVEA-...........................-RK...........K...AEK-.--..--..-..-...-...K...G...E..AL.......................................................................................................................PKEPPFDS.N........CIT......P.............G...........TEFMTKL..STQLKY.FVNK......KMS....E.D..............AS.............................................W..H.......G...VQ.VV..LSGH......E...........V.........PGEGEHKIM.EYL.R....L....AK....................................................................SR.....P.DY..D.P.NNR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.E..PHFALLREE..........................................................................................................................................................
A0A0N0VDQ4_9TRYP/1-344                 ..............................................................MGV..P..K...FA.A..W..L.T.KKY.....PAMVVDRC-.....................................................................................................---.....................--PA..DVH.G...LYIDL......NG..LIHPCC.................................HD-........................--EHDA...TVALR.TE....VEK.M......R.S.V.CL..A.IET.L.V.V.....TV...K.........P....Q....R......V..LYIA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...YMSAATPLTNTekpicssgg........heisaavvaaT--...........-...----.EA..--..-..-...-...-...-...-..-Eftaaertgaekeledvrqallgdvlyggdgdpta..................................................psaaadcafspvaplqeataqpeigvpfaavgaaeDYDERFDS.N........CIS......P.............G...........TAFMDKV..AATVRD.FVKR......KLM....T.A..............ETkadsgdvtegcgddpltwa.......sgtstattaataapsapspW..A.......Q...LT.VV..FSDS......N...........T.........AGEGEHKFV.DFL.R....T....QS....................................................................AF.....P.GF..N.G.SGC.....................HVIAG.............L............D...AD.L................I..F.LSLS........L.H.I..PRVVILRD-h.........................................................................................................................................................
A0A4Q7KAK4_METCM/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVIEdqpvvmp.......................................................................................dgsvvpvD-Ttg.................rnPNGE..EFD.N...LYLDM......NG..IVHPCA.................................HP-........................----ED...KPAPE.DE....EAM.M......L.E.V.FR..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQDAQEK-...........................-EE...........N...KKEL.LK..LV..K..Q...Q...N...G...G..VLppe................................................................................................................hiesVSKKVFDN.N........SIT......P.............G...........TPFMDIL..AVSLRY.WCQY......KLN....T.D..............PA.............................................W..A.......K...MK.VL..ISDA......T...........V.........PGEGEHKIM.SFI.R....S....QR....................................................................AS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A401KU98_ASPAW/1-259                 ..............................................................MGV..P..A...LF.R..W..L.S.NKY.....PKIISPVIEefpqeing.....................................................................................eevpvdttRPN.....................PNGD..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPA.NE....QEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAREAD...........................EKKee.......frK..mLEKQ.NG..KK..E..D...E...D...M...Q..EH.......................................................................................................................VIQKTWDS.N........VIT......P.............G...........TPFMDIL..AAALRY.WIAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................AS.....P.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PYFRVLRE-d.........................................................................................................................................................
A0A2K6U3J3_SAIBB/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A287SKG8_HORVV/66-260                ......................................................fgplslpt---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...QPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A4W3JP83_CALMI/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVVHCLEervkevng.....................................................................................vkipvdtsKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----EN...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IL...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVELL...........................A--...........E...KTRM.RE..EV..I..S...K...G...Gf.lS..EE.......................................................................................................................VIKERFDS.N........CIT......P.............G...........TEFMDNL..ARSLRY.YVAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
K2NUF7_TRYCR/1-228                     ..............................................................MGV..P..K...FF.R..W..V.A.ERY.....PTVITPFRD.....................................................................................................---.....................-SPP..PVD.N...LYLDM......NG..IIHNCT.................................HTN........................D--VDA...TQKSP.TE....KAM.M......E.A.M.FA..Y.LEK.L.F.N.....VI...Q.........P....R....K......Y..FFLA...........................V......D..............GV................APR.AKMN.QQ........R.QRR...YRSGYDLMVA-...........................-RQ...........E...----.--..-A..I..A...Q...G...E...E..VP.......................................................................................................................DEKDVFDS.N........CIT......P.............G...........TNFMVRV..SEQLQY.FITM......KIA....M.D..............PA.............................................W..Q.......N...CQ.VV..YSGH......D...........S.........PGEGEHKIV.DFI.R....R....RK....................................................................MQ.....P.EY..S.P.NET.....................HCMYG.............L............D...AD.L................V..M.LSLA........T.H.E..PHFLLLRE-v.........................................................................................................................................................
A0A091LJ28_CATAU/3-233                 ..............................................sqakecngvkapidts---..-..-...--.-..-..-.-.---.....---------.....................................................................................................KPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..C.IDR.I.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AE...........E...KQKI.RQ..EI..L..A...K...G...G...I..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....S.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1W4WPN4_AGRPL/1-227                 ..............................................................MGV..P..K...FF.R..Y..I.S.ERY.....P-CLSEVVK.....................................................................................................EYQ.....................--LP..EFD.N...LYLDM......NG..IIHTCS.................................HP-........................--DDGD...PHFRI.TE....EKI.F......R.D.I.FH..Y.IEV.L.F.R.....MI...K.........P....Q....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRTAKEALEL-...........................-EQ...........K...ALA-.--..--..-..-...-...K...G...E..KL.......................................................................................................................PTQARFDS.N........CIT......P.............G...........TEFMVKL..QEQLKY.FIVT......KIS....T.D..............PL.............................................W..Q.......K...CK.IV..LSGH......E...........T.........PGEGEHKIM.DYI.R....Y....MR....................................................................SQ.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........T.H.E..PHFSLLREE..........................................................................................................................................................
A0A151ZD91_9MYCE/32-133                ...........................................................skp---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--QSEFNT.H........HIT......S.............G...........SEFMNQL..MKDMEK.FIET......SLG....-.K..............RH.............................................F..S.......D...TA.YY..LSPS......S...........R.........HGEAEFKIF.QYI.N....E....NQ....................................................................--.....-.DL..L.K.TQN.....................HYIIS.............Q............D...SD.S................I..F.YALL........S.P.L..SNIKILK--ts........................................................................................................................................................
S9U5J9_9TRYP/4-128                     ........................................tqkyatssnravhdcaytrdll---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................GEEVAFDK.E........EIT......A.............G...........SEIICAF..EEVLQN.YLAT......EEP....-.-..............RS.............................................W..R.......-...-T.CL..ISGS......A...........E.........EGEGEVKIS.GIL.Q....R....LFgq................................................................akEA.....G.TY..T.G.EES.....................VVFVS.............T............D...SD.L................I..L.VGVL........-.-.-..---------atpftnvali................................................................................................................................................
A0A0E0HYJ1_ORYNI/1-101                 ..............................................................MGV..L..A...FY.R..W..L.A.DRY.....PQTVSDAVEeepvelep....................................................................................gsfvpvdlrRPN.....................PNGL..KFY.N...LYLDM......NG..IIHPCF.................................HPE........................GHARSY...SPIPS.VF....SSS.N......Q.P.I.L-..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------csispwiwtpspa.............................................................................................................................................
F0ZXB4_DICPU/1-126                     ..............................................................MGI..P..A...FF.R..W..L.I.DKY.....GGLIQETTEpreg.............................................................................................dgsrS-Kvd................fteMNPN.gEYD.N...LYLDM......NG..IIHPCA.................................HP-........................----EK...GPKPQ.SV....DDM.I......Q.S.I.YE..Y.LDL.L.F.A.....II...R.........P....R....K......L..IYMA...........................V......D..............GV................APR.AKMN.QQ........R.TRR...FRAALDSR---...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------lek.......................................................................................................................................................
A0A0D3D0Y2_BRAOL/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLIVSDVVEeeaveie.......................................................................................gikipvdT-Sk..................pnPNNL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....EEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDASDA-...........................-AA...........E...EEKL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kIDSQVFDS.N........VIT......P.............G...........TEFMGVL..SIALQY.YVHM......RLN....Y.D..............AG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A0V0UTJ3_9BILA/6-260                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVMNCIEdtprdvdg.....................................................................................ttvpvdntQPN.....................PHGI..EFD.T...FYLDM......NG..IIHPCC.................................HP-........................----ED...KPAPK.SE....EEM.M......V.A.I.FE..Y.IDR.L.M.C.....IV...R.........P....R....R......L..LYMA...........................V......D..............GV................APR.AKMN.QQ........R.TRR...FRASKEAAEK-...........................-EE...........Q...IRQI.RE..DL..Q..A...Q...G...I...P..LPa....................................................................................................................esTDKQHFDS.N........CIT......P.............G...........TPFMARL..AICLRY.YIHE......RLN....T.D..............PA.............................................W..Q.......N...LL.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....H....QR....................................................................AC.....A.SH..D.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A507B5Y2_9PEZI/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.SKY.....PKIISSVVEeqpvtmdd....................................................................................gtvipvdytRSN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPK.DE....EEM.M......M.E.V.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......V..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRTAQDAKQKE...........................--E...........D...KQEL.LK..LL..K..Q...Q...N...G...G..VLaae................................................................................................................sletVTKKAFDS.N........SIT......P.............G...........TPFMDIL..AASLRY.WCAY......KLN....T.D..............PA.............................................W..A.......S...LK.II..ISDA......T...........V.........PGEGEHKIM.DFV.R....S....QR....................................................................SS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A383WIN0_TETOB/1-254                 ..............................................................MGV..P..A...FY.R..W..L.S.DRY.....PKIVRDVIE.....................................................................................................EQQqyvdgvev.....pldtskpnPNGE..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPAPT.TE....NEV.F......Q.N.I.FD..Y.IDR.L.F.S.....IV...R.........P....R....R......V..LYLA...........................I......D..............GT................APR.AKMN.QQ........R.SRR...FRAAQDLEEK-...........................-EA...........E...EERL.RQ..EF..I..K...Q...G...I...H..VPk.....................................................................................................................kQRSEIFDS.N........TIT......P.............G...........TPFMHRL..SIALQY.YVHL......RLN....S.D..............PG.............................................W..R.......D...IE.VV..LSDA......N...........V.........PGEGEHKAM.AFV.R....E....QR....................................................................GQ.....P.GW..N.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LALA........T.H.E..PHFTILRE-v.........................................................................................................................................................
A0A0A2JYU1_PENEN/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PSISMLIA-.....................................................................................................ESR.....................-IP-..EFD.S...LYLDM......NG..IIHNCT.................................HS-........................--DSDS...PTFRM.TE....DQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FYMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAENA-...........................-KE...........K...AIQ-.--..--..-..-...-...Q...G...L..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMQKL..TKQLKY.FINK......KIS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....C....SK....................................................................AQ.....P.DY..E.S.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A5J4Z077_PORPP/4-208                 .................................................kdlhkwlkssvks---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................AHKGRS...KNKKD.MA....RVF.A......A.G.V.DH..K.LDE.I.I.K.....QL...R.........P....R....K......S..LFIA...........................V......D..............GA................APL.GKLF.EQ........R.DRR...KLTEEVVEDA-...........................-GI...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................RSDSPLER.S........ALT......P.............G...........TALMRHL..HIALKK.YAAR......TVA....G.A..............KEks.........................................ngT..P.......H...LD.VI..VSSC......D...........V.........PGEGELKIL.EYL.A....S....AI....................................................................RE.....P.SS..M.Q.TVSgfrwkt........lptvddvTVVVG.............A............D...SD.L................FvqM.LGLT........-.-.-..---------eysslyvvgde...............................................................................................................................................
A0A0E0P2G5_ORYRU/96-350                ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAVEeepvelep....................................................................................gafvpvdlrRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPAPT.TY....DEV.F......K.S.I.FA..Y.IDH.L.F.G.....LV...R.........P....R....K......L..IYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........-...-ERL.RK..EF..E..A...Eg.rT...L...V..AK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.T..............PG.............................................W..Q.......S...VK.VM..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A200Q4R5_9MAGN/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSISDVVEdeppvgpn....................................................................................gvllpvdvsRPN.....................PNKV..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPSPA.TY....DDV.F......R.S.I.FD..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAAEAL...........................AEE...........-...-ERL.KE..EF..E..D...E...R...Rd.lQ..PK.......................................................................................................................EKPETSDS.N........VIT......P.............G...........TQFMAVL..SVALQY.YIHS......RLN....R.N..............PG.............................................W..C.......Y...TK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A446TII4_TRITD/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAEEeepvelep....................................................................................gafipvdprRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
J9HJJ2_9SPIT/1-280                     ..............................................................MGV..P..A...FF.R..W..L.S.VRY.....PKVAINALSdedlehlyddfkktsddn.................................................................kdpneinlldgdldgeieK-Rv...................rENNP..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----QD...KPQPT.SE....TEM.F......N.N.I.FD..Y.TDK.I.M.K.....IV...R.........P....Q....R......L..IYMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRGALDTEERE...........................QREee......irgK...WSKE.GI..KF..S..Q...K...K...D...E..ED.......................................................................................................................GDSDKFDQ.N........VIT......P.............G...........TEFMFRL..SKALQY.YVME......RLQ....T.D..............SL.............................................W..K.......D...IK.VI..FSDA......S...........N.........PGEGEHKIL.DFI.R....S....QR....................................................................LQ.....A.GY..N.P.NTR.....................HCIYG.............A............D...AD.L................I..M.LGLS........T.H.E..PHFAILRE-a.........................................................................................................................................................
A0A2B4S237_STYPI/377-627               ..............................................engikkiytpmiqekk---..-..-...--.-..-..-.-.---.....--------Qisvegpe......................................................................................vdgvrapvD-Tsl.................pnPNDY..EFD.N...LYLDM......NG..IIHPCC.................................HP-........................----EN...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETKEK-...........................-AE...........E...MARI.RS..EL..M..E...K...G...A...L..LPp....................................................................................................................ekEKTEHFDS.N........CIT......P.............G...........TEFMANL..SICLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.DYI.R....K....QR....................................................................AS.....P.HH..D.P.NTK.....................HCLNG.............A............D...AD.L................I..M.LGLA........T.H.E..LHFTIIREE..........................................................................................................................................................
A0A446NWM8_TRITD/1-104                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveieg.....................................................................................vqvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..MYMA...........................I......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------gv........................................................................................................................................................
A0A392QNV6_9FABA/1-46                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........--------M.SFI.R....K....QR....................................................................GL.....P.DY..D.P.NTV.....................HCLYG.............S............D...AD.L................I..M.LGLS........S.H.E..PHFSIIRE-v.........................................................................................................................................................
A0A0G4LJB1_9PEZI/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVVEdqpl............................................................................................qmedgT-Tipvd............ttgpnPNGE..ELD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPK.DE....EEM.M......L.E.V.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAQEKE...........................--V...........D...KQEL.LK..LL..K..Q...Q...N...G...G..ILppe................................................................................................................tlesMNKKAFDS.N........SIT......P.............G...........TPFMDTL..ATSLRY.WCAY......KLN....T.D..............PA.............................................W..A.......R...LK.II..ISDA......T...........V.........PGEGEHKIM.NYV.R....S....QR....................................................................GS.....P.DY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
E3K529_PUCGT/1-260                     ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKVVEQVIEdvpaqnavdg.................................................................................gteevpidmsQRN.....................PNGM..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KKPPE.TE....AEM.M......I.E.V.FK..Y.TER.V.V.N.....MV...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAKVKE...........................--E...........E...KQAL.IE..EY..K..Q...Q...G...K...E..LPed...................................................................................................................ykTDKKAWDS.N........AIT......P.............G...........TPFMTLL..TESLRY.WIVY......KMN....T.D..............KG.............................................W..S.......Q...IQ.VI..LSDA......S...........V.........PGEGEHKIM.DFV.R....R....QR....................................................................TQ.....P.SY..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFKVLRE-d.........................................................................................................................................................
A0A5B6VV56_9ROSI/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQSIVDVIEeepredad....................................................................................gnqipvdvrKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.I.FD..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAAEAA...........................AEE...........-...-ERL.RK..EF..E..A...E...G...N...A..LSp.....................................................................................................................kEKPETCDS.N........VIT......P.............G...........TSFMAVL..SVALQY.YIQS......RLN....H.N..............PG.............................................W..R.......N...TK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A2R6Q9G6_ACTCC/1-234                 ..............................................................MGI..P..A...FY.R..W..L.V.DKY.....PLAVVDVKE.....................................................................................................EEAptvvngvs....vpvdasrpnPNGF..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...FPAPN.TY....DEV.F......K.A.V.FK..S.IDR.I.F.S.....LI...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAAKEAADE-...........................-EQ...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--TDMLDS.N........VIT......P.............G...........TEFMALL..SSALQF.YLHL......RMN....A.D..............PG.............................................W..R.......G...VK.VI..LSDA......S...........V.........PGEGEHKIM.AYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..IHFSILRE-d.........................................................................................................................................................
W7TMF7_9STRA/1-254                     ..............................................................MGV..P..A...FF.R..W..L.S.EKY.....PRTVLDMVEqrpqv..........................................................................................vdgvplP-Mdlr...............apnPNNM..EFD.N...LYIDM......NG..IIHPCS.................................HP-........................----ED...RPTPK.TE....AEM.F......V.N.V.MV..Y.VDR.I.F.A.....AV...R.........P....R....R......L..VFLA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRSAGDARER-...........................HEI...........-...KLAT.RQ..EM..V..A...M...G...L...P..VPp.....................................................................................................................eELDKEWDS.N........VIT......P.............G...........TEFMVTL..ASYLRF.YVAH......RVN....T.C..............KA.............................................W..Q.......Q...VK.VL..FSDG......S...........E.........PGEGEHKIM.DFI.R....K....ER....................................................................AQ.....P.GY..D.P.NTR.....................HILHG.............L............D...AD.L................I..M.LALA........T.H.E..PHFTILREQ..........................................................................................................................................................
A0A2D3VDB0_9PEZI/1-260                 ..............................................................MGV..P..A...LF.X..W..L.S.KKY.....PKIISPVVE.....................................................................................................EQArevenddgttttipidargpnPNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPE.TE....EEM.M......I.A.V.FE..Y.TER.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKD...........................AE-...........-...AAEF.HR..RM..V..A...N...G...E...R..VDe....................................................................................................................ghALKKTWDS.N........SIT......P.............G...........TPFMDLL..AASLRY.WVSY......KLS....T.D..............PA.............................................W..E.......K...LK.VV..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.DH..D.P.NSR.....................HVMYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRILRE-d.........................................................................................................................................................
A0A096MA72_POEFO/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHK.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVHN......KVS....T.D..............KL.............................................W..Q.......N...VK.VF..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.NH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..HNFSLLREE..........................................................................................................................................................
A0A565B145_9BRAS/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLIVSDVVEeeaveie.......................................................................................gvkipvdT-Sk..................pnPNNL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPS.TF....EEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDASDA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kVNSQVVDS.N........VIT......P.............G...........TEFMGVL..SIALQY.YVHL......RLN....Y.D..............AG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
XRN2_YARLI/1-271                       ..............................................................MGV..P..G...LY.R..H..L.S.QKC.....PKIVSDVIE.....................................................................................................DETtivdgee......ipgsdysaPNPN.gELD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...EEAPP.SE....DEM.L......L.A.V.FK..Y.TER.V.L.N.....VC...R.........P....R....K......V..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAKDAAIEA...........................EST...........L...ESEL.KA..KT..I..E...L...Q...S...-..-Sgekgkslet....................................................................................................ildefkqglvNKPGKWDS.N........AIT......P.............G...........TPFMEKL..AAALRY.WVGY......KLN....T.E..............PG.............................................W..R.......D...LK.VV..ISDA......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................GD.....P.TY..N.A.NTS.....................HCIYG.............L............D...AD.L................I..F.LGLA........T.H.E..PKFKLLRE-d.........................................................................................................................................................
L8GYH6_ACACA/1-275                     ..............................................................MGI..A..G...FQ.K..W..L.E.KHY.....PHCFIPVPD.....................................................................................................APRrpapg...........erappAVKD..YFD.H...IYVDL......NG..YIHTVG.................................RR-........................------...---AA.NE....EQL.F......T.L.L.FR..E.LDG.L.F.K.....VC...V.........A....R....Q......S..IFLA...........................I......D..............GP................ASA.AKLI.TQ........R.KRR...LGAASKQDRQA...........................KAKaqp....qpqvA...ESEA.QT..GA..P..-...-...-...-...-..-Avsk.................................................................................................................krvKKKGEFNL.L........QVT......A.............G...........TPFMYRL..KNALCF.WACS......RLQ....S.D..............PK.............................................Y..H.......F...TR.IY..ISGP......D...........V.........PGEGELKIM.EFI.V....S....HAnadsspppnpqe...........................................rvfayqtgfadqeRN.....A.EK..F.R.RDS.....................HLIVG.............T............D...AD.L................I..L.LGLS........S.M.L..QNVFILN--tq........................................................................................................................................................
A0A2P6TTV0_CHLSO/1-254                 ..............................................................MGV..P..S...FY.R..W..L.A.NRY.....PKIVKDVVEdevqving.....................................................................................vevpvdtsQPN.....................PNGV..EYD.C...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPAPT.TE....EEV.F......L.T.M.FD..Y.IDR.L.F.A.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAEER-...........................-EK...........E...EEKL.RE..DF..A..K...Q...G...I...K..VPk.....................................................................................................................kDKSAVFDS.N........VIT......P.............G...........TPFMHRL..SIALQY.YVHQ......RLN....Q.D..............PG.............................................W..R.......N...VK.VI..LSDA......N...........S.........PGEGEHKIM.AYI.R....E....QR....................................................................GL.....P.GY..D.P.LTR.....................HCIYG.............L............D...AD.L................I..M.LALA........T.H.E..PRFSILRE-v.........................................................................................................................................................
W6L6Q1_9TRYP/8-166                     .........................................rrfgssfrnrpvtscaqllit---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................KKTV..CYD.Y...VGIDV......SG..LVGNAL.................................RL-........................--AKSA...SNEQR.RQ....RDV.G......R.H.V.LH..S.VQQ.L.L.R.....KI...N.........C....R....K......S..LLIA...........................M......D..............GA................ESL.AKAD.VT........R.RSS...LTRRLESRLVR...........................LPG..........tA...LMQM.VE..ER..L..-...V...R...M...M..PE.......................................................................................................................DQLRLLPS.E........VVI......S.............G...........TGVMGCV..EEKFSA.W---......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------a.........................................................................................................................................................
F0VA25_NEOCL/41-364                    .............................................................a-GI..P..G...LH.N..W..L.G.QAF.....PSAVRQVNK.....................................................................................................KKE.....................---V.lLVD.H...LLFDL......NQ..LLHQRA.................................ACGaq...................ggdSRKALE...ATFSD.EA....DAV.L......R.R.L.VS..L.ISA.T.L.R.....SI...H.........P....R....K......S..VVFA...........................L......D..............GV................PPL.AKLL.TT........A.KRR...RKREDEVAGGA...........................HSE...........A...AEDE.DS..EG..D..D...A...G...F...R..ENdgrgetqgsvagvesdsagdedagdaggagdadanglgnaskrrqegrdts................rargdgdeegedegveegeeegvaegedrirfppnhsvgatldglrlpektkKERYRIPS.H........LLT......P.............G...........TAFMRRV..EETCRR.FAWQ......RLA....-.S..............RR.............................................Y..Q.......H...LN.FF..ISGS......T...........S.........FGEGELKLI.DWL.L....A....AK....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------naqpfaslpvsssd............................................................................................................................................
A0A165AEJ3_XYLHT/1-142                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.SE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTALDAEVA-...........................-KE...........K...AIK-.--..--..-..-...-...N...G...M..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TTYI---..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------vh........................................................................................................................................................
A0A3Q3S9C3_9TELE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....R......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVHN......KLS....T.D..............KL.............................................W..Q.......K...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AQ.....P.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A453HNA8_AEGTS/5-134                 ..........................................fqeleesimrerfraqgkev---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..-Lpr...................................................................................................................ddAPREVSDP.N........IIT......P.............G...........TEFMEKL..SAALEY.YVRA......RLS....S.H..............PR.............................................W..K.......D...VK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SM.....E.SY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........S.H.K..VHFSILRE-a.........................................................................................................................................................
A0A178ZHQ6_9EURO/1-262                 ..............................................................MGV..P..A...LF.R..W..L.T.KKY.....PKIITPVIEeqpyevdg.....................................................................................vqypvdttQPN.....................PNGE..EMH.N...LYLDF......NG..IVHPCS.................................HP-........................----EN...KPPPA.NE....SEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....R......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSARDAKEAD...........................EKKaefq...tllrQ...QQRD.MD..DD..E..D...E...E...T...V..DD.......................................................................................................................VIKKTWDS.N........VIT......P.............G...........TPFMFIL..AQSIRY.WVQW......KLN....T.D..............PA.............................................W..A.......Q...LK.VI..ISDA......S...........V.........PGEGEHKIM.QFI.R....S....QR....................................................................SD.....P.AY..D.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A3P8X0H4_CYNSE/8-135                 ..............................................fvsrtlleaedkikka---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TQFMVKL..QEQLKY.FVHN......KLS....T.D..............KL.............................................W..Q.......N...VR.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................RK.....P.DH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A183ET47_9BILA/56-121                ....................................................cnialasvlf---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........C.........PGEGEHKIM.DFI.R....S....ER....................................................................SQ.....P.NY..D.P.NTR.....................HCLYG.............L............D...AD.L................V..I.FDIC........-.-.-..---------enwsgeivflrtd.............................................................................................................................................
A0A3P7R883_CYLGO/1-142                 ..............................................................MGV..P..A...FF.R..W..L.T.RKY.....PSII-----.....................................................................................................---.....................----..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPA.NE....DEM.F......A.L.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAWEKA...........................ASI...........-...-EEQ.RR..RL..E..E...E...G...I...P..LPp....................................................................................................................kkEEESHFDS.N........CIT......P.............G...........TPFMAR-..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------..........................................................................................................................................................
A0A3L8SS42_CHLGU/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekak............................................................................................ecngvK-Vpidt.............skpnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.I.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AE...........E...KQKI.RQ..EI..L..A...K...G...G...Y..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....S.N..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1S3LWX1_SALSA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PSEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVNS......KLS....T.D..............NA.............................................W..K.......G...VN.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....R....EN....................................................................SE.....P.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................M..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
K7G845_PELSI/1-200                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEG-...........................-AE...........E...KQRI.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
D7G4F2_ECTSI/1-253                     ..............................................................MGV..P..A...FY.R..W..L.S.EKY.....PKIVVDMLEdhaarveg.....................................................................................teipldltAEN.....................PNGI..EFD.N...LYIDM......NG..IIHPCS.................................HP-........................----ED...KPPPE.SE....EEM.Y......K.N.I.MD..Y.IDR.L.F.S.....AV...R.........P....R....R......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAEEA-...........................-AE...........L...MEET.RQ..AM..K..E...M...G...V...K..VP......................................................................................................................pKAKPAWDS.N........IIT......P.............G...........TEFMHKL..SRYLRF.YVQD......RVN....R.D..............KA.............................................W..Q.......N...IK.VI..LSDA......S...........E.........PGEGEHKIM.DFV.R....R....QR....................................................................TQ.....P.GY..D.P.NQH.....................HILHG.............L............D...AD.L................I..M.LGLA........T.H.E..RSFTILREQ..........................................................................................................................................................
A0A0D8Y9F7_DICVI/1-255                 ..............................................................MGV..P..A...FF.R..W..L.T.KKY.....PSIIVNANEdrq..............................................................................................rnadG-Tripid...........atkpnPNFQ..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPPPA.NE....DEM.F......A.L.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAWEKQ...........................ASI...........-...-DEQ.RR..RL..E..E...E...G...L...P..LPp....................................................................................................................kkDNETHFDS.N........CIT......P.............G...........TPFMARL..ADALRY.YIHD......RIT....N.D..............PA.............................................W..A.......K...IQ.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....K....QR....................................................................SN.....P.SH..N.P.NTV.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..ANFNIIREE..........................................................................................................................................................
A0A6G0TBZ9_APHGL/1-255                 ..............................................................MGV..P..A...FF.R..W..L.T.RKY.....PSVIVNCIE.....................................................................................................QKStdvngeqi.....pidstlpnPNGI..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----EN...KPAPK.DE....DEM.M......I.A.I.FE..C.IDR.L.F.R.....IV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETTEK-...........................-NE...........E...LARV.RK..NL..I..E...A...G...A...I..LPp....................................................................................................................ekQKGEHFDS.N........CIT......P.............G...........TPFMDKL..SACLHY.YVHD......RLN....N.D..............PG.............................................W..K.......G...IK.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....K....QR....................................................................AQ.....P.NH..D.P.NTQ.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
S9V5A0_9TRYP/1-248                     ..............................................................MGI..A..G...FF.L..W..L.Q.RWY.....EQCIHLIPDsvvek...........................................................................................aktgeV-D....................rKAKS..EMD.N...LYVDM......NG..LIHPCC.................................HD-........................---TAP...LPEPE.NE....EEM.I......E.R.I.LT..Q.LDI.L.V.K.....VA...R.........P....R....K......C..LILC...........................I......D..............GV................APR.SKLN.QQ........R.SRR...FRAADERMEGD...........................-AL...........A...KTVS.RT..IV..K..E...H...K...L...P..RP.......................................................................................................................QSRKKWDH.N........VIT......P.............S...........TPFMERV..AIALEW.FIVK......QVN....D.D..............PL.............................................W..K.......K...LV.VV..FSDA......H...........V.........PGEGEHKIM.QYI.R....S....LR....................................................................SQ.....P.GY..D.H.TTS.....................HAICG.............M............D...AD.L................V..C.LGLS........T.H.E..EHVSILRN-q.........................................................................................................................................................
A0A1E7FVR1_9STRA/10-241                .............................................................f-GI..P..K...MF.R..W..L.T.DQY.....PDIINNRLE.....................................................................................................EGL.....................AEDI..EVD.N...FYLDM......NG..IIHPCT.................................HG-........................--NNEA...ELVYL.DE....TAM.F......K.K.I.FL..Y.VDR.L.Y.K.....MV...Q.........P....T....H......V..LYLA...........................V......D..............GT................APR.AKMN.QQ........R.SRR...FRAAKEAEQL-...........................-A-...........A...DLTA.RE..NF..K..G...K...E...L...A..ID.......................................................................................................................EEKQRFDS.N........CIT......P.............G...........TDFMLKL..SLALQK.WVDY......KIE....T.D..............PF.............................................W..T.......N..gAT.VI..VSGP......D...........V.........PGEGEHKVM.DFV.R....D....SQaeyr............................................................ktgiTT.....D.FY..G.P.GWT.....................HVLYG.............L............D...AD.L................I..M.----........-.-.-..---------pt........................................................................................................................................................
A0A5J9W443_9POAL/57-310                ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveveg.....................................................................................vkvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..MYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASDAA...........................--A...........E...EERL.RE..EF..E..R...E...G...R...K..LPa.....................................................................................................................kQQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....QR....................................................................NL.....S.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A1W0E8K8_9MICR/1-223                 ..............................................................MGV..P..S...LY.K..W..I.T.MRF.....PGIVTHLKK.....................................................................................................EFD.....................---Y..NVD.N...LYLDF......NA..IIHPCT.................................DK-........................----SK...TNLEQ.LD....DEL.Y......R.N.L.ER..Y.VDA.L.V.A.....YC...K.........P....K....K......M..IYIS...........................V......D..............GV................APK.AKMN.QQ........R.TRR...FKGAKDNFDN-...........................-NV...........F...YLSE.KE..EL..L..G...N...-...-...-..--.......................................................................................................................-SLQIFDQ.N........SIS......P.............G...........TEFMERL..NEYIQE.LIKY......KLS....T.D..............VL.............................................W..K.......N...KT.VI..YSNY......Q...........V.........PGEGEQKIM.EYL.R....I....HK....................................................................--.....-.-K..H.A.KES.....................HVIYS.............P............D...AD.L................I..F.LGLT........L.P.D..YNLRIMREE..........................................................................................................................................................
A0A084WPA2_ANOSI/1-227                 ..............................................................MGV..P..K...FF.R..Y..I.S.ERF.....P-CLSELLR.....................................................................................................---.....................ENQV.pEFD.N...LYLDM......NG..IIHNCS.................................HP-........................--NDAD...VTFRI.SE....EMI.F......E.G.V.FH..Y.VEY.L.F.K.....MI...R.........P....Q....K......V..FFIA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSADEAQQQ-...........................-LK...........Q...AIE-.--..--..-..-...-...K...G...E..EI.......................................................................................................................PSGDRFDS.N........CIT......P.............G...........TAFMVRL..QKALEH.FIQV......KIA....T.D..............VL.............................................W..K.......A...CT.VI..LSGH......E...........T.........PGEGEHKIM.EYI.R....H....AK....................................................................AQ.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................V..M.LGLC........T.H.E..RYFSLLREE..........................................................................................................................................................
A0A2N5SPL7_9BASI/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKVVEQVIEdvpahhaveg.................................................................................gteeipidmsQRN.....................PNGI..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KKPPE.TE....AEM.M......I.E.V.FK..Y.TER.V.V.N.....MV...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAKVKE...........................--E...........E...KQAL.IE..EY..T..Q...L...G...K...E..LPed...................................................................................................................ykTDKKAWDS.N........AIT......P.............G...........TPFMTLL..TESLRY.WIVY......KMN....T.D..............KG.............................................W..S.......Q...IQ.VI..LSDA......S...........V.........PGEGEHKIM.DFV.R....R....QR....................................................................TQ.....P.SY..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFKVLRE-d.........................................................................................................................................................
A0A452SJ98_URSAM/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
U6GRG3_9EIME/65-266                    .........................................................ggmlh---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...----A.NE....DLM.W......Q.S.V.FA..A.LDL.V.V.S.....TI...S.........P....R....K......L..LYLA...........................A......D..............GV................APR.AKMN.QQ........R.SRR...YRAAKSAQEAA...........................EAQ...........Ek.qRQAA.GN..VF..Q..V...-...-...-...-..-Apegtegqd......................................................................................................sgvpnqtggTTGKGFDS.N........CIS......P.............G...........TEFMASF..FRHLRF.YCEK......KFQ....E.D..............AR.............................................W..R.......G...LK.VL..LSGP......D...........V.........PGEGEHKIM.AYL.R....C....CK....................................................................AA.....D.SS..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........S.H.E..PQFALLREE..........................................................................................................................................................
A0A199W6R8_ANACO/8-232                 .................................................tgvfvpvdlrrpn---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPAPA.TY....EDV.F......K.S.I.VG..Y.IDH.L.F.G.....LV...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAA...........................AEE...........E...RLRK.EF..EV..E..G...R...N...L...S..PK.......................................................................................................................ERLETSDS.N........VIT......P.............G...........TQFMSAL..SVALQY.YIHL......RLN....H.T..............PG.............................................W..Q.......S...LK.VI..LSDA......N...........V.........PGEGEHKIM.AYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A445CNT8_ARAHY/1-257                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSISDVVEeevpatseg..................................................................................gappffvdisKPN.....................PNGM..EFD.N...MYLDM......NG..IIHPCF.................................HP-........................----DG...KPAPA.TY....NDV.F......K.S.I.FD..Y.IDH.L.V.S.....LV...R.........P....R....K......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................AEE...........-...-ERL.RK..EF..E..G...El.eL...L...P..SK.......................................................................................................................DKPETSDS.N........VIT......P.............G...........TPFMAVL..SLALQY.YVQT......RLN....Y.N..............PG.............................................W..R.......N...IK.VI..LSDS......N...........V.........PGEGEHKIM.EYI.R....S....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
Q4DYN0_TRYCC/1-237                     ..............................................................MGV..P..L...LL.T..W..L.K.RRF.....APCFLSSS-.....................................................................................................--S.....................-CP-..AAD.C...LYIDV......NG..LVYQAA.................................AL-........................-ATASE...ASAVD.ID....AAI.L......R.K.L.FD..I.LDD.I.V.L....rLV...R.........P....R....F......L..VYLA...........................V......D..............GI................SPM.GKLA.QQ........R.SRR...RRRSGGGSRG-...........................-R-...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-NAVEWDS.N........SIS......V.............G...........TPFMSRL..TEALHF.YCAS......RAE....R.I..............NGerlrdelqqv........................argnttggdvpV..T.......P...IT.FI..VDDV......W...........R.........PGEGESKIA.DAI.R....R....FR....................................................................SQ.....S.TY..D.P.NTS.....................HVICS.............S............D...TD.V................T..V.CSLI........L.H.E..PRIHVLRY-e.........................................................................................................................................................
A0A5N6E1Q8_ASPPA/1-257                 ..............................................................MGV..P..A...LF.R..W..L.S.NKY.....PKIISPVIEeqpyevn.......................................................................................geqipvdT-Tr..................pnPNGE..ELD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPA.NE....QEM.M......L.E.I.FN..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAKEAD...........................EKK..........eE..fRKQFlKK..SK..G..D...Q...E...I...H..EE.......................................................................................................................VIQKTWDS.N........VIT......P.............G...........TPFMDIL..AASLRY.WIAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................AA.....P.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A453M1S4_AEGTS/1-186                 ............................................................ps---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...---PT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A2T0FFU3_9ASCO/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.SKY.....PKIIKPCLE.....................................................................................................DEPveingie.......ypgdyslPNKN.gELD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...RPAPE.NE....DEM.M......L.E.V.FK..Y.TDR.V.V.T.....MA...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQDAEAAQv.........................aKEE...........K...IAE-.AR..RR..G..E...E...I...D...E..AI.......................................................................................................................HGKKAWDT.N........VIT......P.............G...........TPFMEFL..ASSLRY.WISF......KLN....S.D..............PA.............................................W..K.......D...LK.VI..ISDA......S...........V.........PGEGEHKIM.ELI.R....S....QR....................................................................ND.....P.EH..D.P.NTS.....................HAIYG.............L............D...AD.L................I..F.LGLA........T.H.E..PNFRILRE-d.........................................................................................................................................................
A0A3M7T6L4_BRAPC/1-257                 ..............................................................MGV..P..A...FF.R..W..L.T.KKY.....PSIVVQCVEekak............................................................................................vddtsN-Skipvd...........tsrpnPNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPK.TE....DEM.M......V.I.I.FE..F.IDR.I.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKESCEK-...........................-SS...........E...IRRL.KE..QI..M..A...N...G...G...Q..VPp....................................................................................................................daAQSEKFDS.N........CIT......P.............G...........TPFMHRL..AQCLRY.YIHD......RLN....N.D..............PG.............................................W..K.......N...IC.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AN.....P.DH..Q.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1Z5KRK4_FISSO/43-268                .............................................................n-GI..R..G...FR.S..W..L.E.STH.....PDAIYPIRQ.....................................................................................................LQD.....................--QD..NFD.H...VLIDL......NQ..FLHVIV.................................RN-........................------...---SR.SD....DHA.L......V.L.L.MK..E.LDL.L.I.Q.....MA...T.........P....T....K......S..LVLA...........................I......D..............GP................PSA.AKLA.TQ........R.QRR...LEKIIKVERT-...........................-LK...........Q...LKQS.PL..RV..A..R...R...K...-...-..-R.......................................................................................................................SIVADTRV.L........ALT......P.............S...........TNFMKSV..EKALLY.WTWQ......RLS....N.R..............NS.............................................ClpE.......G...VH.VY..ISPS......S...........V.........PGEGEVKLL.EWL.Y....R....HT....................................................................SR.....-.PH..Q.I.NES.....................VAFLG.............G............D...AD.L................V..V.EGLM........L.N.R..PNVFCL---lp........................................................................................................................................................
A7TQ45_VANPO/1-231                     ..............................................................MGI..P..K...FF.R..Y..I.C.ERW.....PLILQLIE-.....................................................................................................N-D.....................--NV.pEFD.N...LYLDM......NS..ILHSCS.................................HGD........................RGDTEG...IIKPL.TE....EEI.F......T.R.I.FI..Y.IDH.L.F.Q.....LI...K.........P....K....K......V..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAMENEKA-...........................-MN...........K...----.--..-I..I..E...N...G...G...V..IS.......................................................................................................................EEIKPFDP.N........AIT......P.............G...........TTFMEKL..TKYLKY.FIHD......KIS....N.D..............IN.............................................W..A.......N...IE.II..LSGH......E...........V.........PGEGEHKIM.DYI.R....K....KR....................................................................SQ.....K.GY..N.P.NLR.....................HCIYG.............L............D...AD.L................I..I.LGLS........T.H.A..PHFAILREE..........................................................................................................................................................
A0A665V6F4_ECHNA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVHN......KIS....T.D..............KL.............................................W..Q.......N...VH.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.GH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
M4BVC6_HYAAE/1-185                     ..........................................................mlsq---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...----Q.SL....EAQ.L......H.G.I.FT..Y.LDR.L.I.T....hII...K.........P....K....Q......L..VYIA...........................I......D..............GV................APR.AKLN.QQ........R.SRR...FRAGLERQEAI...........................EKE...........-...-KHL.KI..QV..N..D...-...E...T...E..RP.......................................................................................................................NGSSPFDS.N........CIT......P.............G...........TAFLSTL..SQHLVY.FVRR......KMK....D.D..............PL.............................................W..T.......R...LE.VF..FSGS......E...........V.........PGEGEHKIV.EFI.R....H....RK....................................................................MT.....A.DY..D.A.NVR.....................HCMYG.............S............D...AD.L................M..L.LGLM........T.H.E..PHFTLVRE-t.........................................................................................................................................................
A0A165KDK2_9BASI/3-224                 ......................................................lpvdittp---..-..-...--.-..-..-.-.---.....---------.....................................................................................................--N.....................PNGV..ELD.C...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....DEM.M......V.E.I.FK..Y.TER.V.V.N.....MV...R.........P....R....R......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAKEKE...........................EER...........E..eAVRL.FE..AM..G..H...P...V...S...E..ET.......................................................................................................................KKKKSWDS.N........AIT......P.............G...........TPFMELL..ATSLRY.WTVS......KIN....S.D..............PG.............................................W..K.......N...LQ.VI..ISDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................VN.....P.DH..N.P.NTQ.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A2B7XKT7_9EURO/1-259                 ..............................................................MGV..P..A...LF.R..W..L.S.SKY.....PKIISAVIEeqpqevdg.....................................................................................eeipvdttKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPE.NE....QEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......I..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEAD...........................EK-...........-...KEEF.TK..LL..R..K...Q...N...G...N..KGgea................................................................................................................iveeVIKKTWDS.N........VIT......P.............G...........TPFMDIL..AASLRY.WVAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................SC.....E.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLG........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A446TIE6_TRITD/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAEEeepvelep....................................................................................gafipvdprRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A061D9I2_BABBI/71-321                .............................................................y-GV..P..R...MF.Y..W..L.L.DNF.....GGFKTALER.....................................................................................................AL-.....................-EKQ..PVD.H...LYIDM......NA..IIHVAT.................................HGN........................----VS...PLVQM.EN....EQR.L......R.R.I.TS..A.IEM.L.F.N.....VV...Q.........P....R....K......M..LYMA...........................V......D..............GV................CPT.AKIN.QQ........R.GRR...FRTSKSIDQLVsvasl.................dphgvQ--...........-...-TEI.CS..AV..S..S...K...-...-...-..-Dgekyva..........................................................................................................qrlpfdaYDNVTFNP.N........YIS......P.............G...........TDFMQIV..DSEVAN.WLAL......KTV....-.E..............GL.............................................F..G.......K...CL.VV..YSGV......S...........V.........PGEGEHKIF.QCI.R....K....MN....................................................................KA.....S.RH..A.R.KET.....................HLVYG.............L............D...AD.L................M..M.LSMA........L.K.I..PNIKVLREE..........................................................................................................................................................
A0A2K2CQ52_BRADI/1-209                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHPCF.................................HPE........................DP-SSS...SPAPA.TF....DDV.F......R.A.I.FA..Y.TDH.L.L.R.....IA...R.........P....R....K......L..LYLA...........................L......D..............GV................APR.AKMN.QQ........R.ARR...FKSAIAAKDA-...........................-EV...........E...EKLL.RE..RF..R..A...E...G...K...E..LLppp................................................................................................................pvpvDAEALLDP.N........VIT......P.............G...........TEFMEKL..SAALQY.YVRA......RLN....A.H..............PR.............................................W..K.......H...LK.VI..MSDA......N...........V.........PGEGEHKIM.SFI.R....A....QW....................................................................SM.....E.SY..D.P.NTS.....................HCLYG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRK-y.........................................................................................................................................................
A0A671WXE8_SPAAU/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCLEekgkecng.....................................................................................vrvpvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-TD...........E...KNRI.RE..EI..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YVAD......RLS....N.D..............PG.............................................W..S.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................GQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A383VEA9_TETOB/1-226                 ..............................................................MGI..P..K...FY.R..W..L.S.ERY.....PLLNMPVTA.....................................................................................................TE-.....................-APP..EID.N...LYLDM......NG..IIHNCT.................................HAN........................-----D...PNLKL.TE....TEM.V......I.R.I.FS..Y.LDK.L.I.H.....IM...K.........P....R....K......L..VFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FKTAMERMAL-...........................-EA...........E...K---.--..--..-..K...A...K...G...E..ET.......................................................................................................................PEEYKFDS.N........CIT......P.............G...........TGFMARL..GRHIRF.FVRK......KLS....E.D..............PV.............................................W..Q.......Q...PV.VI..FSGH......D...........V.........PGEGEHKIM.EYI.R....W....QK....................................................................RS.....P.SY..T.P.NQR.....................HCMYG.............L............D...AD.L................I..M.LSLV........T.H.E..PHFCLLRE-v.........................................................................................................................................................
A0A1S7HPA3_9SACH/1-254                 ..............................................................MGV..P..S...FF.R..W..L.S.RKY.....PKIISPVLE.....................................................................................................EQPqvidgvt.......lpidysaPNPN.gELD.N...LYLDM......NG..IVHPCS.................................HP-........................----EN...KPPPE.TE....DEM.L......L.A.V.FE..Y.TNR.V.L.N.....MA...R.........P....R....K......V..LVIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSAKDAQVEN...........................EAR...........-...-ERI.ME..ER..E..Q...L...G...E...I..IDg....................................................................................................................amKQKKTWDS.N........AIT......P.............G...........TPFMDKL..AAALRY.WCSF......KLA....T.D..............PG.............................................W..K.......N...LQ.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................AD.....P.QY..N.P.NTT.....................HCIYG.............L............D...AD.L................I..F.LGLA........T.H.E..PHFKVLRE-d.........................................................................................................................................................
A0A669EC62_ORENI/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KSRV.RE..EV..I..Q...K...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AQCLRY.YVAE......RLT....N.D..............PG.............................................W..K.......N...IV.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................GQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
Q4CW10_TRYCC/1-304                     ..............................................................MGV..P..K...FA.S..W..L.T.KKY.....PEMVSDVI-.....................................................................................................-P-.....................---A..DVH.G...LYIDL......NG..LIHPCC.................................HS-........................--ERDP...SVAAR.PE....EEK.L......Q.C.I.CC..E.VEV.L.L.A.....TV...R.........P....H....D......I..LYIA...........................T......D..............GV................APR.AKMN.QQ........R.ARR...YMSRAKIMSSG...........................T-E...........V...VEEV.VR..EF..T..P...N...E...M...A..EAdddlddirqllmqdalyggvmvqddttetlngvan.................................................iadsltpvtpchdksnnheahaetwaafdgltdgtMEVTEFDS.N........CIS......P.............G...........TAFMVKV..TNAILT.MVQD......KLT...nG.D..............PL.............................................W..A.......G...LR.VV..FSGA......N...........T.........PGEGEHKIV.DFL.R....T....QS....................................................................SY.....P.GF..N.G.KGA.....................HVIAG.............L............D...AD.L................I..F.LSLS........L.H.I..PHILLLRD-r.........................................................................................................................................................
A0A0D9YSC6_9ORYZ/1-167                 ..............................................................MGI..P..S...FY.R..W..L.V.NRY.....PSIVSPAKE.....................................................................................................SRP.....................ADGI.vVYD.N...LYLDM......NQ..IIHYSF.................................HPQd......................qMNAGTD...VCAPT.TV....SEV.F......E.S.M.FD..Y.LDR.L.F.R.....IV...R.........P....R....R......L..LYLA...........................V......D..............GV................APC.AKMNgMR........R.GRR...FAWASEEEEM-...........................-QK...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................ISEGVSDP.N........VIT......P.............G...........TEFMEKI..SQALTY.YIRA......RLN...sS.D..............PG.............................................W..K.......H...I-.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------m.........................................................................................................................................................
A0A0J8RFF0_COCIT/16-109                ..............................................................MGV..P..A...LF.R..W..L.S.TKY.....PKIISAVVEelpqeidg.....................................................................................eefpvdttKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPA.NE....GEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...K.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------i.........................................................................................................................................................
A0A453M1S7_AEGTS/1-88                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........---MFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A4D9BYK7_SALSN/1-235                 ..............................................................MGV..P..S...FY.R..W..L.V.NKY.....PKIVSDAA-.....................................................................................................--A.....................-NPP..EFD.N...LYLDM......NG..LIHPCF.................................HP-........................---DDD...PFPPT.TV....DDV.F......R.R.I.HD..Y.VDS.L.F.D.....IV...K.........P....R....Q......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDYQHA-...........................-EE...........V...EDKL.RK..QF..E..G...E...G...R...V..VLp.....................................................................................................................kQESEILDS.N........VIT......P.............G...........TEFMHLL..SENLRS.YVKR......RLR....E.D..............PA.............................................W..G.......N...IK.VI..LSDD......K...........A.........LGEGEHKIM.SFI.R....A....QR....................................................................AS.....S.EY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..AHFSILREE..........................................................................................................................................................
W4ISF1_PLAFP/45-259                    .............................................................y-GI..P..R...MY.K..W..L.T.SYY.....PTVREELIN.....................................................................................................NEK.....................--QK..SVD.I...FYIDM......NG..VIHHCT.................................HAN........................----KE...KLPIY.DE....HEL.F......S.N.I.LQ..Y.LKN.L.F.Y.....LI...K.........P....K....K......L..IYIG...........................V......D..............GV................SPK.AKMN.QQ........R.KRR...FLSIFKINDN-...........................-DN...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-TSNLFNP.N........CIT......T.............G...........TDFMYKI..NLSLNK.WFKI......-LK....K.K..............KV.............................................F..E.......-...FD.VI..FSGS......D...........V.........AGEGEHKIL.KYI.R....E....NC....................................................................KR.....D.SN..F.K.NYN.....................HCIYG.............L............D...AD.L................I..M.LSLV........T.H.L..NNIFILRD-k.........................................................................................................................................................
V7CG77_PHAVU/1-254                     ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDSIEeepvvidg.....................................................................................vkipvdtsDKN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......E.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AA...........E...EARL.RE..EF..E..K...E...G...R...K..LPp.....................................................................................................................kEESQTFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YVHL......RLN....N.D..............PG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....K.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..IHFSILRE-v.........................................................................................................................................................
A0A673CI04_9TELE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVYN......KLS....T.D..............KM.............................................W..Q.......K...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....A....EK....................................................................AK.....P.GH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A1Z5T7A9_HORWE/1-265                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIISPVLEerpeefenad................................................................................gsktkipvdgrKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......I.A.I.FE..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKD...........................--A...........A...AAEY.HR..EM..L..A...K...G...A...I..TEnggg...............................................................................................................ddpeKPKKTWDS.N........SIT......P.............G...........TPFMDLL..AQSLRY.WVSY......KLS....T.D..............PA.............................................W..E.......K...LK.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.TH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
I2JXA0_DEKBR/1-165                     ..............................................................MGI..P..K...FF.R..F..I.S.ERW.....PLTSQEVDG.....................................................................................................--Q.....................-EMI..EFD.N...MYLDM......NS..ILHNCT.................................HT-........................---NDG...TIIHL.SE....EQM.F......G.A.I.FA..Y.IDH.L.F.N.....LI...K.........P....K....K......V..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAVEAEXN-...........................-MK...........K...AIE-.--..--..-..-...-...R...G...D..EI.......................................................................................................................PKEAPFDS.N........AIT......P.............G...........TDFMAKV..TEHLKY.YINQ......KVS....T.D..............SN.............................................W..Q.......S...I-.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------qg........................................................................................................................................................
A0A068QKX0_9VIRU/1-252                 ..............................................................MGI..K..H...YF.N.gF..L.K.KNH.....PECISTIKR.....................................................................................................GDNe..................gaGIPA..MID.V...LLVDM......NG..IIHNAA.................................QEVy......................gYGNFSI...PHKYP.ND....QTV.Y......R.Y.V.NN..C.LDS.L.V.V.....QF...K.........P....K....E......L..VLC-...........................I......D..............GV................APM.SKQI.QQ........R.QRR...FRAAYERDEKN...........................---...........-...VGEF.YT..--..-..-...Q...N...-...-..QP.......................................................................................................................EPVLRFDS.N........AIS......P.............G...........TEFMHKL..GRSIAL.HIER......QQK....G.E..............KRryeqdwr..............................ktdesenhW..K.......N...LK.VY..FAND......K...........V.........EGEGEHKLV.DHV.R....K....NG....................................................................--.....-.--..R.H.DYN.....................YCIYG.............S............D...AD.L................I..M.LSMAll....ttS.A.I..TNIFVLRD-k.........................................................................................................................................................
A0A2K6SLD2_SAIBB/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.S.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A3P8V8N8_CYNSE/1-250                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgrecng.....................................................................................vrtpvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-TE...........E...KNRI.RE..EI..L..Q...R...G...G...S..VPs.....................................................................................................................eQIKERFDS.N........CIT......P.............G...........TEFMDNL..AQCLRY.YVAD......RLT....N.D..............PG.............................................W..K.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.HH..D.P.NTH.....................HCLCG.............A............D...GQsL................L..F.TSLT........-.-.-..---------fnvwtcv...................................................................................................................................................
A0A3S2P1B9_CHISP/1-255                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSVIVECIE.....................................................................................................QKPtdvdgqlv.....yvdsslpnPNGV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPPPK.DE....DEM.M......V.A.I.FE..C.IDR.L.F.R.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETQEKI...........................--D...........E...IARI.RS..EL..L..T...K...G...A...Y..LPp....................................................................................................................erPKEAHFDS.N........CIT......P.............G...........TPFMDRL..SKCLHY.YIHD......RLN....N.D..............PG.............................................W..K.......G...IK.VI..LSDA......N...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.DH..D.P.NTQ.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A0N8K2T2_SCLFO/1-267                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....ASIIVHCVE.....................................................................................................EKEcngvrip.......vdtskpnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-QE...........E...KKKV.RE..EI..Y..Q...R...G...G...Y..LPp.....................................................................................................................dEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAE......RLS....N.D..............PGwrnltdvl.............................ttvpliinF..V.......-...SQ.VV..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A197JRZ9_9FUNG/1-192                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCS.................................LP-........................--NDTD...AHFRL.SE....DKI.F......L.A.I.FN..Y.IDH.L.F.L.....KI...K.........P....Q....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRTAKDAEDA-...........................-KR...........K...AIA-.--..--..-..-...-...K...G...E..EL.......................................................................................................................PEEEQFDR.N........CIT......P.............G...........TPFMKRL..SAQLEY.FISK......KVT....E.D..............AN.............................................W..R.......G...VK.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....E.GY..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.E..PHFALLREE..........................................................................................................................................................
V5HV58_BYSSN/1-227                     ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PPISQLIA-.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEVA-...........................-KE...........K...AIA-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMAKL..TQQLKY.FINK......KIS....E.D..............VD.............................................W..Q.......G...VD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.GY..D.A.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A6D2JJV0_9BRAS/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PKSISDVVEeeptdsgr....................................................................................gyaipvditRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.M.FE..Y.IDH.L.F.S.....LV...R.........P....R....K......V..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASEAE...........................AEE...........E...RLRQ.DF..EI..G..E...Q...V...L...S..AK.......................................................................................................................EKVETSDS.N........VIT......P.............G...........TPFMAIL..SVALQY.YIQS......RLN....H.N..............PG.............................................W..R.......F...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
H6BTC3_EXODN/1-259                     ..............................................................MGV..P..A...LF.R..W..L.T.KKY.....PKIISPVVEeqpyeidg.....................................................................................vqypvdttKPN.....................PNGE..EMH.N...LYLDF......NG..IVHPCS.................................HP-........................----EN...KPPPA.NE....SEM.M......M.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....R......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAARDAKEAD...........................EKKae.......fqT..lLRQQ.QQ..DR..D..D...V...S...D...E..EE.......................................................................................................................VIKKTWDS.N........VIT......P.............G...........TPFMFIL..AQSIRY.WVQW......KLN....T.D..............PA.............................................W..A.......E...LK.VI..ISDA......S...........V.........PGEGEHKIM.QFI.R....S....QR....................................................................SD.....P.EY..D.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A0L7K4X3_PLAFX/1-272                 ..............................................................MGV..P..T...FY.R..W..L.V.TRY.....PKIAKAVYEtrdsdvysrrtkyde......................................................................ngeyfkvhdlndyvnnT-Del................hcsDNIN.gYFD.N...MYLDM......NG..IIHLCS.................................HS-........................----DN...SKRAK.SN....EEI.F......L.N.V.FL..Y.VER.L.F.D.....II...E.........P....K....K......L..LYMA...........................I......D..............GV................APK.AKMN.QQ........R.SRR...FKSISCSEIE-...........................-KR...........A...YLEL.KE..RF..I..A...E...N...K...M..VP.......................................................................................................................EETTYWDS.N........VIT......P.............G...........TEFMHEL..SIALKY.FIEH......KIT....N.D..............EK.............................................W..K.......N...VV.VI..FSDS......N...........V.........CGEGEHKIF.NFI.K....S....QR....................................................................AQ.....P.GY..D.P.NTR.....................HVIHG.............M............D...AD.L................I..M.LSLA........S.H.E..PYFYILRE-i.........................................................................................................................................................
K2RVX6_MACPH/1-227                     ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HN-........................--DSDS...PTHRM.SE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....Q....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTARDAEEA-...........................-RE...........K...A--I.RE..--..-..-...-...-...G...V..EM.......................................................................................................................PAEPAFDS.N........CIT......P.............G...........TEFMARL..TQHLKY.FINK......KVS....E.D..............VD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................SQ.....P.GY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2J7QVF6_9NEOP/1-227                 ..............................................................MGV..P..K...FF.R..W..I.S.ERY.....P-CLSEVIK.....................................................................................................EYQ.....................---V.pEFD.N...LYLDM......NG..IIHTCS.................................HP-........................--NDFD...PHFRI.TE....EKI.L......K.D.I.FH..Y.IEV.L.F.R.....MI...R.........P....Q....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEIL-...........................-EQ...........K...ARE-.--..--..-..-...-...R...G...E..AL.......................................................................................................................PSEARFDS.N........CIT......P.............G...........TEFMAQL..HEQLKY.FVTY......KVS....T.D..............TL.............................................W..Q.......N...VK.VI..LSGH......E...........T.........PGEGEHKIM.DYI.R....Y....MK....................................................................SQ.....P.DY..D.Q.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A446Q744_TRITD/1-174                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kLQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHR......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....P.GF..I.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A1J9QH07_9EURO/1-259                 ..............................................................MGV..P..A...LF.R..W..L.S.SKY.....PKIISPVVEeipqeidg.....................................................................................eevpvdttKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EDM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAREAD...........................--E...........K...KEEF.AK..LL..R..K...Q...N...G...S..KGgeg................................................................................................................lveeVITKTWDS.N........VIT......P.............G...........TPFMDIL..AAALRY.WVAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................SC.....T.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A654GSJ4_9CEST/1-139                 ..............................................................MGV..P..K...FY.R..W..I.S.QRY.....P-CINQLVK.....................................................................................................ENE.....................---V.aPID.H...FYLDM......NG..IIHTSS.................................HC-........................---EDM...AFKAF.DE....AKV.F......A.N.I.EN..Y.ITY.L.V.T.....LM...K.........P....L....K......T..LYLA...........................V......D..............GV................APR.AKMT.QQ........R.ARR...FQGPKEAAAEI...........................KKR...........-...-R--.--..--..-..-...D...K...G...M..EV.......................................................................................................................DESAVFDP.N........AIS......P.............G...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------kllq......................................................................................................................................................
A0A1B8CHR6_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HK-........................--DSDD...ATFRM.TE....EQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....H....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVENA-...........................-RE...........K...AIR-.--..--..-..-...-...E...G...K..EM.......................................................................................................................PKEEAFDS.N........CIT......P.............G...........TEFMAKL..TEQLKY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....P.DY..D.H.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A482SU95_9ARCH/1-229                 ..............................................................MGV..P..K...FY.R..W..L.S.ERY.....P-LINQLIS.....................................................................................................GTA.....................-ILP..EFD.N...LYLDM......NG..IIHACT.................................HP-........................--NDNH...AANSL.TL....REM.M......L.S.I.FR..Y.IDR.I.V.T....eIV...K.........P....K....K......V..LFLA...........................I......D..............GV................APR.AKLN.QQ........R.ARR...FRAAQDRAES-...........................-IE...........K...A---.--..--..-..K...Q...R...G...E..VI.......................................................................................................................DESNLFDS.N........CIT......P.............G...........TEFMETV..HRHLKY.YIRK......KIK....E.D..............PI.............................................W..A.......A...LT.VI..YSGH......D...........V.........PGEGEHKIM.QYI.R....D....LR....................................................................AS.....P.TY..E.P.NVR.....................HCMYG.............Q............D...AD.L................I..M.LSLT........T.H.E..PHFALLRE-v.........................................................................................................................................................
A0A6G0I4Z7_LARCR/1-162                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....SSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KNRM.RE..EV..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------q.........................................................................................................................................................
A0A5N6Q1E6_9ASTR/1-250                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PRSISDVVEeeg..............................................................................................vegnG-Aqll...............rpnPNNI..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DEV.F......K.S.I.FD..Y.IDH.L.Y.S.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................A--...........E...EERL.RN..EF..E..A...Q...G...Aa.lA..TK.......................................................................................................................EKLETCDS.N........VIT......P.............G...........TKFMSVL..SVALQY.FIQC......RLN....H.N..............PG.............................................W..Q.......F...TK.VI..LSDS......N...........V.........PGEGEHKVM.SFI.R....L....QR....................................................................NL.....A.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A267DH31_9PLAT/1-227                 ..............................................................MGV..P..K...FF.R..W..I.S.ERY.....P-CLSEIVR.....................................................................................................EHE.....................--IP..EFD.N...LYLDM......NG..IIHPCS.................................HP-........................--EDDN...IHFRM.SE....EQM.F......K.N.V.MN..Y.VDF.I.F.R.....MI...K.........P....K....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKEAESQ-...........................-EA...........R...AIR-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PSESRFDS.N........CIT......P.............G...........TPFMARL..QDALTE.FAQR......KVA....E.D..............PL.............................................W..R.......G...IR.VV..LSGH......Q...........T.........PGEGEHKIM.EFI.R....Y....ER....................................................................SL.....P.DY..D.P.DTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........S.H.Q..AHFSLLREE..........................................................................................................................................................
A0A665UMH8_ECHNA/1-230                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgrecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-TE...........E...KSRM.RE..EI..I..S...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AHCLRY.YVAD......RLS....N.D..............PG.............................................W..R.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................A-.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------lisvfsiycqgta.............................................................................................................................................
F1MKX7_BOVIN/1-254                     ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-EI...........E...KQRV.RE..EI..L..A...K...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A4Y8D1X6_9HELO/1-254                 ..............................................................MGV..P..A...LF.R..W..L.T.KQY.....PKIVSPVIE.....................................................................................................EQPreidgqii.....pidirgpnPNGE..ECD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPK.DE....EEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKA...........................EDK...........-...-AEL.LK..MLksQ..G...S...H...I...E..ET.......................................................................................................................EVKKAWDS.N........EIT......P.............G...........TPFMDIL..ALSLRY.WIAY......KLN....T.D..............PA.............................................W..A.......K...MK.VI..ISDS......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................SS.....P.DH..N.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRILRE-d.........................................................................................................................................................
F4Q1L3_CAVFA/1-147                     ..............................................................MGV..G..G...LA.D..Y..I.S.TYY.....PSVVRFQQQqqhgvgvgggrprydhla................................................................agssymsvgqlrnklggrhSNN.....................TRGA..ETT.H...LFMDM......NS..IIHTIF.................................RR-........................------...-NPNT.DT....SKI.Y......K.Q.I.NM..R.IKQ.T.V.D.....EH...F.........P....V....K......T..LFLT...........................T......D..............GP................GPR.AKIP.LQ........R.KRR...SKSKED-----...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------gisss.....................................................................................................................................................
J7SB69_KAZNA/1-254                     ..............................................................MGV..P..S...FF.R..W..L.S.RKY.....PKIISPVLEerpqivd......................................................................................gvelpidyST-.....................ENAN.gELD.N...LYLDM......NG..IVHPCS.................................HP-........................----EN...KPPPE.TE....DEM.L......L.A.V.FE..Y.THR.V.L.N.....MA...R.........P....R....K......V..LVMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...LGLAKDAELQN...........................EKK...........E..eELRK.RE..HY..G..E...V...I...D...D..SV.......................................................................................................................KAKKTWDS.N........AIT......P.............G...........TPFMDKL..ALALRY.WTAF......KLA....T.D..............PG.............................................W..K.......N...LQ.VV..ISDA......T...........V.........PGEGEHKIM.NFI.R....S....QR....................................................................AD.....P.EY..N.P.NTS.....................HCIYG.............L............D...AD.L................I..F.LGLA........T.H.E..PHFKILRE-d.........................................................................................................................................................
XRN1_YEAST/1-227                       ..............................................................MGI..P..K...FF.R..Y..I.S.ERW.....PMILQ-LIE.....................................................................................................GTQ.....................-IP-..EFD.N...LYLDM......NS..ILHNCT.................................HG-........................--NDDD...VTKRL.TE....EEV.F......A.K.I.CT..Y.IDH.L.F.Q.....TI...K.........P....K....K......I..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTAMDAEKA-...........................-LK...........K...AIE-.--..--..-..-...-...N...G...D..EI.......................................................................................................................PKGEPFDS.N........SIT......P.............G...........TEFMAKL..TKNLQY.FIHD......KIS....N.D..............SK.............................................W..R.......E...VQ.II..FSGH......E...........V.........PGEGEHKIM.NFI.R....H....LK....................................................................SQ.....K.DF..N.Q.NTR.....................HCIYG.............L............D...AD.L................I..M.LGLS........T.H.G..PHFALLREE..........................................................................................................................................................
A0A0P0XZL5_ORYSJ/1-69                  ..............................................................MGV..P..S...FY.R..W..L.V.GKY.....PAIVSPAND.....................................................................................................DDDdvgs............ssngaAAPP..VYH.N...LYLDM......NG..IIHPCF.................................HPQ........................DQ----...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------vrvplhvr..................................................................................................................................................
A0A2K6PSM6_RHIRO/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
H9IT93_BOMMO/1-145                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..--MA...........................I......D..............GV................APR.AKMN.QQ........R.GRR...FRSAREAENL-...........................-EA...........E...A-K-.--..--..-..-...A...K...G...E..VL.......................................................................................................................PTEKRFDS.N........CIT......P.............G...........TVFMARL..HEQLKY.FVKH......KMS....T.D..............PL.............................................W..S.......K...VK.VI..LSGH......E...........T.........PGEGEHKIM.DYI.R....W....AR....................................................................SQ.....P.DY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGMC........T.H.E..PHFALLREE..........................................................................................................................................................
A0A397G222_9GLOM/1-244                 ..............................................................MGI..P..G...FF.R..W..L.S.LKY.....PHIVETVKK.....................................................................................................SPR.....................---N..KTD.F...LYLDI......NA..FFHVAL.................................RS-........................-KVKGK...PIKNM.AP....RRM.L......G.K.V.FA..E.MDT.A.F.N.....IT...D.........P....Q....V......L..IYIA...........................M......D..............GV................APR.AKMN.EQ........R.SRR...FMSQEEDKKKS...........................EKKke......dskQ...----.TI..NI..E..K...P...I...I...-..-Eksiie.............................................................................................................qstksGFFVPVDN.V........SIS......A.............G...........TEFMQAA..NEAIKF.YIYQ......RLN....-.-..............GK.............................................H..R.......N...IQ.II..FNDS......K...........V.........AGEGEHKVF.RFL.N....A....QR....................................................................NH.....P.NY..N.S.KHK.....................HVVCG.............G............D...AD.F................I..M.YALL........T.H.E..PSLRILR--p.........................................................................................................................................................
A0A251NRY2_PRUPE/20-268                ..............................................................MGV..P..S...FF.R..W..L.G.NKY.....PKAVVKAIV.....................................................................................................DQRdest.............sspnPNGM..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................-ESDED...GVQPT.SF....EEV.F......I.N.I.FE..Y.IDT.L.F.N.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FKSAKDKELAD...........................AEE...........E...KLRR.QF..EL..E..G...K...Q...V...L..QK.......................................................................................................................KENEVSDS.N........IIT......P.............G...........TDFMYKL..SNALGS.YISL......RLS....N.D..............SG.............................................W..R.......H...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....Q....QR....................................................................NF.....P.SY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-d.........................................................................................................................................................
R1CRJ5_EMIHU/1-179                     ..............................................................MGV..P..S...FF.R..W..L.A.ERY.....PLSLERLHRpcg...............................................................................................segEES.....................HAGA.gPID.N...LYLDL......NG..IIHPCF.................................HP-........................----EH...GPPPA.SE....DEV.F......L.A.I.LA..Y.IDR.L.L.E.....VV...R.........P....T....S......L..LYLA...........................V......D..............GP................APR.AKMN.QQ........R.SRR...FKSAAEAVAR-...........................-EQ...........L...RREV.EQ..EW..R..D...V...G...K...E..PPprad...............................................................................................................ggegGGGGLKDS.N........IIT......P.............G...........TPFMATL..GRWLRH.YAYA......R--....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------i.........................................................................................................................................................
A0A2X0P8N4_9BASI/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVLPVIEdtpvsvpgp...................................................................................dgqmeelpiD-Tsg.................anPNGE..EFD.N...LYLDM......NG..IVHPCT.................................HP-........................----DG...KPAPK.TE....QDM.M......H.E.V.FL..Y.TER.V.V.A.....MV...R.........P....R....K......L..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAAEAKVKE...........................EER..........iK...AIEE.WE..AM..G..K...E...V...S...D..EM.......................................................................................................................RGEKGWDS.N........AIT......P.............G...........TPFMDLL..AKSLRY.WVAK......KLN....E.D..............PG.............................................W..A.......G...LQ.VI..ISDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................SH.....S.SH..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PYFRVLRE-d.........................................................................................................................................................
A0A066XAD5_COLSU/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVIEeqp..............................................................................................vkmeD-Gseipv..........dttgpnPNGE..ELD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPK.DE....EEM.M......L.E.V.FR..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAQEKE...........................--E...........D...KQEL.LK..LL..K..Q...Q...N...G...G..AVsdd................................................................................................................slesVTKKAFDS.N........SIT......P.............G...........TPFMDIL..AASLRY.WCAY......KLN....T.D..............PA.............................................W..A.......R...LK.II..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................IS.....P.DY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A287S1Q5_HORVV/1-194                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NE..IIHKCF.................................GR-........................------...-----.KN....GQV.Y......L.R.F.FD..H.MDR.L.F.R.....LV...K.........P....R....R......L..LYLA...........................V......D..............GV................APM.AKTN.KL........R.QGY...FKSTKQGTDAE...........................--A...........E...AVLL.TE..IF..R..V...Q...G...K...E..VLp.....................................................................................................................rDTYEFEDR.T........VKM......P.............G...........TEFMETI..SMVLEW.FIRE......RLN....T.D..............PE.............................................W..K.......D..iKK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SR.....E.NY..D.P.NTR.....................HCLYG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-v.........................................................................................................................................................
G9NHM7_HYPAI/1-260                     ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVIEqtpivted....................................................................................gitipvdttQPN.....................PNGE..ELD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPA.DE....EEM.M......L.E.V.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......I..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKE...........................EDKqal.....ielL...KRQN.GG..TF..-..A...A...A...D...S..ET.......................................................................................................................VVKKAFDS.N........SIT......P.............G...........TPFMDIL..ALSLRY.WCQY......KLN....T.D..............PA.............................................W..A.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................AS.....P.NY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A022R9X2_ERYGU/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PKCIVDVVEeeprnaa......................................................................................ngaplpvdV-Sr..................pnPNGI..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.I.FD..Y.IDH.L.V.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................A--...........E...EERL.RK..EF..D..L...E...G...A...K..LLp.....................................................................................................................kEKTETSDS.N........VIT......P.............G...........TPFMAVL..SVALQY.YVQC......RLN....S.I..............PG.............................................W..R.......F...LK.VI..LSDA......N...........V.........PGEGEHKVM.SYI.R....L....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A4D8XY37_SALSN/1-237                 ..............................................................MGV..P..S...FY.R..W..L.V.NKY.....PKIVSDAAA.....................................................................................................SA-.....................-DPP..EID.N...LYLDM......NG..LIHPCF.................................HP-........................---DDD...PFPPT.TV....DDV.F......R.R.I.HD..Y.VDS.L.F.D.....IV...K.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDSQRA-...........................-EE...........V...EDKL.RK..QF..E..A...E...G...R...V..VLp.....................................................................................................................kQESEILDS.N........VIT......P.............G...........TEFMHLL..SENLRS.YVKR......RLR....E.D..............PA.............................................W..G.......N...IK.VI..LSDD......K...........A.........LGEGEHKIM.SFI.R....A....QR....................................................................AS.....S.EY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..AHFSILREE..........................................................................................................................................................
A0A077ZGF5_TRITR/1-126                 ..............................................................MGI..P..K...FA.R..L..L.C.ERY.....PSLVSYPLT.....................................................................................................PFY.....................SQIP..EFD.N...LYLDM......NG..IIHNCT.................................HD-........................--NNAE...VSIAR.PE....YEV.V......K.S.I.FA..Y.IEM.L.F.R.....VV...R.........P....K....K......L..FFMA...........................V......D..............GV................APR.AKIN.QQ........R.ARR...FMSAKNAEMA-...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------laklnqygtvlp..............................................................................................................................................
W2SKN8_NECAM/15-269                    ..............................................................MGV..P..A...FF.R..W..L.T.KKY.....PLIIVNANEdrqr.............................................................................................nadgT-Ripid............stkpnPNFQ..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPA.NE....DEM.F......A.L.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAWEKK...........................--A...........S...IEEQ.RR..RL..E..E...E...G...I...A..LPp....................................................................................................................kkEEESHFDS.N........CIT......P.............G...........TPFMARL..AEALRY.YIHE......RIT....T.D..............PA.............................................W..A.......K...IE.VI..LSDA......N...........A.........PGEGEHKIM.DFI.R....R....QR....................................................................SN.....P.AH..N.P.DTV.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..ANFNIIREE..........................................................................................................................................................
A0A0H5C301_CYBJN/1-101                 ..............................................................MAI..P..K...LY.S..I..I.Q.GRW.....PDTVAVANG.....................................................................................................---.....................-SSC..KCE.C...LYIDM......GS..ILHSAL.................................HR-........................------...---TQ.DQ....DGV.Y......K.A.L.KS..Y.IGQ.I.V.S.....MA...K.........P....T....V......L..IYVA...........................L......D..............GV................PPV.SKLK.EQ........A.MRR...KMSK-------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------tsgh......................................................................................................................................................
A0A5A9PDI8_9TELE/170-396               ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVHN......KLS....T.D..............KT.............................................W..Q.......G...VN.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....ES....................................................................AK.....P.SH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A2G4SLA7_RHIZD/1-227                 ..............................................................MGI..P..K...FF.R..W..I.S.ERY.....P-MCSELIT.....................................................................................................--D.....................-NGI.pEFD.N...LYLDM......NG..IVHNCS.................................HN-........................--NSDD...PHFRI.TE....EQI.W......L.G.I.FQ..Y.IDH.L.F.S.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAKDAEDA-...........................-RR...........K...AIQ-.--..--..-..-...-...N...G...E..EL.......................................................................................................................PPEAPFDT.N........CIT......P.............G...........TPFMIKL..TQQLRY.FISK......KVQ....E.D..............AN.............................................W..R.......N...VE.IV..LSGP......E...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....P.DY..D.P.NTR.....................HCLYG.............L............D...AD.L................L..M.LGLL........S.H.D..PHFALLREE..........................................................................................................................................................
D7G490_ECTSI/131-361                   ..............................................................MGI..P..K...LF.R..W..L.T.DQY.....PVISQRLDQ.....................................................................................................GLN.....................EHTA..PID.N...LYLDM......NG..VIHMCT.................................HH-........................---NDD...EFIEL.NE....KEM.F......R.R.I.FI..F.TDR.M.F.K.....LV...R.........P....R....R......L..LYLA...........................V......D..............GT................APR.AKMN.QQ........R.SRR...FRSSKEAEVN-...........................-MA...........E...--M-.--..-V..M..-...-...R...D...G..KL.......................................................................................................................PEVTRFDS.N........CIT......P.............G...........TDFMFKL..TKAFQA.WIEY......KMD....T.D..............PF.............................................W.qQ.......N...AR.VV..FSGP......D...........V.........PGEGEHKVM.DYI.R....E....AR....................................................................ET....eP.DW..R.D.DLR.....................HCLYG.............L............D...AD.L................I..M.LSLV........T.H.E..KHFSLLRE-k.........................................................................................................................................................
A0A059ES26_9MICR/1-66                  ..............................................................MGV..P..G...LF.K..H..F.V.KKY.....PNIVLENT-.....................................................................................................---.....................---P..PID.F...LYIDF......NA..IIHRSA.................................KP-........................----FI...LPPIK.KE....SDI.F......E.N.I.KL..Y.LEN.I.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------y.........................................................................................................................................................
A0A0V0X8L7_9BILA/1-227                 ..............................................................MGV..P..R...FF.R..W..L.S.ERY.....PGLSQLVVE.....................................................................................................-SQ.....................--IP..SYD.N...FYLDF......NG..IIHSCS.................................HP-........................--SFAD...ATFRC.TE....VDI.F......T.N.I.FS..Y.IEG.I.F.Q.....LI...K.........P....R....K......L..LFIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FMSAKEAEDS-...........................-RL...........K...AI--.--..--..-..-...R...N...G...E..VI.......................................................................................................................PDSDPFDS.N........CIT......P.............G...........TEFMERL..HIHLKY.FINL......KLS....S.D..............PL.............................................W..Q.......N...VD.VY..YSGH......D...........C.........PGEGEHKIL.AFI.R....F....MR....................................................................SQ.....A.DY..D.S.NTT.....................HCIYG.............L............D...AD.L................I..F.LGMA........M.H.E..PYFSILREE..........................................................................................................................................................
E9AD71_LEIMA/1-239                     ..............................................................MGV..K..G...LW.S..Y..V.E.HHS.....IQYAFPNKN.....................................................................................................ARA.....................DCYA.vNPR.H...LLVDM......NA..VLHMAY.................................DS-........................------...--TRP.TT....AAT.L......R.A.V.VA..K.MDE.L.L.T.....RV...R.........A....R....D......T..LVLV...........................Y......D..............GV................API.AKLK.TQ........K.ERR...NSLSVHPPRPA...........................KTV...........-...-ASS.KG..SG..N..G...S...-...-...-..IRvspwy.............................................................................................................tcdpvLGEVPLHR.E........EIL......C.............G...........AEFVLAC..EEYITT.YLQQ......RKA....-.H..............YS.............................................W..-.......-...AK.LI..VSGC......C...........E.........PGEGEVKIS.ALL.R....R....LW....................................................................AEtv.adG.SY..S.Q.DDV.....................VTMVG.............N............D...SD.L................I..L.VAMV........A.-.-..---------vpysyytli.................................................................................................................................................
A0A0S4JPQ7_BODSA/2-248                 ...........................................................gpq---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..--D.H...LYVDL......NS..LLYPAVniaadallqrlaa.......aeatgtggggmflHQKgs....................ssASTASA...VSVKE.AE....DAI.L......A.A.L.VT..L.LEK.L.C.S.....IC...P.........P....Q....K......L..LYIA...........................S......D..............GV................SPM.GKMS.HQ........R.ARR...QNSTARSAAR-...........................-RL...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................CDVTGFDI.T........MLT......C.............G...........SSFMARV..THASHY.FATMy...veRIN....S.K..............RHaancrrqhn..........................npnegssssaA..P.......L...LT.AV..VVDA......T...........S.........PGEGEHKIF.EAI.R....A....FR....................................................................SF.....E.SY..D.H.NVT.....................HCVCS.............S............D...TD.V................V..V.SALT........L.H.E..PFLYALR--fd........................................................................................................................................................
A0A4W6FTG9_LATCA/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KNRM.RE..EI..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AHCLRY.YVAD......RLS....N.D..............PG.............................................W..R.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFV.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A369S6P7_9METZ/1-227                 ..............................................................MGV..P..K...FF.R..W..I.S.ERY.....P-CLSQIIK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHNCS.................................HP-........................--DDAN...AHFRI.SE....EKI.F......L.D.I.FS..Y.IEV.L.F.R.....II...K.........P....R....K......V..LFMA...........................I......D..............GI................APR.AKMN.QQ........R.SRR...FRSAMEAKQV-...........................-IE...........K...A---.--..--..-..K...S...K...G...E..EL.......................................................................................................................PTEEAFDS.N........CIT......P.............G...........TEFMDKL..HRQLKY.FISR......KIS....T.D..............EA.............................................W..Q.......N...VD.IY..LSGH......E...........T.........PGEGEHKIM.EFI.R....H....LR....................................................................ST.....P.DY..D.H.NTR.....................HCLYG.............L............D...AD.L................I..I.LGLA........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A2G5V6T2_9PELO/40-296                ..............................................................MGV..P..A...FF.R..W..L.T.KKY.....PATVVNANEdrqrgvdg.....................................................................................rrvpvdctQPN.....................PNFQ..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPK.NE....DEM.F......A.L.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEMAEKAa........................siEEQ...........R...RRLI.AE..GI..A..V...P...Q...K...K..KD.......................................................................................................................EDEAHFDS.N........CIT......P.............G...........TPFMARL..ADALRY.YIHD......RVT....N.D..............PA.............................................W..A.......N...IE.II..LSDA......N...........V.........PGEGEHKIM.DYI.R....K....QR....................................................................GN.....P.AH..D.P.NTV.....................HCLCG.............A............D...AD.L................I..M.LGIA........T.H.E..ANFNIIREE..........................................................................................................................................................
A0A1B8EZZ1_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HK-........................--DSDD...ATFRM.TE....EQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....H....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVENA-...........................-RE...........K...AIR-.--..--..-..-...-...E...G...K..EM.......................................................................................................................PKEEAFDS.N........CIT......P.............G...........TEFMAKL..TEQLKY.FINK......KVS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....P.DY..D.H.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2Z7BZB1_9LAMI/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepvvied.....................................................................................vkipvdtsKPN.....................PNKI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................A--...........E...EERL.RA..EF..E..R...E...G...R...K..LPp.....................................................................................................................kQESQVFDS.N........VIT......P.............G...........TPFMAVL..STALQY.YIHL......RLN....N.D..............PG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GC..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A5M6C050_9TREE/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVNRVVEdapkrvrgpd................................................................................geiveeplryeNPN.....................PNGF..EVD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......V.E.I.FN..Y.TER.V.V.N.....MT...R.........P....R....K......V..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQDAADKE...........................EEK...........R..eAIKL.FE..VM..G..H...K...V...S...D..ET.......................................................................................................................ANKKSWDT.N........AIT......P.............G...........TPFMDLL..SISLKY.WVSY......KLT....N.D..............PG.............................................W..K.......D...LK.VI..LSDS......S...........V.........PGEGEHKIM.DWI.R....R....QR....................................................................SH.....P.NW..N.A.NTS.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A3Q1JGU9_ANATE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHHCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..QEQLTY.FVHN......KLS....T.D..............KL.............................................W..Q.......N...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................SK.....P.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A674C0Z1_SALTR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....STIVVHCTEerskecn.......................................................................................gvripvdT-Sk..................pnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KAAPK.NE....DEM.M......V.A.I.FE..Y.MDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KSRI.RE..EI..L..G...K...G...G...Y..LPp.....................................................................................................................vEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YVAD......RLS....N.D..............PG.............................................W..R.......N...IT.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.HH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1S3YVC2_TOBAC/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSIVDVVEeepkedsh....................................................................................glfvpvdvsKPN.....................PNGM..EFD.N...MYLDM......NG..IIHPCF.................................HPE........................-----G...KAAPA.TY....NDV.F......K.S.I.FD..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAAEAE...........................AE-...........-...EKRL.RE..EF..E..M...E...A...A...S..LLp.....................................................................................................................tGKPETSDS.N........VIT......P.............G...........TPFMAVL..AVALQY.YIHS......RLN....K.N..............AG.............................................W..R.......F...TK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
H0ZDX1_TAEGU/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSQVLK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.N.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..NEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...IT.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.HH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFALLREE..........................................................................................................................................................
S2JMG4_MUCC1/1-212                     ......................................................mcsqlitd---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................-NAI.pEFD.N...LYLDM......NG..IIHNCS.................................HN-........................--NNES...AHFRI.TE....EQI.W......I.G.V.FN..Y.IDH.L.F.S.....KI...K.........P....K....K......F..FFLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTARDAEET-...........................-KQ...........K...ALS-.--..--..-..-...-...K...G...E..EL.......................................................................................................................PEEDAFDS.N........CIT......P.............G...........TEFMKKL..TAELRY.FISK......KVS....E.D..............AN.............................................W..R.......G...VE.IV..LSGP......E...........V.........PGEGEHKIM.EYI.R....L....AK....................................................................AQ.....P.DY..D.P.NVR.....................HCLYG.............L............D...AD.L................V..M.LGLL........S.H.D..PHFALLREE..........................................................................................................................................................
A0A4V6T4M8_MUSBA/1-78                  ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveieg.....................................................................................vkvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................D-----...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------rvcplsfirlp...............................................................................................................................................
A0A077Z408_TRITR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.CKY.....PSIVVSCIE.....................................................................................................EKKrigdvei......pvnccepnPHGI..EFD.N...FYLDM......NG..IIHPCC.................................HP-........................----EN...KPAPA.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....II...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAEEKE...........................--I...........L...IKTR.RQ..EM..E..L...Q...G...I...P..LPp....................................................................................................................vdENAEHFDS.N........CIT......P.............G...........TPFMSRL..AECLRY.YIND......RLS....S.N..............PA.............................................W..K.......D...VA.VI..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AS.....P.SY..D.P.NLQ.....................HVICG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A3R7L1N2_9TRYP/1-242                 ...................................mgvlglrkfieassctkflpeiapeaa---..-..-...--.-..-..-.-.---.....--------Apasarsgea...................................................................................tqaachpalSSS.....................PAAA.pQAD.H...VLVDL......NC..VIHACF.................................GR-........................------...GASTT.TK....REV.V......Q.A.V.LE..Q.LRV.L.L.T....lVV...V.........P....R....L......S..LTIC...........................I......D..............GP................APY.AKLQ.TQ........R.LRR...RRLALLDTGG-...........................-A-...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................---QQLTS.L........AVT......P.............G...........SLFLVEL..ENALAA.QFKL......RGG....R.G..............--.............................................FlpH.......F...VP.VF..LHGS......T...........A.........AGEGEAKIA.RAL.A....H....LA....................................................................TAalprgG.RY..D.P.NHT.....................VVVVG.............N............D...ID.L................A..L.TCLG.......aT.Q.Y..HNLF-----vvg.......................................................................................................................................................
A0A1D3D544_9EIME/24-347                .................................................stksfsklsrcqa---..-..-...--.-..-..-.-.---.....DSMVQERQP.....................................................................................................EIH.....................KKDV.vETD.H...LLFDL......NQ..LLHQAAlksatah...................crhkcgtD-Qn.....................adSSSTGH...TPSDT.GD....RQV.L......R.A.L.WS..I.INN.T.F.K.....RF...R.........V....R....K......S..IVFA...........................I......D..............GV................PPI.AKLA.IS........Q.QRR...LRAARAGVLSAriees.................frarrA--...........-...KEGI.AS..--..-..-...-...-...-...-..-Glnrsseeynrcytdged....................................................................................cdtseaadalategaptgKSGYRIPS.Y........LLS......P.............G...........TYFMRQV..EGHCRK.FAKQ......LLL....-.S..............GL.............................................V..E.......A...SK.VF..LSGP......S...........S.........YGEGELKLA.DWI.N....F....SCdagrsqtqeassesqgas................................errsgrsaysrgrpcpglGL.....L.KV..K.P.TDS.....................IVVIG.............G............D...AD.L................V..V.QSLA........L.-.-..---------pfasnlfv..................................................................................................................................................
Q4CX39_TRYCC/6-119                     .......................................................alldtgs---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--AQQLTS.L........AVT......P.............G...........SLFLVEL..ENALAA.QFKL......RGG....R.G..............--.............................................FlpH.......F...VP.VF..LHGS......T...........A.........AGEGEAKIA.RAL.A....H....VA....................................................................TAslsrgE.RY..N.P.NHT.....................VVVIG.............N............D...ID.L................T..L.TCLG.......aT.Q.Y..HNLF-----vvg.......................................................................................................................................................
A0A4Z1SWH2_GIAMU/1-248                 ..............................................................MGV..T..R...LF.R..W..F.H.ERY.....PYAVGSPTA.....................................................................................................V--.....................-TRA..SIG.H...LYIDF......NS..LIHEVL.................................RR-........................---DSY...VTLQF.SE....ATM.F......G.E.I.AE..Y.LCA.V.V.A.....EV...Q.........P....Q....E......R..IYIA...........................V......D..............GV................APD.AKIN.QQ........R.QRR...VVGDAHAQMRRhyq....................sqiaD-Iaqv.....ydqT...AAFT.RE..TF..A..N...T...T...S...D..DK.......................................................................................................................TFPAQNTG.I........AIS......P.............G...........TCFMDRL..HSFMIL.FLTK......CVE...eR.R..............PG.............................................W..G.......H...CE.VV..FSGW......D...........V.........CGEGEHKIL.HEL.R....K....AR....................................................................TK.....P.EA..A.R.-GT.....................HCVFG.............M............D...GD.I................V..L.LTLG........V.H.L..PELYIMR--rw........................................................................................................................................................
A0A444TWP5_ACIRT/318-546               ..................................................eifapllvaens---..-..-...--.-..-..-.-.---.....-KNINKAKEcngig..........................................................................................vpvdtsKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.Y.N.....IV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKESVEL-...........................-TE...........E...KSRV.RE..EV..L..Q...R...G...G...Y..LPp.....................................................................................................................dEVKERFDS.N........CIT......P.............G...........TEFMDNL..ARCLRY.YVAE......RQN....N.D..............PG.............................................W..K.......N...IT.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................--.....-.--..-.-.---.....................-----.............-............-...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
Q0UB95_PHANO/1-227                     ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....PGISQLIA-.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HN-........................--DSDG...ATARK.SE....DQM.F......L.D.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RD...........K...A--I.RE..--..-..-...-...-...G...V..EM.......................................................................................................................PKEEAFDS.N........CIT......P.............G...........TAFMAKL..TQQLKY.FINK......KVS....E.D..............MD.............................................W..Q.......G...VE.VV..LSGH......E...........V.........PGEGEHKVM.EYI.R....Q....AK....................................................................AQ.....P.GY..D.P.NRR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
V9EEG2_PHYPR/1-255                     ..............................................................MGV..P..A...FY.R..W..V.L.EKY.....PKCVVDCVEsrav.............................................................................................vlesE-Rhfelt..........dttgpnPNGF..EVD.N...LYVDM......NG..LIHPCA.................................HP-........................----EN...GEAPK.TE....EEM.Y......R.R.V.MA..Y.VDR.L.V.A.....AV...R.........P....R....R......V..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAEQRM...........................--E...........V...EKEA.LE..YM..S..A...L...G...H...K..VP......................................................................................................................sKQEKPWDS.N........VIT......P.............G...........TKFMAKL..AKYLRF.YIRD......RVN....N.N..............AA.............................................W..K.......S...IK.VI..LSDA......G...........V.........PGEGEHKLM.QYI.R....V....QR....................................................................SQ.....P.GY..D.P.NQH.....................HVLHG.............L............D...AD.L................I..M.LGLA........T.H.E..VKFSILREE..........................................................................................................................................................
A0A341DEC8_NEOAA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A166RSJ2_9HYPO/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.SRY.....PKIISSVIEeqpiempd....................................................................................gsvvpidttRPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCA.................................HP-........................----ED...EPAPK.DT....EEI.M......L.A.I.FK..Y.TNR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQDAKEKE...........................ENKqe.......llK...----.--..LV..K..Q...Q...N...A...G..ALpse................................................................................................................htevNDQQVFDN.N........SIT......P.............G...........TPFMDML..AISLRY.WCQY......KLN....T.D..............PG.............................................W..A.......K...LK.VL..ISDA......T...........V.........PGEGEHKIM.NFI.R....S....QR....................................................................AS.....P.AH..N.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
B7QH01_IXOSC/1-253                     ..............................................................MGV..P..A...FF.R..W..L.S.KKY.....PSIVVHCVEekvvdgv.......................................................................................kvpvdmtKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCC.................................HP-........................----EN...KPAPK.NE....DEM.M......V.D.I.FE..Y.IDR.I.M.S.....VV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETAEK-...........................-VE...........E...MSRI.RT..EL..R..D...K...G...I...P..LPp....................................................................................................................ekPKSEHFDS.N........CIT......P.............G...........TPFMARL..AKCLHY.YVHD......RMN....N.D..............PG.............................................W..K.......N...IE.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AN.....P.KH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
C6HE87_AJECH/1-227                     ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAELA-...........................-KE...........K...AIK-.--..--..-..-...-...Q...G...I..EM.......................................................................................................................PKEEAFDS.N........CIT......P.............G...........TEFMAKL..TQQLKY.FINK......KVS....E.D..............VE.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....SK....................................................................AQ.....P.GY..Q.P.DIR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A6Q2XSN3_ESOLU/1-192                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVNS......KLS....T.D..............KA.............................................W..Q.......G...VS.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.GH..N.P.NVR.....................HCLYG.............L............D...AD.L................M..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A3M7MJB8_9PLEO/1-260                 ..............................................................MGV..P..A...MF.R..W..L.S.QKY.....PKIVSSVHEelpkkv........................................................................................gdavipvD-Rtg.................pnPNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...KPAPK.TE....ADM.M......M.A.I.FE..Y.TDR.V.L.G.....MV...R.........P....R....K......L..LYMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRAAREAKEKD...........................EERae.......fqK...---I.LN..SQ..K..A...N...R...-...-..-Gedin...............................................................................................................tleeVMEKTWDS.N........AIT......P.............G...........TPFMHLL..AESLQY.WCAY......KFT....T.D..............PS.............................................W..K.......D...MK.VI..ISDA......S...........V.........PGEGEHKIM.NFI.R....S....QR....................................................................AM.....P.TH..D.P.NTS.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PYFKVLRE-d.........................................................................................................................................................
U6LTL3_9EIME/3-207                     ........................................................rrwgml---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...---HA.NE....DLM.W......Q.S.V.FA..A.LDL.V.I.S.....TI...S.........P....R....K......L..LYLA...........................A......D..............GV................APR.AKMN.QQ........R.ARR...YRAAKSAREAA...........................EAQ...........A..rQLHA.MA..NV..I..E...V...T...A...-..-Hragaqgts.......................................................................................................gpnqagggAEVKGFDS.N........CIS......P.............G...........TEFMASF..FRHLRF.YCEK......KFK....E.D..............AR.............................................W..R.......G...LK.VL..LSGP......D...........V.........PGEGEHKIM.AYL.R....C....CK....................................................................AA.....G.NA..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........S.H.E..PQFALLREE..........................................................................................................................................................
A0A0C3CAL6_HEBCY/1-152                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIIYPVQE.....................................................................................................EEEikvpdengdnitvplnislpnPNGE..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......V.E.V.FK..Y.TER.V.V.N.....MI...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKDKE...........................DAR...........K...ESQW.ER..RF..R..R...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------krkm......................................................................................................................................................
A0A067RFP2_ZOONE/1-227                 ..............................................................MGV..P..K...FF.R..W..I.S.ERY.....P-CLSEVIR.....................................................................................................EYQ.....................-IP-..EFD.N...LYLDM......NG..IIHMCS.................................HP-........................--NDFD...PHFRI.TE....EKI.F......K.D.I.FH..Y.IEV.L.F.R.....MI...Q.........P....Q....R......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEIL-...........................-EK...........K...AR--.--..--..-..-...E...R...G...E..VL.......................................................................................................................PSDARFDS.N........CIT......P.............G...........TEFMARL..HEQLRY.FVTY......KVT....T.D..............TL.............................................W..Q.......K...VK.VI..LSGH......E...........T.........PGEGEHKIM.DYI.R....Y....MK....................................................................SQ.....P.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A2K6MIN4_RHIBE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A1Y1JE13_PLAGO/150-278               ......................................................ksksslln---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................----RTKA.N........DIT......C.............G...........SLFIQKI..SKFLLN.FVKY......LS-....S.Q..............GK.............................................Y..E.......H...IK.FY..VSTD......K...........E.........LGEGELKLM.NWI.Q....N....YI....................................................................ST.....N.ET..N.F.QINeagkedkgsicmspigaseesFVIVG.............A............D...AD.L................L..L.QCLA........L.K.K.lHNIYV----yty.......................................................................................................................................................
U6MBS9_EIMMA/28-295                    .................................................tgknfsllqrnqd---..-..-...--.-..-..-.-.---.....------C--.....................................................................................................QQQ.....................QQQQ.vPID.A...LLIDF......NA..LMHLCI.................................HGHlpstlp...........alslmqqQQQLQP...LLQQQ.HL....PLL.L......Q.R.V.LS..Y.LDL.L.V.R.....LV...R.........P....R....S......L..LCVT...........................L......D..............GV................PPA.AKLA.QQ........R.GRR...FRQQREQQLQQqqlqe................qqqlmlE--...........-...----.--..--..-..S...E...L...G...T..-Aagaatrpkatakpsr.........................................................................................tqqqpaeaaaaaataAEDNKFDI.N........SIG......P.............G...........THFMFLA..EAALKR.FISY......KQR....S.S..............RV.............................................W..G.......C..mRA.VL..LSGA......D...........V.........PGEGEHKLM.QLL.T....R....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------gswgphsaaladawssevqqqqqqqhprqqh...........................................................................................................................
A0A5N6F1I5_9EURO/1-257                 ..............................................................MGV..P..A...LF.R..W..L.S.NKY.....PKIISPVIEeqpyevn.......................................................................................geqipvdT-Tr..................pnPNGE..ELD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPA.NE....QEM.M......L.E.I.FN..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAKEAD...........................EKKe........efR...KQFL.KK..SK..E..D...Q...Q...I...H..EE.......................................................................................................................VIQKTWDS.N........VIT......P.............G...........TPFMDIL..AASLRY.WIAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................AA.....P.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
T0LBB7_COLGC/1-260                     ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVIEeqpv.............................................................................................kmddG-Seipvd...........ttgpnPNGE..ELD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPK.DE....EEM.M......L.E.V.FR..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQDAQQKE...........................--E...........D...KEEL.MK..LL..K..Q...Q...N...G...G..VIped................................................................................................................tlesMTKKAFDS.N........SIT......P.............G...........TPFMDIL..AASLRY.WCAY......KLN....T.D..............PA.............................................W..A.......R...LK.II..ISDA......T...........V.........PGEGEHKIM.SFV.R....S....QR....................................................................IS.....P.DY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A0H2RVV1_9AGAM/1-90                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.--MN.QQ........R.SRR...FRASQEAKEKE...........................EAR...........Q..eNLVL.WE..QM..G..Q...T...V...T...D..EM.......................................................................................................................RNKKSWDS.N........AIT......P.............G...........TPFMDLL..AASLRY.WVAK......KLN....T.D..............PG.............................................W..K.......Q...VR.YV..F---......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------dlfh......................................................................................................................................................
A0A093XUJ4_9PEZI/1-259                 ..............................................................MGI..P..A...AF.K..W..L.S.TKY.....PKILSPVIEdhpkdidn.....................................................................................vaipvdatQPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......L.E.I.FK..Y.TER.V.F.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKD...........................EDKael.....lkmL...RSQA.GG..QV..E..E...S...-...T...S..EA.......................................................................................................................MVTKTWDS.N........AIT......P.............G...........TPFMDIL..AASLRY.WTAY......KLN....T.D..............PA.............................................W..A.......K...VK.VI..LSDA......T...........V.........PGEGEHKIM.QFI.R....S....QR....................................................................SS.....P.NH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A1D6FJM1_MAIZE/23-57                 .........................................................clvlt---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.-QI.....................HCLYG.............L............D...VY.L................I..M.LALQ........T.H.E..VRFSILRE-v.........................................................................................................................................................
A0A182G723_AEDAL/1-227                 ..............................................................MGV..P..K...FF.R..Y..I.S.ERY.....P-CLSELIR.....................................................................................................E--.....................-NQV.pEFD.N...LYLDM......NG..IIHNCS.................................HP-........................--NDSD...VFFRI.TE....EKI.F......S.D.I.FH..Y.LEF.L.F.R.....MI...R.........P....Q....K......L..FFIA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAREAQEQ-...........................-ME...........E...AQ--.--..--..-..-...K...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TSFMVRL..QRALEH.FIKV......KVS....T.N..............PL.............................................W..K.......H...CK.VI..LSGH......E...........T.........PGEGEHKIM.EYI.R....Y....AK....................................................................AS.....P.DF..D.S.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........T.H.E..KHFSLLREE..........................................................................................................................................................
A0A388JQB6_CHABU/22-175                ...................................vrtneqsnvritepdhgltceqrnvcf---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-Q---------...........................-AA...........E...EEKL.RR..EF..E..A...E...G...R...K..IPp.....................................................................................................................kVKSETFDS.N........VIT......P.............G...........TEFMASL..AIALQY.YIHL......RLN....Y.D..............PG.............................................W..R.......N...VK.VI..LSDA......N...........V.........PGEGEHKIM.AYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..IHFTILRE-i.........................................................................................................................................................
A0A3B0K9F7_DROGU/1-191                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IVHNCS.................................HP-........................--DDNN...IHFYM.EE....QQI.F......Q.E.I.FN..Y.VDK.L.F.Y.....LI...K.........P....Q....K......L..FFLA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSSREAELQ-...........................-EA...........K...SL--.--..--..-..-...-...Q...R...G..EQ.......................................................................................................................REHERFDS.N........CIT......P.............G...........TDFMERL..QQGLRF.FLKT......KIS....T.D..............PL.............................................W..Q.......K...CS.VI..LSGQ......E...........T.........PGEGEHKIM.DYI.R....F....LK....................................................................AQ.....P.NF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..I.LGMC........T.H.E..LHFVVLREE..........................................................................................................................................................
E9GTH9_DAPPU/1-183                     .............................................................d---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..-YD.N...LYIDL......NE..IVHNCV.................................RA-........................---ARF...HKADD.RE....RRI.M......E.I.L.FE..K.IDQ.I.F.S.....IV...R.........P....R....K......L..LYVA...........................L......D..............GV................APR.AKRT.QQ........R.IRR...FGRSKPNQDE-...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-----FDG.N........CVS......P.............G...........TSFMCTL..SKNLML.YVDR......KLS....N.D..............PQ.............................................W..K.......N...IS.VI..FSDS......N...........V.........PGEGEHKIA.DFI.R....Q....QR....................................................................TQ.....P.CH..D.P.VTK.....................HVICG.............N............D...AD.L................I..L.LGLA........S.H.E..TNVTLLR--gd........................................................................................................................................................
A0A1Z5T623_HORWE/1-265                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIISPVLEerpeefenad................................................................................gsktkipvdgrKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......I.A.I.FE..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKDa........................aaA--...........-...--EY.HR..EM..L..A...K...G...A...I..TEnggg...............................................................................................................edseKPKKTWDS.N........SIT......P.............G...........TPFMDLL..AQSLRY.WVSY......KLS....T.D..............PA.............................................W..E.......K...LK.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.TH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A423XL86_9PEZI/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.TKY.....PKIVSPVVEdqpitmdd....................................................................................gtvipvdatRPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPK.DE....EEM.M......V.E.V.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQDAQQKE...........................ED-...........-...KQQL.IT..LL..K..K...Q...N...G...G..HHpae................................................................................................................steeVVKKAFDS.N........SIT......P.............G...........TPFMAIL..AASLRY.WCSY......KLN....T.D..............PA.............................................W..A.......N...VK.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A0V1BWV3_TRISP/414-640               ..............................................................MGV..P..R...FF.R..W..L.S.ERY.....PGLSQLVVE.....................................................................................................-SQ.....................--IP..SYD.N...LYLDF......NG..IIHNCS.................................HPN........................S---PD...ATFRC.TE....VDI.F......T.N.I.FS..Y.IEG.L.F.Q.....LI...K.........P....R....K......V..LFIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FMSAKEAEDS-...........................-RL...........K...AI--.--..--..-..-...R...N...G...E..VI.......................................................................................................................PDSDPFDS.N........CIT......P.............G...........TEFMERL..HIHLKY.FINL......KLS....S.D..............PL.............................................W..Q.......N...VD.VY..YSGH......D...........C.........PGEGEHKIL.AFI.R....F....MR....................................................................SQ.....A.DY..D.S.NTT.....................HCIYG.............L............D...AD.L................I..F.LGMA........M.H.E..PYFSILREE..........................................................................................................................................................
A0A2K6ESR1_PROCO/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........T.H.E..AHFSLLREE..........................................................................................................................................................
A0A1V2L963_CYBFA/1-227                 ..............................................................MGI..P..K...FF.R..F..I.S.ERW.....P-MISQLID.....................................................................................................GNQ.....................---I.pEFD.T...LYLDM......NS..ILHTCT.................................RP-........................--KDED...VTKRL.SE....EEV.F......S.A.I.FA..Y.IDH.L.F.D.....TI...K.........P....K....K......V..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKN-...........................-MK...........K...AIEL.G-..--..-..-...-...-...-...Q..EL.......................................................................................................................PEQEPFDS.N........SIT......P.............G...........TEFMHKL..TRYLKY.FIHK......KVS....T.D..............SK.............................................W..Q.......D...CE.II..LSGH......E...........V.........PGEGEHKIM.EFI.R....N....KK....................................................................AL.....P.DY..D.P.NTR.....................HCVYG.............L............D...AD.L................I..M.LGLV........S.H.D..PHFALLREE..........................................................................................................................................................
A0A091NBV9_APAVI/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekak............................................................................................ecngvK-Apidt.............skpnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.I.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AE...........E...KQKI.RQ..EI..L..A...K...G...G...I..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....S.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
W8W1L1_9VIRU/1-141                     ..............................................................MGI..K..Y...FF.K..W..F.K.DSF.....PKTVTKPFG.....................................................................................................REDqnlrda.........lanckgDNID..GLD.NpflLLLDL......NG..IIHTSC.................................QKIykygs.............fepkslLKKSPP...INSGE.KD....LLV.F......E.D.V.LN..S.INS.L.V.V.....KI...D.........P....K....E......I..VLC-...........................I......D..............GV................API.SKQI.QQ........R.QRR...FLSKKT-----...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------ngg.......................................................................................................................................................
A0A1R0GWU9_9FUNG/1-226                 ..............................................................MGV..P..K...FF.R..W..I.-.-RY.....PLISSNVS-.....................................................................................................--E.....................NSFP..EFD.N...LYLDM......NG..VIHNCT.................................HS-........................--NEGD...GNLGI.SE....NEM.F......L.R.I.FK..Y.TET.L.F.S.....KI...R.........P....N....K......L..FFIA...........................I......D..............GV................APR.AKMN.EQ........R.ARR...FRKIRDLEQL-...........................-KQ...........Q...ELE-.--..--..-..-...K...G...R...E..IV.......................................................................................................................TPENEFDS.N........CIT......P.............G...........TEFMERL..NEQLKY.FINK......KIS....E.D..............NG.............................................W..K.......K...VD.VI..LSGY......N...........V.........PGEGEHKIV.EYI.R....Y....IR....................................................................SL.....P.DH..N.P.NTR.....................HCLYG.............L............D...AD.L................V..M.LGLS........S.H.E..PHFCLLRE-l.........................................................................................................................................................
A0A0L1I907_PLAFA/45-259                .............................................................y-GI..P..R...MY.K..W..L.T.SYY.....PTVREELIN.....................................................................................................NEK.....................--QK..SVD.I...FYIDM......NG..VIHHCT.................................HAN........................----KE...KLPIY.DE....HEL.F......S.N.I.LQ..Y.LKN.L.F.Y.....LI...K.........P....K....K......L..IYIG...........................V......D..............GV................SPK.AKMN.QQ........R.KRR...FLSIFKINDN-...........................-DN...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-TSNLFNP.N........CIT......T.............G...........TDFMYKI..NLSLNK.WFKI......-LK....K.K..............KV.............................................F..E.......-...FD.VI..FSGS......D...........V.........AGEGEHKIL.KYI.R....E....NC....................................................................KR.....D.SN..F.K.NYN.....................HCIYG.............L............D...AD.L................I..M.LSLV........T.H.L..NNIFILRD-k.........................................................................................................................................................
A0A3P9QBB0_POERE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHK.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVYN......KVS....A.D..............KL.............................................W..Q.......N...VK.VF..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.NH..D.P.STR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..HNFSLLREE..........................................................................................................................................................
A0A5N6PVL9_9ASTR/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVIVDAVEeepveidg.....................................................................................iripvdtsKPN.....................PNQI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......Q.C.M.FE..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GC................APR.AKMN.QQ........R.SRR...FRAAKDSADA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kQESQTFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YVHQ......RLN....N.D..............PG.............................................W..K.......P...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A665V7G5_ECHNA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVHN......KIS....T.D..............KL.............................................W..Q.......N...VH.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.GH..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
V9SGR6_9VIRU/137-232                   .........................................................gipsc---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................----GFDP.N........SIT......C.............G...........TEFLDRL..QRYVER.GLSN......FCQ....-.K..............E-.............................................-..-.......K...FS.LV..FSSS......S...........E.........SGEGEHKAL.AFA.R....A....NG....................................................................--.....-.--..-.N.EES.....................HCFYS.............P............D...GD.L................V..L.LTMA........L.G.F..ENVSLLRQ-d.........................................................................................................................................................
F1PB11_CANLF/1-254                     ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1E5RAE7_9ASCO/1-230                 ..............................................................MGI..P..K...FF.R..Y..I.S.QRW.....PEISQLIE-.....................................................................................................GDQ.....................-IP-..EYD.N...LYLDM......NS..ILHNCT.................................RS-........................----ED...INIKM.TQ....EEV.F......A.K.I.FA..Y.IDH.L.F.N.....II...K.........P....K....N......T..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAKDAEQA-...........................-LN...........D...AIEK.GE..YI..P..N...A...N...G...-..--.......................................................................................................................DDEDNFDK.N........AIT......P.............G...........TEFMARL..TKNLKY.YIHD......KVS....K.D..............SA.............................................W..A.......S...IN.VI..FSGH......E...........V.........PGEGEHKIM.DYI.R....T....LR....................................................................SA.....K.DY..N.P.NTR.....................HCIYG.............L............D...AD.L................I..I.LGLV........T.H.E..PHLSILREE..........................................................................................................................................................
D8TUT9_VOLCA/1-195                     ..............................................................MGI..P..G...FN.V..W..F.S.EKY.....SKAYLPLD-.....................................................................................................---.....................--KV..RVD.H...LYIDL......NS..VLHTVM.................................RN-........................------...---AR.NH....GHF.H......K.L.L.HK..R.LSA.I.L.D.....VT...Q.........P....N....K......S..VMIA...........................V......D..............GP................APL.AKLL.TQ........R.DRR...KKKGRSVDEG-...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................---ETLTG.V........AIT......P.............G...........TTFMLDL..THSLTY.FCCT......KMS....-.G..............KR.............................................Y..R.......H...LL.FE..LSDS......N...........V.........MGEGEVKVL.GRL.A....R....PW....................................................................--.....H.PG..N.P.KDT.....................HVIFG.............D............D...AD.L................I..L.MALT........S.Y.-..---------kvple.....................................................................................................................................................
A0A4U0VWK0_9BASI/10-243                ..........................................vipgkdgqpdetipvdmsgp---..-..-...--.-..-..-.-.---.....---------.....................................................................................................--N.....................PNGE..EYD.C...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPK.TE....EEM.M......R.E.V.FI..Y.TDR.V.V.S.....MV...R.........P....R....K......L..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAKQKE...........................DDR...........Q..nAIAE.LE..AM..G..K...E...V...S...D..EY.......................................................................................................................RNEKGWDS.N........AIT......P.............G...........TPFMDLL..AKSLRY.WVRK......KIN....E.D..............PG.............................................W..A.......G...LE.VI..ISDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................VS.....G.EH..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PYFKVLRE-d.........................................................................................................................................................
A0A132A7L8_SARSC/1-243                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCDE.....................................................................................................GVK.....................-GQY..HFD.N...LYLDM......NG..IIHPCS.................................HP-........................----EN...KPPPA.NE....EEM.F......L.A.I.FE..Y.VEN.I.M.K.....IV...R.........P....K....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQESYEK-...........................-LI...........Q...IEEV.KE..NL..R..Q...K...G...L...A..VPe.....................................................................................................................kSESAHFDS.N........VIT......P.............G...........TNFMINL..SDALRS.WVNR......RLS....D.Dfd.........dtyEI.............................................W.pK.......D...LV.VI..LSDS......S...........V.........PGEGEHKIM.DYI.R....R....QK....................................................................AD.....K.EY..D.P.NLS.....................HCLYG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTILREE..........................................................................................................................................................
A0A1B9GC13_9TREE/8-267                 .............................................................q-GV..P..A...LF.R..W..L.S.KKY.....PKIVNRVVEdtpkkv.........................................................................................rtsdgeI-Eeipvr...........yegpnPNGF..EVD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....AEM.M......V.E.I.FK..Y.TER.V.V.N.....MT...R.........P....R....K......V..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAADKA...........................EEK...........R..eAIKM.FE..AM..G..H...I...V...S...E..ET.......................................................................................................................QNQKHWDT.N........AIT......P.............G...........TPFMDLL..SISLKY.WVSH......KLS....T.D..............PG.............................................W..K.......N...LK.VI..LSDS......S...........V.........PGEGEHKIM.DWI.R....R....QR....................................................................SH.....P.TW..D.A.NTS.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A096NVR5_PAPAN/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.S.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A2T7CKC2_9POAL/2-74                  .....................................................tnpglhtsi---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...LK.VI..LSDS......N...........V.........PGEGEHKIM.SFI.Q....A....QR....................................................................SR.....E.NY..D.P.NTH.....................HCLYG.............L............D...AD.L................I..M.LALA........S.H.E..LHFSILRE-n.........................................................................................................................................................
A0A183WGT7_TRIRE/25-177                ...........................gnfeeqlnwptatlnlpsihhqpewnldspstiae---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................---V.pVID.H...FYLDI......NG..ILHTCS.................................HPE........................G-----...SKKSV.SE....EAI.L......R.N.F.--..-.---.L.F.N.....LI...K.........P....R....K......T..FFMA...........................V......D..............GV................APR.AKMT.QQ........R.ARR...FQSALEGRIA-...........................-KE...........N...----.--..--..-..-...-...S...K...D..RS.......................................................................................................................PDGKHFDP.C........LIS......P.............G...........MSILLAL..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------ihhskkssvfr...............................................................................................................................................
V4TA43_9ROSI/1-254                     ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVADVIEeepvvidg.....................................................................................vkipvdtsKPN.....................PNGL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPAPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKDAADS-...........................-AA...........E...EERL.RQ..EF..E..R...E...G...R...K..LPp.....................................................................................................................kSDSQVFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....N.D..............PG.............................................W..E.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYV.R....L....QR....................................................................NL.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A063BZW4_USTVR/1-148                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.--MN.QQ........R.SRR...FRSAQEAKEK-...........................-EE...........N...KVEF.LK..LI..K..K...Q...N...G...G..LLppe.................................................................................................................htgQAKKAFDN.N........SIT......P.............G...........TPFMDIL..ATSLRY.WCRY......KLN....T.D..............PA.............................................W..A.......K...MK.IL..ISDA......T...........V.........PGEGEHKIM.SFI.R....S....QR....................................................................AS.....P.DY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A099ZFP1_TINGU/1-202                 ............................................................ip---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................TK.....P.HH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFALLREE..........................................................................................................................................................
A0A2K1QN91_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HN-........................--DSDS...VTKRM.TE....DQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTARDAEDA-...........................-RN...........K...AIA-.--..--..-..-...-...A...G...T..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TQFMARL..TQQLKY.FVNK......KVS....E.D..............YD.............................................W..Q.......N...VE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....K....AK....................................................................SQ.....P.GY..D.P.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A452SJ93_URSAM/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A4D9ESF4_9SAUR/13-248                .........................................awygdmqpkecngikipvdts---..-..-...--.-..-..-.-.---.....---------.....................................................................................................KPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEG-...........................-AE...........E...KQRI.RQ..EI..M..A...K...G...G...F..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A2K6DG83_MACNE/109-240               ...................................vlslaqpqvpvhhsqlrgreggflppe---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................EIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A139IH84_9PEZI/1-228                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PPISQLIA-.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HN-........................-DSDSV...TKARL.SE....DEM.F......I.K.I.FN..Y.IEF.L.F.G.....KI...K.........P....Q....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTALDAEKA-...........................-RD...........K...AVA-.--..--..-..-...-...E...G...R..EL.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMARL..TQQLKY.FVAK......KIS....E.D..............GD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................SQ.....H.DY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
F6HEH8_VITVI/1-254                     ..............................................................MGI..P..A...FY.R..W..L.A.DRY.....PLAVVNAVEdrpavvng.....................................................................................vsvavdttRPN.....................PNGN..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----EG...LPAPK.TY....TDV.F......K.A.V.FK..Y.IDR.I.F.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAAKEAADDA...........................SGT...........E...RLKT.VF..ES..E..M...E...M...L...A..LL.......................................................................................................................DQTKKLDS.N........VIT......P.............G...........TEFMALL..SSALKY.YIHL......RMN....L.D..............PG.............................................W..R.......G...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..IHFSILRE-d.........................................................................................................................................................
A0A5N5NKN5_9ROSI/200-332               ...........................................................wsf---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................--R.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kESSQTFDS.N........VIT......P.............G...........TEFMAVL..SLAAQY.YIHL......RLN....Y.D..............PG.............................................W..K.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GY..N.P.NTR.....................HCLYA.............-............-...--.-................-..-.----........-.-.-..---------flngmv....................................................................................................................................................
A0A395RQP7_FUSSP/1-228                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...VSFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTALDAEKA-...........................-RD...........K...AIS-.--..--..-..-...-...E...G...V..EI.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TAFMAKL..SQQLRY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.H.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A094FIH6_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HK-........................--DSDD...ATFRM.TE....EQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....H....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVENA-...........................-RE...........K...AIR-.--..--..-..-...-...E...G...K..EM.......................................................................................................................PKEEAFDS.N........CIT......P.............G...........TEFMAKL..TEQLKY.FINK......KVS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....P.DY..D.H.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
F8WDA0_HUMAN/1-107                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FR---------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------lcld......................................................................................................................................................
A0A6A4NC43_LUPAL/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVIVDAIEeepvvieg.....................................................................................tqipvdtsKEN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......E.C.M.FD..Y.IDR.L.F.C.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASDA-...........................-AA...........E...EARL.RE..EF..E..R...E...G...R...R..LPl.....................................................................................................................kEESQTFDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YVHL......RLN....N.D..............PG.............................................W..Q.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....K.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A3B6LR47_WHEAT/1-147                 .............................................................m---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.AKMN.KL........R.QGY...FKYAKHHTDA-...........................-EA...........E...AVLL.TE..IF..R..A...Q...G...K...E..VLp.....................................................................................................................rGTYELEDP.T........VKM......P.............G...........TEFMEKI..SILLEY.FIRE......RLK....M.D..............PE.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................ST.....E.NY..D.P.NTR.....................HCMHG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-v.........................................................................................................................................................
A0A087WQ18_MOUSE/1-40                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..--MA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................KKA...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------iekgetl...................................................................................................................................................
A0A0J7K6X8_LASNI/105-197               .............................................................v---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............G...........TPFMARL..SACLHY.YIHE......RLN....N.D..............PG.............................................W..R.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................SQ.....P.DH..D.P.NTQ.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A5C3L4H2_9AGAR/1-227                 ..............................................................MGI..P..K...FF.R..Y..I.S.ERY.....P-LTSQLIQ.....................................................................................................EN-.....................--KI.pEFD.N...LYLDF......NG..IIHNCS.................................HP-........................--NDED...AHYRI.TE....EQI.F......T.A.I.FT..Y.VDH.L.F.E.....KI...K.........P....K....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRTAKEAQEV-...........................-RE...........K...AER-.--..--..-..-...-...K...G...E..KL.......................................................................................................................PEEKAFDS.N........CIT......P.............G...........TPFMVRL..SDQLRY.FINK......KIS....E.D..............SN.............................................W..R.......N...VE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....SR....................................................................AQ.....P.DY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A094AVR8_9PEZI/1-259                 ..............................................................MGI..P..A...AF.K..W..L.S.TKY.....PKILSPVIEdhpkdvdn.....................................................................................vaipvdatQPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......L.E.I.FK..Y.TER.V.F.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKD...........................EDKael.....lkmL...RSQA.GG..QV..E..E...S...-...T...S..EA.......................................................................................................................MVTKTWDS.N........AIT......P.............G...........TPFMDIL..AASLRY.WTAY......KLN....T.D..............PA.............................................W..A.......K...VK.VI..LSDA......T...........V.........PGEGEHKIM.QFV.R....S....QR....................................................................SS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A2J7QVG3_9NEOP/1-227                 ..............................................................MGV..P..K...FF.R..W..I.S.ERY.....P-CLSEVIK.....................................................................................................EYQ.....................---V.pEFD.N...LYLDM......NG..IIHTCS.................................HP-........................--NDFD...PHFRI.TE....EKI.L......K.D.I.FH..Y.IEV.L.F.R.....MI...R.........P....Q....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEIL-...........................-EQ...........K...ARE-.--..--..-..-...-...R...G...E..AL.......................................................................................................................PSEARFDS.N........CIT......P.............G...........TEFMAQL..HEQLKY.FVTY......KVS....T.D..............TL.............................................W..Q.......N...VK.VI..LSGH......E...........T.........PGEGEHKIM.DYI.R....Y....MK....................................................................SQ.....P.DY..D.Q.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLC........S.H.E..PHFSLLREE..........................................................................................................................................................
H3AKR8_LATCH/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TAFMARL..HNHLKY.FVNM......KIS....N.D..............KA.............................................W..H.......G...VA.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....A....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
K0KTQ3_WICCF/1-227                     ..............................................................MGI..P..K...FF.R..F..I.S.ERW.....P-LISQLID.....................................................................................................GNQ.....................---I.pEFD.N...LYLDM......NS..ILHTCT.................................RP-........................--KDED...VTKRL.SE....EEV.F......S.A.I.FA..Y.IDH.L.F.D.....TI...K.........P....K....E......V..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTAVDAEKN-...........................-LE...........K...AIK-.--..--..-..-...-...E...G...T..EI.......................................................................................................................PKDEPFDS.N........SIT......P.............G...........TEFMAKL..TRYLKY.FIHK......KVS....T.D..............SR.............................................W..Q.......N...VQ.II..LSGH......E...........V.........PGEGEHKIM.EFI.R....T....KK....................................................................AS.....K.DY..N.P.NLR.....................HCIYG.............L............D...AD.L................I..M.LGLV........S.H.E..PHFALLREE..........................................................................................................................................................
A0A4W6FRX4_LATCA/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KNRM.RE..EI..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AHCLRY.YVAD......RLS....N.D..............PG.............................................W..R.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFV.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A2R8FCT6_9VIRU/84-177                .........................................................sptpf---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-----FNS.N........VIS......P.............G...........TDFMFRV..DDFLRS.WIED......NVA....-.-..............--.............................................I..L.......P...PQ.IV..YSSH......M...........V.........PGEAEQKIF.DFF.R....E....NA....................................................................--.....-.--..-.L.PGS.....................HCISG.............L............D...AD.L................V..V.LSLT........V.P.S..-NMLVIRQ-d.........................................................................................................................................................
A0A5B0P5E6_PUCGR/1-191                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCS.................................HP-........................--STPT...ADFQI.TE....PEI.F......S.G.I.FA..A.LEH.L.F.T.....LA...K.........P....K....K......L..FFMA...........................V......D..............GV................APR.AKMN.EQ........R.SRR...FKAAQANETML...........................QRN...........-...---A.FR..RF..Q..-...-...-...-...-..--.......................................................................................................................SDSNSFDS.N........CIT......P.............G...........TPFMARL..HEQLKY.FINK......KVT....E.D..............PV.............................................W..Q.......A...VQ.VI..FSGH......D...........V.........PGEGEHKIM.EYI.R....R....AK....................................................................TQ.....Q.DY..S.P.HIR.....................HCIYG.............L............D...AD.L................I..M.LALL........S.H.E..PHFCLLREE..........................................................................................................................................................
L8H1S3_ACACA/1-81                      ..............................................................MGV..P..K...FF.A..W..L.A.QKC.....PQMIHPVTR.....................................................................................................--D.....................-SIV..DVD.N...LYLDM......NG..VVHQCR.................................QG-........................------...---AN.SE....EEL.I......V.A.T.FQ..Y.IEA.L.V.D.....IV...R.........P....K....K......Y..LYMA...........................V......D..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------ds........................................................................................................................................................
A0A1D6PUT5_MAIZE/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveieg.....................................................................................vrvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..MYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................--A...........E...EERL.RE..EF..E..R...E...G...R...R..LPa.....................................................................................................................kQQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHQ......RLN....Y.D..............PG.............................................W..K.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
Q6K2K4_ORYSJ/1-229                     ..............................................................MGI..P..S...FY.R..W..L.V.NRY.....PSIVSPAKE.....................................................................................................SRP.....................ADGI.vVYD.N...LYLDM......NQ..IIHYSF.................................HPQd......................qMNAGTD...VCAPT.TV....SEV.F......E.S.M.FD..Y.LDR.L.F.R.....IV...R.........P....R....R......L..LYLA...........................V......D..............GV................APC.AKMNgMR........R.GRR...FAWASEEEEM-...........................-QK...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................ISEGVSDP.N........VIT......P.............G...........TEFMEKI..SQALTY.YIRA......RLN...sS.D..............PG.............................................W..K.......H...IM.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SM.....E.GY..D.P.NTR.....................HCLFG.............H............D...AD.L................I..M.LALA........S.H.E..VHFSILRE-d.........................................................................................................................................................
A0A2G3AJV2_CAPAN/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVIVDVIEeeaavie.......................................................................................gikvpvdN-Sk..................pnPNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.S.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AA...........E...EEKL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kQVSQVFDS.N........VIT......P.............G...........TQFMATL..SVSLQY.YIHL......RIN....H.D..............PG.............................................W..K.......K...IK.VV..LSDA......N...........V.........PGEGEHKIM.SYI.R....Q....QR....................................................................NL.....T.GH..D.P.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
Q4QJ53_LEIMA/1-228                     ..............................................................MGV..P..K...FF.R..W..A.A.ERF.....PSIITPFKD.....................................................................................................---.....................-SPP..PVD.N...LYLDI......NG..IIHNCT.................................HPN........................D--VDA...TRRSP.TE....KEM.I......Q.A.M.FV..Y.LEK.L.F.N.....AI...Q.........P....R....K......Y..FLLA...........................V......D..............GV................APR.AKMN.QQ........R.QRR...YRAGYEMMIA-...........................-RE...........E...ALA-.--..--..-..-...M...G...E...E..VP.......................................................................................................................EEKDVFDS.N........CIT......P.............G...........TPFMVRV..SKEFQY.FITM......KLS....T.D..............PA.............................................W..Q.......G...CQ.II..FSGH......D...........C.........PGEGEHKIV.DFI.R....R....RK....................................................................MQ.....P.NY..D.P.NET.....................HCMYG.............L............D...AD.L................V..M.LALA........T.H.E..PHFVLLRE-v.........................................................................................................................................................
A0A1B9GXB5_9TREE/8-267                 .............................................................q-GV..P..A...LF.R..W..L.S.KKY.....PKIVNRVVEdtpkrvrgpe................................................................................geiveepvryeNPN.....................PNGF..EVD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......A.E.I.FK..Y.TER.V.V.N.....MT...R.........P....R....K......V..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQDAADKE...........................EER...........K..eAIKM.FE..AM..G..H...P...V...S...E..ET.......................................................................................................................QKTKSWDT.N........AIT......P.............G...........TPFMDLL..SKSLKY.WVSR......KLT....E.D..............PG.............................................W..A.......N...LK.II..LSDS......S...........V.........PGEGEHKIM.DWI.R....R....QR....................................................................SY.....D.SW..D.P.NTS.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PNFRVLRE-d.........................................................................................................................................................
A0A669BQH5_ORENI/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...FYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................KKA...........-...----.--..--..-..L...D...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..QEQLKY.FVHN......KLS....N.D..............KL.............................................W..Q.......N...VK.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................TK.....P.NH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A3R7MJ20_PENVA/1-227                 ..............................................................MGV..P..K...FF.K..W..I.S.ERY.....PSLSEVVK-.....................................................................................................DYQ.....................--IP..DFD.N...LYLDM......NG..IIHICS.................................HP-........................--NDND...PHFRM.TE....EKM.F......Q.D.I.FH..Y.IEV.L.F.R.....LV...Q.........P....K....E......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAREAVEC-...........................-EK...........K...A-R-.--..--..-..-...D...R...G...E..VL.......................................................................................................................PSEERFDS.N........CIT......P.............G...........TEFMVRL..DAQLQY.FVTC......KIS....Q.D..............KM.............................................W..Q.......N...CK.VI..YSGH......Q...........T.........PGEGEHKIM.EYI.R....Y....SK....................................................................SQ.....P.NY..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A287SKG3_HORVV/1-184                 .............................................................p---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...----T.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-g.........................................................................................................................................................
A0A517L0M0_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..M.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HN-........................--DSDS...VTHRM.SE....DQM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVEKA-...........................-RE...........K...A--I.QE..--..-..-...-...-...G...I..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TQFMARL..TKHLKY.FVNK......KVS....E.D..............VE.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.DY..D.P.NRR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A452QNR8_URSAM/1-177                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........-------..-----K.FTER......KIP....S.D..............QF.............................................F..F.......Q...DF.IY..LTQR......-...........E.........--KGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A1S3LVY0_SALSA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PSEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVNS......KLS....T.D..............NA.............................................W..K.......G...VN.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....R....EN....................................................................SE.....P.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................M..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
A0A448ZAR6_9STRA/284-688               ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PKINQRYGSlpdpdtardhf..............................................................................perssppptpfeE-Pdpm..............atcgL-GA.pPID.R...LYLDM......NG..IIHGCS.................................HNNdedenknvag...sxsdkdtdasvEAGSRN...KAGGI.SR....EEI.F......R.N.V.CY..Y.LDR.V.V.G....dMV...Q.........P....Q....Q......M..VYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...YRSGGEGEIETtiyea................hraaqdEKE...........R...LRRM.E-..--..-..-...-...-...-...-..-Eegfddeerekeqelydasysfvldhnegntipssygnnredeenimqkktkrdak.........npiaaggendaxgnsxssssttssggdlqevtrgrfkgkfesssssitsqevvpxAATNXFHS.N........EIT......P.............G...........TPFFSEF..TKHLEH.FVKR......KLS....T.D..............PK.............................................W..K.......N...LT.II..FSGP......N...........V.........PGEGEHKIM.QFL.R....E....QR....................................................................EL.....P.DY..D.P.NLR.....................HCIMG.............Q............D...GD.L................I..M.LGLL........T.H.E..PNMVLLRE-k.........................................................................................................................................................
A0A0V0X896_9BILA/1-227                 ..............................................................MGV..P..R...FF.R..W..L.S.ERY.....PGLSQLVVE.....................................................................................................-SQ.....................--IP..SYD.N...FYLDF......NG..IIHSCS.................................HP-........................--SFAD...ATFRC.TE....VDI.F......T.N.I.FS..Y.IEG.I.F.Q.....LI...K.........P....R....K......L..LFIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FMSAKEAEDS-...........................-RL...........K...AI--.--..--..-..-...R...N...G...E..VI.......................................................................................................................PDSDPFDS.N........CIT......P.............G...........TEFMERL..HIHLKY.FINL......KLS....S.D..............PL.............................................W..Q.......N...VD.VY..YSGH......D...........C.........PGEGEHKIL.AFI.R....F....MR....................................................................SQ.....A.DY..D.S.NTT.....................HCIYG.............L............D...AD.L................I..F.LGMA........M.H.E..PYFSILREE..........................................................................................................................................................
A0A671E279_RHIFE/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AI--.--..--..-..-...E...K...G...E..IL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A4W4F501_ELEEL/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEeksk.............................................................................................ecngV-Ripvd............tskpnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....II...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEL-...........................-TE...........E...KHRM.RE..EV..L..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLT....N.D..............PG.............................................W..R.......T...LS.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A674NUW3_TAKRU/15-259                ............................................wqkfrwfhknkylfsqgk---..-..-...--.-..-..-.-.---.....--------Ecngvr..........................................................................................ipvdttRPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGAEL-...........................-VE...........D...KKRI.RE..EV..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.N..............PG.............................................W..R.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A287LYE2_HORVV/1-254                 ..............................................................MGV..P..S...FY.R..W..L.A.EKY.....PMLVVDVVEeepveieg.....................................................................................vkvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----DD...RASPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kQQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A328DZ44_9ASTE/1-250                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSIADVAE.....................................................................................................EEPrdgmpfp.......vdvsgpnPNGM..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----EG...MPAPA.TY....NDV.F......K.S.I.FE..Y.IDH.L.F.S.....LI...R.........P....R....K......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FKAAKDAAETE...........................A--...........-...EERL.RK..EF..E..I...E...G...A...K..LS......................................................................................................................vEKTETSDS.N........VIT......P.............G...........TPFMAVL..SVALQY.YIQS......RLN....S.N..............AG.............................................W..R.......F...TK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................DL.....P.GF..D.P.NTS.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A453M1U1_AEGTS/8-262                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAEEeepvele......................................................................................pgafvpvdP-Rr..................pnPNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
XRN2_CHICK/1-254                       ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekake...........................................................................................cngvkA-Svdt..............skpnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.I.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AE...........E...KQKI.RQ..EI..L..A...K...G...G...I..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....S.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PHFTIIREE..........................................................................................................................................................
A0A1C1CF09_9EURO/1-265                 ..............................................................MGV..P..A...LF.R..W..L.T.RKY.....PKIITPVIEeqpvdidg.....................................................................................vkypvdttKPN.....................PNGE..EFH.N...LYLDF......NG..IVHPCS.................................HP-........................----ED...KPPPA.NE....TEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....R......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSARDAKEAD...........................EKK..........aE...FQTL.LR..QQ..R..S...N...N...-...-..-Ddddddd..........................................................................................................eadtveeVVKKTWDS.N........VIT......P.............G...........TPFMFIL..AQSIRF.WVQW......KLN....T.D..............PA.............................................W..A.......Q...LK.VV..ISDA......S...........V.........PGEGEHKIM.QFI.R....S....QR....................................................................SD.....P.AY..D.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGIA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A0B7NCD2_9FUNG/471-699               ...................................lqtmlfqslvgilaycmlavrvqtdif---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................---R.pSQD.N...LYLDM......NG..IIHNCS.................................HN-........................--NNDS...AHFRI.TE....EQI.W......I.G.V.FN..Y.IDH.L.F.S.....KI...K.........P....K....K......F..FFLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTARDAEEA-...........................-KQ...........K...ALA-.--..--..-..-...-...R...G...E..EL.......................................................................................................................PEEDAFDS.N........CIT......P.............G...........TAFMKKL..TAELRY.FISK......KMS....E.D..............AN.............................................W..R.......G...VQ.VV..LSGP......E...........V.........PGEGEHKIM.EYI.R....L....AK....................................................................AQ.....P.DY..D.P.NVR.....................HCLYG.............L............D...AD.L................V..M.LGLL........S.H.D..PHFALLREE..........................................................................................................................................................
A0A1Y2CP01_9FUNG/127-255               ........................................................vpgvsv---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....K......S..LFIA...........................V......D..............GP................PPL.PKLL.LQ........R.SRR...QETAKKRRTT-...........................-T-...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-KALRFNS.L........NFT......P.............G...........SLFMTRL..DAALSH.YAAT......IVA....R.S..............-P.............................................W..I.......-...QE.VI..VRGS......R...........D.........PGEGEVKIV.KRI.V....T....PI....................................................................PT.....T.KP..T.E.THV.....................HMIVT.............G............D...SD.A................I..I.Q---........-.-.-..---------sn........................................................................................................................................................
A0A210PHS3_MIZYE/1-255                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCIEqkak............................................................................................evdgqK-Vpvdt.............sqpnPNDY..EFD.N...LYLDM......NG..IIHPCC.................................HP-........................----ED...RPAPK.NE....DEM.M......V.L.I.FE..F.IDR.I.F.S.....IV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKETVEK-...........................-KE...........E...MAAM.RA..QL..E..A...K...G...C...S..VPp....................................................................................................................pkPPGEHFDS.N........CIT......P.............G...........TPFMFKL..AECLIY.YIYD......RLN....T.D..............PG.............................................W..Q.......D...IK.VI..LSDA......N...........S.........PGEGEHKIM.DYI.R....K....QR....................................................................AQ.....P.DH..D.P.NTK.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PYFTIIREE..........................................................................................................................................................
A0A446NWN3_TRITD/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveieg.....................................................................................vqvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..MYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kLQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHR......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....D.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A3B6KJY3_WHEAT/1-265                 ..............................................................MGI..P..S...FF.S..W..L.V.GKY.....PKIVGTIIDvysasssedeeeekee....................................................................keeeegeeeeveedddeE-D....................eDEEE.iIYD.N...LYLDM......NE..IIHKCF.................................RL-........................------...-----.NN....GLV.Y......N.W.F.FA..Y.LDR.L.F.R.....MV...R.........P....R....R......L..LYLA...........................V......D..............GV................APM.SKMT.KL........R.QRY...FKTAKYRADS-...........................-EA...........E...AILL.TE..IF..R..A...Q...G...K...E..VMp.....................................................................................................................rDTYELQNP.V........VKV......P.............G...........TEFMEKI..SAALEY.FIHE......RLN....T.D..............PE.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SM.....E.NY..D.P.NTR.....................HCLHG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-f.........................................................................................................................................................
A0A6I8SI98_XENTR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHSVEekpkecnn.....................................................................................ikipvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVES-...........................-SE...........E...KQRI.RE..EV..L..S...K...G...G...Y..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.HH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PYFTIIREE..........................................................................................................................................................
A0A286U9W3_9AGAM/1-227                 ..............................................................MGI..P..K...FF.R..Y..I.S.ERY.....P-MTSQLIE.....................................................................................................ENK.....................---I.pEFD.N...LYVDF......NG..IIHNCS.................................HP-........................--NDND...AHFRL.SE....QQI.F......T.A.I.FS..Y.VDM.L.F.G.....KV...K.........P....K....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRTAKEAKEI-...........................-RE...........K...AL--.--..--..-..-...R...N...G...E..KL.......................................................................................................................PDEKAFDS.N........CIT......P.............G...........TTFMARL..SDQLRY.FVNK......KIT....E.D..............AN.............................................W..R.......D...IE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....AK....................................................................AQ.....P.DY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A3B6H2I0_WHEAT/1-233                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeepveieg.....................................................................................vqvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.I.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kLQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHR......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............-...--.-................-..-.----........-.-.-..---------v.........................................................................................................................................................
M3JTD0_CANMX/1-226                     ..............................................................MGI..P..K...FF.R..F..I.S.ERW.....P-LISQLID.....................................................................................................ENQ.....................---I.pEFD.N...LYLDM......NS..ILHACA.................................HS-........................---NDE...SITRL.TD....DEM.F......S.S.I.FH..Y.IEH.L.F.Q.....II...K.........P....Q....K......T..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTAYEAELK-...........................-MK...........K...AIE-.--..--..-..-...-...E...G...Q..AL.......................................................................................................................PKEEPFDS.N........SIT......P.............G...........TEFMSNL..TKNLKY.FIHK......KIT....E.D..............SS.............................................W..A.......N...IE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....A....MR....................................................................SQ.....E.GY..N.P.NLR.....................HCIYG.............L............D...AD.L................I..M.LSLV........T.H.D..PHFALLREE..........................................................................................................................................................
A0A1V8V4U2_9PEZI/1-262                 ..............................................................MGV..P..A...LF.R..W..L.S.QKY.....PKIISPVIEeageev........................................................................................dngdgttT-Klpid............argpnPNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......I.A.V.FE..Y.TER.V.V.N.....MC...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKD...........................--K...........A...VQEY.HE..MM..A..S...K...G...Q...V..VEga..................................................................................................................gdeKPAKTWDS.N........AIT......P.............G...........TPFMDIL..AASLRY.WVSY......KLS....T.D..............PA.............................................W..E.......K...LK.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................QS.....P.TH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A1X0P557_9TRYP/1-233                 ..............................................................MGT..K..G...LW.G..Y..L.E.SHG.....--LISQARG.....................................................................................................NKG.....................GEAI.mEPN.H...LLIDM......NA..LVHSVI.................................VR-........................------...--DQL.TS....RKV.I......Q.D.V.IA..S.IKR.I.L.L.....LF...P.........P....T....E......T..FALV...........................F......D..............GA................APL.AKLR.LQ........K.ERR...GDMGIPKDML-...........................-QP...........S...NSTV.GS..RY..N..H...N...Y...H...-..--.......................................................................................................................EREVKLRR.E........EVL......T.............G...........SEFLLAC..EDAVRC.ALTI......ESE....N.G..............QS.............................................F.vK.......Np.dCT.II..ISGC......T...........E.........AGEGELKIS.SIL.R....E....IW....................................................................MKqq.qtN.TY..T.G.EDV.....................IIVFG.............N............D...SD.L................A..L.IGIA........C.-.-..---------tpyqsyyiv.................................................................................................................................................
A0A672FH60_SALFA/62-215                ..........................................................yvfi---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............-T................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-AE...........E...KHRM.RE..EI..I..Q...R...G...G...Y..LPa.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AHCLRY.YVAE......RLS....N.D..............PG.............................................W..K.......N...VT.VL..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A4W3K1X8_CALMI/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVVHCLEervkevng.....................................................................................vkipvdtsKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----EN...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IL...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVELL...........................A--...........E...KTRM.RE..EV..I..S...K...G...Gf.lS..EE.......................................................................................................................VIKERFDS.N........CIT......P.............G...........TEFMDNL..ARSLRY.YVAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A2E007_TRIVA/1-107                     ..............................................................MGI..Y..T...FR.G..Q..L.T.NRY.....PLILKSLSE.....................................................................................................---.....................-IPY.pKYN.C...LFIDA......SL..LIVKGI.................................RS-........................------...---GV.QT....ELR.T......A.N.V.RQ..L.FNN.I.V.H.....LV...Q.........P....S....D......L..IFIA...........................F......D..............GP................FSN.AKQY.TV........L.RRR...YADK-------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------smpieawnq.................................................................................................................................................
A0A287SKF5_HORVV/86-281                .....................................................gfgplslpt---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...QPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A0G4PWQ4_PENCA/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PSISMLIA-.....................................................................................................ESR.....................-IP-..EFD.S...LYLDM......NG..IIHNCT.................................HS-........................--DSDS...PTFRM.TE....DQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FYMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAENA-...........................-KE...........K...AIQ-.--..--..-..-...-...Q...G...L..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMQKL..TKQLKY.FINK......KIS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....C....SK....................................................................AQ.....P.DY..E.S.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A0P1AH50_PLAHL/1-255                 ..............................................................MGV..P..A...FY.R..W..V.Q.EKY.....PKCVVDCIEsrav.............................................................................................elegE-Rhfelt..........dttgpnPNGF..EVD.N...LYVDM......NG..LIHPCA.................................HP-........................----ED...GEAPK.TE....EEM.Y......R.R.V.MA..Y.VDR.L.V.A.....AV...R.........P....R....R......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAAQEAEQRM...........................--E...........V...EKEA.LE..YM..A..A...L...G..hK...I..PA.......................................................................................................................TQEKAWDS.N........VIT......P.............G...........TKFMAKL..AKHLRF.YIRD......RVN....N.N..............TA.............................................W..K.......S...IK.II..LSDA......G...........V.........PGEGEHKLM.EYV.R....V....QR....................................................................SQ.....P.GY..D.P.NQH.....................HVLHG.............L............D...AD.L................I..M.LGLA........T.H.E..VKFSILREE..........................................................................................................................................................
A0A1Y1W9S8_9FUNG/1-237                 ..............................................................MGI..P..K...FF.R..W..L.G.GRY.....PLICERVKD.....................................................................................................--D.....................-NIP..EFD.N...LYLDM......NG..IIHNCT.................................HP-........................--KDGN...APAPK.TD....EER.F......L.A.I.FN..Y.IDF.L.F.S.....KI...R.........P....Q....K......V..FFLA...........................I......D..............GV................APR.AKMN.EQ........R.ARR...FRTARDLQQDY...........................EKK...........Q...KEQH.KA..GE..K..P...A...V...D...Q..AE.......................................................................................................................YDVDAFDP.T........CIT......P.............G...........TEFMSKL..TEALRY.YVNK......RIS....E.D..............VD.............................................W..R.......K...PK.VI..LSAP......N...........V.........PGEGEHKIM.DFI.R....F....SR....................................................................AQ.....P.GY..R.A.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.E..PHVSLLREE..........................................................................................................................................................
A2EMZ4_TRIVA/1-256                     ..............................................................MGV..P..A...FF.R..T..L.S.RKY.....PLIISNCIEphetngh......................................................................................ylpnaslpNPN.....................TIGD.rEFD.C...LYLDM......NG..LIHPCF.................................HP-........................----EG...LPPPK.SE....AEV.L......Q.N.I.EN..Y.IER.L.F.M.....IV...R.........P....R....Q......I..LFMA...........................I......D..............GP................APR.AKMN.QQ........R.KRR...FFAAKQAAHDRw.........................iK-Y..........wK...AQKS.GE..TE..L..A...A...E...L...Y..NP.......................................................................................................................DYLKNHDS.N........VIT......P.............G...........TLFFERL..SKHLHG.FIQR......KQE....T.D..............PA.............................................W..G.......K...IC.VI..LSDA......S...........V.........PGEGEHKIM.DFV.R....A....QR....................................................................LE.....P.QY..D.S.NRH.....................HVIYG.............L............D...AD.I................I..F.LGLA........S.H.E..PYWTILRE-r.........................................................................................................................................................
A0A4S4DAF4_CAMSI/1-87                  ..............................................................MGV..P..A...FY.K..W..L.A.DRY.....PQSISDVVEeeprelvn....................................................................................gvffpvdisKPN.....................PNGM..EFD.N...MYLDM......NG..IIHPCF.................................HPE.......................gK-----...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------vpdhfgtynrngkgytvc........................................................................................................................................
A0A287S1R8_HORVV/1-255                 ..............................................................MGI..P..S...FF.S..W..L.V.GKY.....PNILSPVIDafppslseende.............................................................................eeeeeaegeeeeE-E.....................EEED.iIYD.N...LYLDM......NE..IIHKCF.................................GR-........................------...-----.KN....GQV.Y......L.R.F.FD..H.MDR.L.F.R.....LV...K.........P....R....R......L..LYLA...........................V......D..............GV................APM.AKTN.KL........R.QGY...FKSTKQGTDAE...........................--A...........E...AVLL.TE..IF..R..V...Q...G...K...E..VLp.....................................................................................................................rDTYEFEDR.T........VKM......P.............G...........TEFMETI..SMVLEW.FIRE......RLN....T.D..............PE.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SR.....E.NY..D.P.NTR.....................HCLYG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-v.........................................................................................................................................................
A0A4Y9ZVU1_9AGAM/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVTPVIE.....................................................................................................EEEtkveteggeeilvpvdmsrpnPNQL..EFD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPE.TE....EEM.M......V.E.V.FK..Y.TER.V.V.N.....MA...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKD...........................EAR..........rE...SVAI.WE..AM..G..K...T...L...S...D..EE.......................................................................................................................KNKKSWDS.N........AIT......P.............G...........TPFMDLL..ASSLRY.WVVQ......KAN....T.D..............PG.............................................W..K.......Q...IE.VI..ISDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................SN.....P.GH..D.P.NTQ.....................HVIYG.............L............D...AD.L................I..M.LALA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A6I8Q8U4_XENTR/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.TE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................KKA...........-...----.--..--..-..V...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VA.IY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....QK....................................................................TK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..VHFSLLREE..........................................................................................................................................................
A0A453LGJ2_AEGTS/1-31                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........-GEGEHKIM.SFI.R....A....QR....................................................................SM.....E.NY..D.P.NTR.....................HCLHG.............-............-...--.-................-..-.----........-.-.-..---------h.........................................................................................................................................................
Q4QE76_LEIMA/1-339                     ..............................................................MGV..P..K...FA.A..W..L.A.RKY.....PSMVMDSC-.....................................................................................................---.....................--PG..DVH.G...LYIDL......NG..LIHPCC.................................HD-........................--EHDP...SVALR.TQ....EEK.L......R.S.I.CL..A.IET.L.V.V.....TV...R.........P....Q....R......V..IYIA...........................I......D..............GV................VPR.AKMN.QQ........R.ARR...YMSSAAPLTDTdkpi...................hggsH-K...........M...SATI.VA..AI..E..K...E...F...T...Q..AEcdgvereladvsqalmgdvlyggcatmalaedateka............................................eahtlaaapwtipptlasegkkdaccaaaqvgrqpaaaASPAKFDS.N........CIS......P.............G...........TAFMDAV..ATAVRD.YIRR......KLA....P.K..............ENdaggkaeaeag......................aspaaitatcahW..A.......G...LT.VI..FSDS......N...........T.........AGEGEHKIS.DFL.R....T....QS....................................................................AF.....P.GF..N.G.SGC.....................HVIAG.............L............D...AD.L................I..F.LSLS........L.H.I..PRVVILRD-h.........................................................................................................................................................
A0A232FF30_9HYME/81-306                ..............................................................MGV..P..K...FF.R..F..I.S.ERY.....P-CINKIIK.....................................................................................................EHE.....................--IP..QYD.N...LYLDM......NS..IIHTCS.................................HPTd......................sDVHFRI...GKKEF.SD....EDI.F......E.N.V.SR..Y.VEI.I.F.R.....IV...K.........P....L....E......M..LFLA...........................F......D..............GV................APR.AKMN.QQ........R.ANR...FRVARDNSIL-...........................-ER...........-...----.--..--..-..-...-...-...-...E..IL.......................................................................................................................LTDKLFDA.N........SIT......P.............G...........TVFMADL..IDHMKH.FIAY......KVS....T.D..............PL.............................................W..Q.......K...CK.II..LSGS......E...........A.........PGEGEHKIM.QFI.R....Y....HK....................................................................AQ.....K.NY..N.S.NTR.....................HCLYS.............L............D...AD.L................I..V.LGLC........T.H.E..PHFSLLRE-k.........................................................................................................................................................
A0A212CI89_CEREH/1-202                 ............................................................ip---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PAEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A177WJS7_BATDL/1-219                 ..............................................................MGG..T..Q...LW.R..F..L.Q.TVV.....PTALHQNTA.....................................................................................................QLK.....................--KQ..PTD.H...LLMDL......TM..FIHRSM.................................KA-........................------...--DMV.VE....RSL.N......S.S.V.IA..S.IKS.L.V.Q.....SY...K.........P....R....Q......S..LFIA...........................I......D..............GA................API.AKLP.VQ........I.LRR...AQYFDKNKHL-...........................-KA...........P...Y---.--..--..-..-...-...-...-...-..--.......................................................................................................................GIMNKVHR.L........DLS......P.............G...........SAYYGRL..ELLLKE.TFDS......NAE....-.S..............QS.............................................W..N.......QgpyKE.FK..ISGS......I...........N.........SGEGEAKVM.KRI.L....E....LR....................................................................AT.....N.AF..D.S.SQIp..................etFTMLS.............G............D...SD.A................L..M.HLM-........-.-.-..---------vatpdidciiqr..............................................................................................................................................
A0A095C8E0_CRYGR/23-162                .............................................................y-GV..P..A...LF.R..W..L.S.KKY.....PKIVERVKEdtpkkirgpd................................................................................geiveepiryeNPN.....................PNGF..EVD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...RPAPE.TE....EEM.M......V.E.I.FK..Y.TER.V.V.N.....MC...R.........P....R....K......V..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAADKE...........................EER...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------kea.......................................................................................................................................................
A0A453M1S3_AEGTS/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAEEeepvele......................................................................................pgafvpvdP-Rr..................pnPNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
S7PGB4_MYOBR/1-192                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
S9UNL0_9TRYP/1-207                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..-MD.N...LYVDM......NG..LIHPCC.................................HD-........................---TAP...LPEPE.NE....EEM.I......E.R.I.LT..Q.LDI.L.V.K.....VA...R.........P....R....K......C..LILC...........................I......D..............GV................APR.SKLN.QQ........R.SRR...FRAADERMEGD...........................-AL...........A...KTVS.RT..IV..K..E...H...K...L...P..RP.......................................................................................................................QSRKKWDH.N........VIT......P.............S...........TPFMERV..AIALEW.FIVK......QVN....D.D..............PL.............................................W..K.......K...LV.VV..FSDA......H...........V.........PGEGEHKIM.QYI.R....S....LR....................................................................SQ.....P.GY..D.H.TTS.....................HAICG.............M............D...AD.L................V..C.LGLS........T.H.E..EHVSILRN-q.........................................................................................................................................................
M2W0S3_GALSU/1-225                     ..............................................................MGI..P..K...FY.R..W..L.S.ERF.....PVINQELE-.....................................................................................................---.....................-TEY..EFD.N...FYLDM......NG..IIHLCT.................................HN-........................--NNSL...QLVWN.NV....EEM.F......D.S.I.FE..Y.TDR.L.Y.R.....IV...K.........P....K....K......L..LFLA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDAEKA-...........................-LA...........E...AIER.--..--..-..-...-...-...G...E..EI.......................................................................................................................KSSSRFDS.N........CIT......P.............G...........TEFMHVL..SQRFKD.WISF......MTT....H.D..............PA.............................................W..Q.......Q..gCD.II..FSGP......D...........V.........PGEGEHKIM.DFI.R....T....HT....................................................................ED.....K.EW..T.E.-RK.....................HCLYG.............L............D...AD.L................I..M.LGLV........T.H.F..PHFSLLRE-k.........................................................................................................................................................
A0A5D2V1S8_GOSMU/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLIVMDVIEeepvvieg.....................................................................................vsipvdtsKPN.....................PNKL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....DEV.F......Q.C.I.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEA-...........................-AA...........E...EARL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kEESQLVDS.N........VIT......P.............G...........TPFMAVL..SIALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A151ZT28_9MYCE/1-210                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..VIHSAV.................................KLDd.....................sgNIRGNL...IKIRDlPN....EMI.K......S.S.L.YY..R.LDQ.I.I.H.....SI...K.........P....N....H......I..LYIG...........................I......D..............GV................PPR.SKSI.EQ........R.KRR...FKASKEALDVI...........................NKMr........syQ...KSNG.NG..TQ..L..V...S...G...N...Q..QP.......................................................................................................................QQESYFDS.N........SIS......P.............A...........TEFILLV..NEWVRE.YCVK......LSK....-.-..............-I.............................................Y..E.......N...LN.IV..YSDS......S...........V.........PGEGEHKIM.DFI.R....S....YQ....................................................................KS.....S.HY..Q.SeKES.....................HIFYG.............M............D...AD.L................I..F.LGLS........T.H.E..KNFYVLRD-a.........................................................................................................................................................
A0A4V5P7C6_MONMO/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
E4X911_OIKDI/1-227                     ..............................................................MGV..P..K...FY.R..Y..M.S.ERY.....P-CLSQVIK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHPCS.................................HP-........................--NDDD...PHFRI.TE....EQI.F......K.D.I.FH..Y.IEC.L.F.R.....II...R.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKEAEEN-...........................-ER...........K...AK--.--..--..-..-...E...K...G...E..SL.......................................................................................................................PTEGKFDS.N........VIT......P.............G...........TGFMVRL..DKQLRY.FIQN......KIT....H.D..............DA.............................................W..R.......G...IT.VF..LSGH......E...........T.........PGEGEHKIM.EYI.R....Y....QR....................................................................TL.....S.DH..D.P.RTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..PNFSLLREE..........................................................................................................................................................
A0A392NPT1_9FABA/1-107                 ..............................................................MGI..P..A...FY.K..W..L.A.EKY.....V-VVNSVEEepvvmdg......................................................................................vqvpvdttNKN.....................PNNI..EYD.N...LYLDM......NG..VIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......R.S.I.FA..Y.IDR.L.F.V.....IV...R.........P....R....K......L..LFMA...........................I......D..............GV................APT.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------m.........................................................................................................................................................
A0A0L0NH23_TOLOC/1-193                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCT.................................HKD........................--AGED...ATFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDVEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SLQLRY.FVNE......KVS....E.D..............TD.............................................W..Q.......G...CE.VV..LSGH......D...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A061FD64_THECC/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVIMDVIEeepvvidg.....................................................................................vsipvdtsKPN.....................PNKL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEA-...........................-AA...........E...EARL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kEESQLFDS.N........VIT......P.............G...........TPFMAVL..SIALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......T...VK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A2T6ZQ94_TUBBO/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-TISQVIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HG-........................--DSDS...PAFRM.TE....DVM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....R....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDADNA-...........................-KQ...........K...A--I.RE..--..-..-...-...-...G...I..EI.......................................................................................................................PKEAAFDS.N........CIT......P.............G...........TEFMAKL..TTHLKY.FINK......KVS....E.D..............VD.............................................W..Q.......G...VE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....L....AK....................................................................AQ.....P.SY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A0L9V2K3_PHAAN/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVIVDAIEeepvvidg.....................................................................................iqipvdtsKEN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......E.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AT...........E...EARL.RE..EF..E..K...E...G...R...K..LPp.....................................................................................................................kAESQTFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YVHL......RLN....N.D..............PG.............................................W..Q.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....N.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A674C0H2_SALTR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....STIVVHCTEerskecn.......................................................................................gvripvdT-Sk..................pnPNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KAAPK.NE....DEM.M......V.A.I.FE..Y.MDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-VE...........E...KSRI.RE..EI..L..G...K...G...G...Y..LPp.....................................................................................................................vEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YVAD......RLS....N.D..............PG.............................................W..R.......N...IT.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.HH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A423X7G6_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDD...TQFRL.SE....DEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FYMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAETA-...........................-RD...........K...ALR-.--..--..-..-...-...E...G...K..EL.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TDFMAKL..SRQLRY.FINK......KVS....E.D..............KE.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AR....................................................................AQ.....P.NY..S.H.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
E4URR6_ARTGP/1-227                     ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....R......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAELA-...........................-KE...........R...A--I.KE..--..-..-...-...-...G...I..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMAKL..TKQLKY.FVNK......KVS....E.D..............AE.............................................W..Q.......G...VE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.EY..D.P.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A482SD85_9ARCH/1-62                  .............................................................m---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.-I..LSDA......S...........E.........PGEGEHKIM.SFI.R....C....QR....................................................................AQ.....A.GY..H.P.STK.....................HVLHG.............L............D...AD.L................I..M.LALA........T.H.E..PNFFILREK..........................................................................................................................................................
A0A2K6RNC5_RHIRO/102-355               ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.S.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A427Y4C9_9TREE/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVLGMREdvptkvrqed................................................................................gqivevpvqfaSAN.....................PNGF..EID.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...RPAPE.TE....EEM.M......V.E.V.FR..Y.TER.V.V.N.....MA...R.........P....R....K......V..LIMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAAEKE...........................QER..........lE...SIRL.FE..AM..G..H...P...V...S...E..ET.......................................................................................................................KNKKSWDS.N........AIT......P.............G...........TPFMDLL..SASLKY.WVAE......KLN....N.D..............PG.............................................W..K.......D...LK.VI..ISDA......S...........V.........PGEGEHKIV.DWI.R....R....QR....................................................................TF.....P.DW..D.P.NTK.....................HAIYG.............L............D...AD.L................I..M.LALA........T.H.E..PNFYVLRE-d.........................................................................................................................................................
A0A2U9BLS3_SCOMX/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVNN......KIS....T.D..............TL.............................................W..H.......N...VR.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AT.....P.EH..N.P.NTR.....................HCLYG.............L............D...AD.L................M..M.LGLT........S.H.E..PNFSLLREE..........................................................................................................................................................
A0A287LYH0_HORVV/30-283                ..............................................................MGV..P..S...FY.R..W..L.A.EKY.....PMLVVDVVEeepveieg.....................................................................................vkvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----DD...RASPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kQQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A1Q9BX56_SYMMI/37-119                ................................................egvedaeeeedede---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............EE.............................................E..E.......E...VT.IV..LSGP......D...........T.........PGEGEHKIM.DYI.R....A....SK....................................................................AQ.....P.DY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........S.H.E..LHFALLREE..........................................................................................................................................................
A0A0L0H8Z9_SPIPD/1-254                 ..............................................................MGV..P..A...LF.R..W..L.S.QKY.....PKVTSQVIEeqpreing.....................................................................................htipvdasKVN.....................PNGV..EFD.N...LYLDM......NG..IIHPCC.................................HPE........................-----G...KPAPA.TE....EEM.F......V.E.I.FK..Y.IDR.I.M.A.....MI...R.........P....R....K......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEAQIQQ...........................EEE...........E...RIRK.EW..EA..A..G...D...K...M...P..ET.......................................................................................................................EKKQHFDS.N........CIT......P.............G...........TPFMTNL..AVALRY.YIAD......RLN....T.D..............PG.............................................W..R.......N...LK.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................GQ.....T.GY..D.P.NTH.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..PNFQILRE-d.........................................................................................................................................................
A0A446UQQ5_TRITD/1-88                  ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........---MFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
F6XNM6_CANLF/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..THFSLLREE..........................................................................................................................................................
A0A287LYE8_HORVV/1-254                 ..............................................................MGV..P..S...FY.R..W..L.A.EKY.....PMLVVDVVEeepveieg.....................................................................................vkvpvdtsKPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----DD...RASPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AE...........E...EEKL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kQQSQTCDS.N........VIT......P.............G...........TEFMAVL..SVALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....NR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
J3L6A0_ORYBR/1-254                     ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PMVVVDVVEeeaveie.......................................................................................gvkvpvdT-Sk..................pnPNSL..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....AEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kHQSQTCDS.N........IIT......P.............G...........TEFMDVL..SIALQY.YIHC......RLN....Y.D..............PG.............................................W..K.......Q...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....G....QR....................................................................NL.....P.GF..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A3P7KIX8_STRVU/1-255                 ..............................................................MGV..P..A...FF.R..W..L.T.RKY.....PSIIVNANE.....................................................................................................ERQrnadgtri.....pidstkpnPNFQ..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPA.NE....DEM.F......A.L.I.FE..Y.IDR.I.F.S.....IV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAWEKA...........................ASI...........-...-EEQ.RR..RL..E..E...E...G...I...A..LPp....................................................................................................................kkEEENHFDS.N........CIT......P.............G...........TPFMARL..AEALRY.YIHE......RIT....T.D..............PA.............................................W..S.......K...IE.VI..LSDA......N...........A.........PGEGEHKIM.DFI.R....R....QR....................................................................SN.....P.AH..N.P.DTV.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..ANFNIIR--le........................................................................................................................................................
A0A287X5W2_HORVV/25-92                 ..............................................................MGV..P..T...FY.R..W..L.A.DRY.....PQTVSDAEEeepvele......................................................................................pgafvpvdP-Rr..................pnPNGL..EFD.N...LYLDM......ND..IIHPCF.................................HP-........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------kg........................................................................................................................................................
A0A452GVI1_9SAUR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNSAEekpkecng.....................................................................................ikipvdtsKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEG-...........................-AE...........E...KQRI.RQ..EI..L..S...K...G...G...F..LPp.....................................................................................................................eEVKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A364NGS0_9PLEO/1-260                 ..............................................................MGV..P..A...MF.R..W..L.S.QKY.....PKIISSVQEelpkkv........................................................................................gdakipvD-Rtg.................pnPNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----DD...KPAPK.TE....ADM.M......I.A.I.FE..Y.TDR.V.L.G.....MV...R.........P....R....K......L..LYMA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKEAKEKD...........................EER...........-...-AEF.QK..ML..N..S...Q...K...A...S..RGedin...............................................................................................................sleeVVEKTWDS.N........AIT......P.............G...........TPFMHLL..AESLQY.WCAY......KFT....T.D..............PS.............................................W..K.......D...MK.VI..ISDA......S...........V.........PGEGEHKIM.NFI.R....S....QR....................................................................SM.....P.TH..D.P.NTS.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PYFRVLRE-d.........................................................................................................................................................
A0A453LG62_AEGTS/1-199                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..--D.N...LYLDM......NE..IIHKCF.................................RL-........................------...-----.NN....GLV.Y......N.W.F.FA..Y.LDR.L.F.R.....IV...R.........P....R....R......L..LYLA...........................V......D..............GV................APM.SKMT.KL........R.QTY...FKTAKYRADS-...........................-EA...........E...AILL.TE..IF..R..A...Q...G...K...E..VMp.....................................................................................................................rDTYELENP.V........VKM......P.............G...........TEFMEKI..SAALEY.FIRE......RLN....T.D..............PE.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SM.....E.NY..D.P.NTR.....................HCLHG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-f.........................................................................................................................................................
A0A0D9YSC3_9ORYZ/1-128                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NQ..IIHYSF.................................HPQd......................qMNAGTD...VCAPT.TV....SEV.F......E.S.M.FD..Y.LDR.L.F.R.....IV...R.........P....R....R......L..LYLA...........................V......D..............GV................APC.AKMNgMR........R.GRR...FAWASEEEEM-...........................-QK...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................ISEGVSDP.N........VIT......P.............G...........TEFMEKI..SQALTY.YIRA......RLN...sS.D..............PG.............................................W..K.......H...I-.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------m.........................................................................................................................................................
A0A4Y7JXN1_PAPSO/1-254                 ..............................................................MGV..P..A...FY.R..W..L.T.EKY.....PMIIQDVIEeepveiqg.....................................................................................isipvdtsKPN.....................PNKL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPAPT.TF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..IYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAARDAQEAA...........................--E...........E...EERL.RV..EF..A..E...E...G...R...K..LPp.....................................................................................................................kETSQVCDS.N........VIT......P.............G...........TEFMHVL..SVALQF.YIHL......RLN....N.D..............PG.............................................W..R.......S...VK.VI..LSDA......N...........V.........PGEGEHKIM.SYV.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFCILRE-i.........................................................................................................................................................
A0A0V0QDK4_PSEPJ/113-219               ......................................................dysgnyis---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-------L.N........HLL......P.............G...........SQNIKSV..REQLDV.VVNQ......FFF....G.E..............EN.............................................Y..Qf....rdE...LK.VV..FSDF......S...........V.........PGDASYKIG.QFI.Q....K....QR....................................................................AQ.....D.GF..E.E.EMY.....................HCIVD.............T............S...FE.G................F..V.NCLA........T.H.Q..KNM------fnls......................................................................................................................................................
Q54GU2_DICDI/1-260                     ..............................................................MGI..P..S...FY.R..W..L.I.ENF.....PKVLENNL-.....................................................................................................---.....................-NGE.iKFN.N...LYIDM......NG..VVHNAIkldhsptssssss......sttttppttptttyS-K.......................dKEVVLM...LKSEL.SD....EKL.K......E.R.I.FY..R.LDQ.M.V.N.....NV...N.........P....S....S......L..LYIG...........................V......D..............GV................PPR.AKAI.EQ........R.KRR...FKSSKETVDVI...........................IKQ...........-...-LKS.KS..KP..I..T...R...D...S...I..IE.......................................................................................................................QFSLIFDS.N........SIS......P.............A...........TEFIEKV..DDWIKD.YCKQ......LSL....-.-..............-K.............................................R..Q.......N...LS.II..LSDS......T...........V.........PGEGEHKIM.DYI.R....Q....NH....................................................................PI.....L.-K..K.D.GMS.....................HCFYG.............M............D...AD.L................I..F.LGLE........S.H.L..SNFYILRD-p.........................................................................................................................................................
A0A6A5BYS7_NAEFO/1-385                 ........................................mgvpsfmsqlnsiinslyqqeh---..-..-...--.-..-..-.-.---.....--------Iglryqkiisnvmnerknkntt..........................................................trntsntttttnttsnnsqqnnS-Sckfqp..........pfisnrIHSK..VFD.C...IYIDI......NP..IIHGVVrgvqnsldat.............aeksqtqdskK-Kds....................kkKKSNDM...SSNAQ.WD....DKI.V......R.G.V.IK..S.LEE.V.M.T.....SF...K.........A....N....S......H..WFIS...........................F......D..............GV................ATK.SKRI.KQ........R.SHR...AKESKKRNGEE...........................KKT...........S..gDKSH.AN..ET..M..N...D...N...S...N..TQgeddgssldpimddeemiddddddsms.................................................................vttssaledsftnsttnlnslsntifeTPKKRSLS.V........EIS......P.............G...........TNLSKKI..YQGVLN.LSYH......YS-....-.-..............-K.............................................T..H.......N...VT.VY..VSSS......S...........R.........SGEGETKII.EHL.R....T....YM....................................................................MK.....K.NK..S.G.HTRkktsreg......tslplassVLIIS.............H............D...SD.M................V..L.IPLS........N.P.E..LN-------csfyvlv...................................................................................................................................................
A0A3Q7TAI1_VULVU/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
J3K8A5_COCIM/1-227                     ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEIA-...........................-KE...........K...--AI.RE..G-..-..-...-...-...-...I..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMAKL..TKQLKY.FINK......KVS....E.D..............AE.............................................W..Q.......G...VE.VI..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.DY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
R1BVA3_EMIHU/1-146                     ..............................................................MGV..P..G...LF.S..W..V.R.RQF.....PEAIIPEEV.....................................................................................................WSK.....................SSPA..PVS.S...LFVDL......NH..ILHACT.................................HPE........................YP----...YEEPS.SR....EAM.L......E.A.I.LL..Y.IEA.L.L.A.....LV...Q.........P....T....D......L..LFIA...........................V......D..............GP................PPR.AKMN.QQ........R.SRR...FLAAMEAADRK...........................RMQ...........E...Q---.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------artalasllvppaepkartatavrael...............................................................................................................................
A0A2U3X4H9_ODORO/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkvpvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A287S1A5_HORVV/1-256                 ..............................................................MGI..P..S...FF.S..W..L.V.GKY.....PNILSPVIDafppslseende.............................................................................eeeeeaegeeeeE-E.....................EEED.iIYD.N...LYLDM......NE..IIHKCF.................................GR-........................------...-----.KN....GQV.Y......L.R.F.FD..H.MDR.L.F.R.....LV...K.........P....R....R......L..LYLA...........................V......D..............GV................APM.AKTN.KL........R.QGY...FKSTKQGTDAV...........................EAE...........-...AVLL.TE..IF..R..V...Q...G...K...E..VLp.....................................................................................................................rDTYEFEDR.T........VKM......P.............G...........TEFMETI..SMVLEW.FIRE......RLN....T.D..............PE.............................................W..K.......D...IK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....A....QR....................................................................SR.....E.NY..D.P.NTR.....................HCLYG.............H............D...AD.L................I..M.LALA........S.H.E..VHISILRE-v.........................................................................................................................................................
XRN2_CANAL/1-250                       ..............................................................MGV..P..A...LF.R..W..L.S.RKY.....PKIISPVVE.....................................................................................................EEDheigg...........akyenPNPN.gEID.N...LYLDM......NG..IVHPCS.................................HP-........................----EH...KKPPE.TE....DEM.F......L.D.I.FK..Y.TDR.V.L.M.....MA...R.........P....R....K......V..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRAAKDAELKA...........................KQL...........E...IEVQ.ER..EL..R..G...E...I..iN...D..AI.......................................................................................................................KGKKQWDS.N........AIT......P.............G...........TPFMDRL..AEALRY.WVAY......KLS....S.D..............PG.............................................W..A.......N...LQ.VI..ISDA......T...........V.........PGEGEHKLM.SFI.R....S....QR....................................................................SD.....P.QY..D.P.NTK.....................HCIYG.............L............D...AD.L................I..F.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
W5P8Q9_SHEEP/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PAEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A158PPI1_ANISI/1-277                 ..............................................................MGV..P..A...FF.R..W..L.T.RKY.....PSVIVNAVEekprdvdg.....................................................................................nevpirttEPN.....................PNFQ..EFD.N...LYLDM......NG..IIHPCT.................................HPEnrpapkne.......deilvlmriQWISIA...FSKKG.RN....FKF.Q......A.L.I.FE..Y.IDR.I.F.A.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEAAEK-...........................-AA...........Q...IAEV.RE..RL..E..R...E...G...Y...P..LPp....................................................................................................................kkEDEEHFDS.N........CIT......P.............G...........TPFMARL..ADALRY.YVHV......RLN....N.D..............PG.............................................W..E.......N...IE.VI..LSDA......N...........A.........PGEGEHKIM.DFI.R....R....QR....................................................................AS.....P.SH..D.P.NTV.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFNIIREE..........................................................................................................................................................
A0A163J6C1_ABSGL/1-242                 ..............................................................MGI..P..K...FF.R..W..M.R.LTD....sPMVCTLLFA.....................................................................................................SSErypmc...........sqlitENRI.pEFD.N...LYLDM......NG..IIHNCS.................................HN-........................--NNES...AHFRI.TE....EQI.W......I.G.I.FN..Y.VDH.L.F.A.....KI...K.........P....K....K......T..FFLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAKDAEDT-...........................-RK...........R...AL--.--..--..-..-...S...K...G...E..EL.......................................................................................................................PEEDPFDS.N........CIT......P.............G...........TAFMKKL..TLQLRY.FISK......KVS....E.D..............AL.............................................W..R.......D...VE.II..LSGP......E...........V.........PGEGEHKIM.EFI.R....L....SK....................................................................AQ.....E.GY..N.P.NTR.....................HCLYG.............L............D...AD.L................V..M.LGLL........S.H.D..PHFALLREE..........................................................................................................................................................
C6HCG6_AJECH/1-259                     ..............................................................MGV..P..A...LF.R..W..L.S.SKY.....PKIISPVVEeipqeidg.....................................................................................eevpvdttKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCT.................................HP-........................----DG...KPPPE.TE....EDM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEAD...........................--E...........K...KEEF.AK..LL..R..K...Q...N...G...S..KGgeg................................................................................................................lveeVITKTWDS.N........VIT......P.............G...........TPFMDIL..AAALRY.WVAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................SC.....A.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A545A983_9PEZI/1-254                 ..............................................................MGV..P..A...LF.R..W..L.S.QKY.....PKIVSPVIEeq................................................................................................preV-Dgqiipv.........darganPNDE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...GPAPK.NE....EEM.M......M.A.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKA...........................ED-...........-...KAEF.LK..ML..K..S...Qg.sG...P...E..DT.......................................................................................................................DVKKVWDS.N........EIT......P.............G...........TPFMDIL..AASLRY.WISY......KLN....T.D..............LA.............................................W..S.......K...IK.VI..ISDS......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................SS.....P.EH..N.P.NTK.....................HVMYG.............L............D...AD.L................I..M.LGLG........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A1S9DS30_ASPOZ/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PA-ISMLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEVA-...........................-KE...........K...AIS-.--..--..-..-...-...Q...G...I..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMAKL..TEQLKY.FINK......KIS....E.D..............KD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....H....AK....................................................................AQ.....P.GY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A0M0JMK0_9EUKA/7-233                 ...............................................wtddgvrvpvdtsra---..-..-...--.-..-..-.-.---.....---------.....................................................................................................--N.....................PNGM..EFD.N...LYLDM......NG..IIHPAS.................................HP-........................----ED...GPPPE.TE....DDM.Y......L.A.I.FD..Y.LER.V.F.A.....AV...R.........P....R....R......L..LFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAQEK-...........................-EE...........E...ETRL.RE..EW..A..K...E...G...R...E..VP......................................................................................................................pRKENLFDS.N........VIT......P.............G...........TPFMDRL..ALFLRT.FVHC......KLS....T.D..............PG.............................................W..A.......G...IE.VI..LSDG......S...........V.........PGEGEHKIM.EYI.R....S....QR....................................................................RQ.....P.GY..D.P.DTR.....................HALHG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFCILRE-y.........................................................................................................................................................
A0A3S3S6H8_9ACAR/1-242                 ..............................................................MGV..P..A...FF.R..W..L.S.KKY.....PSIVVHCDE.....................................................................................................R--.....................-QGE.cSFD.N...VYLDM......NG..IIHPCT.................................HP-........................----EY...KAPPE.TE....EEM.F......E.A.I.FE..Y.IER.L.M.R.....IV...R.........P....Q....K......L..LYLA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRASKESLEK-...........................-KI...........E...IEKI.KE..EL..K..E...K...G...Iv.lG..ET.......................................................................................................................EKKKHFDS.N........VIT......P.............G...........TDFMISL..SKELRK.WIDL......KLS....E.Nnp.........dedEI.............................................W.pK.......D...LK.VI..LSDA......S...........V.........PGEGEHKIM.EYI.R....K....QK....................................................................AN.....D.NY..N.P.NIS.....................HLLVG.............A............D...AD.L................I..M.LALA........T.H.E..LNFTILREE..........................................................................................................................................................
A0A024GJM0_9STRA/1-256                 ..............................................................MGV..P..A...FY.R..W..L.S.AKY.....PKCVVDCVEqspv.............................................................................................miegK-Rhyell..........ditgpsPNEI..EVA.N...LYIDM......NG..LIHPCA.................................HP-........................----EN...GEQPK.TE....EEM.Y......Q.R.V.MD..Y.VDR.L.V.A.....AV...R.........P....R....R......V..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSAKEAEERS...........................EIE...........K...QAID.YM..KA..M..G...H...Q...V...Q..DE.......................................................................................................................DQPKGWDS.N........VIT......P.............G...........TKFMSKL..SKYLRF.YIRE......RIN....Q.N..............EA.............................................W..K.......S...IK.VV..FSDA......S...........V.........PGEGEHKLM.SFV.R....L....QR....................................................................SQ.....P.GY..D.P.NQH.....................HVLHG.............L............D...AD.L................I..M.LGLA........T.H.E..VNFTILREE..........................................................................................................................................................
A0A078HZY8_BRANA/1-249                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PKSISDVVE.....................................................................................................EESglgal..........ditrpnPNGF..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.M.FE..Y.IDH.L.F.T.....LV...R.........P....R....K......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................AEE...........E...MLRQ.DF..EA..G..G...Q...I...L...S..AK.......................................................................................................................EKAETSDS.N........VIT......P.............G...........TPFMAVL..SVALQY.YIQS......RLN....R.N..............PG.............................................W..R.......F...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................GL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A6Q2ZB14_ESOLU/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TDFMARL..QEQLKY.FVNS......KLS....T.D..............KA.............................................W..Q.......G...VS.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EN....................................................................AK.....P.GH..N.P.NVR.....................HCLYG.............L............D...AD.L................M..M.LGLT........S.H.E..PHFSLLREE..........................................................................................................................................................
K0KWY3_WICCF/1-99                      ..............................................................MAI..P..Y...FY.S..M..L.K.END.....SECFKNGG-.....................................................................................................---.....................---K..QCD.N...LYIDM......NC..IFHICL.................................RD-........................------...---AK.SE....KDF.K......D.L.I.LA..H.LQM.V.T.A.....AY...C.........P....H....K......L..LYIA...........................I......D..............GV................PPL.GKLK.GQ........A.LRR...QSY--------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------iksgng....................................................................................................................................................
A0A395NEJ4_TRIAR/1-193                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCT.................................HKD........................--AGED...ATFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...--AI.RE..--..-..-...-...-...G...I..EL.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SQQLRY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2P5I0Q0_9PEZI/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PSISQLIA-.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................---SGD...TQFRL.SE....DEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEQA-...........................-RD...........K...AV--.--..--..-..-...R...E...G...K..EL.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SLQLRY.FINK......KVS....E.D..............KE.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AR....................................................................AQ.....P.DY..H.P.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A1D003_NEOFI/1-227                     ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PTISMLIA-.....................................................................................................ENR.....................---I.pEFD.A...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....R....K......L..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEVA-...........................-KE...........K...AIA-.--..--..-..-...-...Q...G...I..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMAKL..TQQLKY.FINK......KIS....E.D..............KD.............................................W..Q.......G...VD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....H....AK....................................................................AQ.....P.GY..D.P.NIR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2I1GSG2_9GLOM/1-81                  ............................................................np---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................-NNI..EFN.N...LYLDM......ND..IIHLYC.................................YL-........................----KN...KSTSF.TE....KDM.I......V.E.I.IE..Y.TER.I.V.A.....II...C.........L....K....K......V..LYLA...........................I......D..............SI................ALH.TKTN.QQ........K.FRR...FKA--------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------v.........................................................................................................................................................
F8PQY4_SERL3/2-75                      ........................................................gktisd---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..DE.......................................................................................................................KNKVAWDS.N........AIT......P.............G...........TPFMDLL..ALSLRY.WVVQ......KMN....T.D..............PG.............................................W..K.......D...LQ.VI..ISDA......S...........V.........PGEGEHKIM.DFI.R....R....Q-....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------..........................................................................................................................................................
A0A078A6J2_STYLE/1-93                  ..............................................................MGV..P..A...FF.R..W..L.S.VRY.....PKVVMDALTedeleymysdfkkqgg....................................................................dpneidllegdldgeiqK-K....................iKDNN.lEHD.N...LYLDM......NG..IIHPCA.................................HPQ........................DK----...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------pqptcen...................................................................................................................................................
A0A5J4YW09_PORPP/1-225                 ..............................................................MGI..P..K...FY.R..W..L.S.ERY.....PLINQRLD-.....................................................................................................---.....................-SSH..EFD.N...FYLDM......NG..IIHQCT.................................HP-........................---NDD...EIVVM.NQ....EQM.F......Q.A.M.FD..Y.TDR.L.Y.K.....IV...R.........P....R....K......L..MYLA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSSKDAERAV...........................AEQ...........-...---L.A-..--..-..-...-...R...G...A..EL.......................................................................................................................PEGQQFDS.N........CIT......P.............G...........TEFMADL..SWQFRK.WIRH......KYL....T.D..............PA.............................................W..Q.......Q..gCD.VI..WSGP......N...........V.........PGEGEHKIM.DHI.R....T....WR....................................................................ES.....K.NW..N.P.SVR.....................HCMYG.............L............D...AD.L................I..M.LGLV........T.H.E..PHFTLLRE-k.........................................................................................................................................................
A0A078HNA4_BRANA/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLIVSDVVEeeaveie.......................................................................................gikipvdT-Sk..................pnPNDL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....EEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAKDASDA-...........................-AA...........E...EEKL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kIDSQVFDS.N........VIT......P.............G...........TEFMGVL..SIALQY.YVHL......RLN....H.D..............VG.............................................W..K.......N...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NI.....P.GF..D.L.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A096MU12_PAPAN/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A177EBL2_9MICR/1-212                 ..............................................................MGV..P..S...LF.R..W..V.A.RKY.....ARSLSKVA-.....................................................................................................--D.....................---Q..EVD.N...LYLDL......NG..IIHPCC.................................HP-........................----TN...KPAPA.NE....AEM.F......I.E.I.FR..T.IDH.L.V.D.....LV...R.........P....K....Q......L..LYIA...........................V......D..............GV................APR.AKMN.QQ........R.ERR...FKTGDDAAAK-...........................-NE...........-...----.--..--..-..-...-...-...-...Q..QS.......................................................................................................................VLAEKFDS.N........TIT......P.............G...........TPFMFRL..HQSLIS.YVES......RMA...sS.R..............PA.............................................W..K.......S...LA.VI..YSGC......D...........V.........PGEGEHKVY.DFV.R....N....IK....................................................................--.....-.--..G.Q.DVR.....................HAICG.............L............D...AD.L................I..F.LSLS........T.H.E..GSFKVLRE-d.........................................................................................................................................................
A0A0N1H4X4_9EURO/1-260                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIITSVVEeqpfdidg.....................................................................................vkypvdttKPN.....................PNGE..EMH.N...LYLDF......NG..IVHPCS.................................HP-........................----ED...KAPPA.NE....SEM.M......L.E.I.FK..Y.TER.V.V.N.....MV...R.........P....R....R......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAAQEAQEKN...........................EQQaef.....qalL...RRQQ.GS..NA..D..N...V...T...S...E..EQ.......................................................................................................................VVKKVWDS.N........AIT......P.............G...........TPFMFIL..AKSIRY.WCQW......KLN....T.D..............PA.............................................W..A.......D...MK.VI..ISDA......S...........V.........PGEGEHKIM.QFI.R....S....QR....................................................................SD.....P.EY..D.P.NTR.....................HVMYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRILRE-d.........................................................................................................................................................
A0A0E0KK46_ORYPU/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVADAVEeepvelep....................................................................................gafvpvdlrRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPAPT.TY....DEV.F......K.S.I.FA..Y.IDH.L.F.G.....LV...R.........P....R....K......L..IYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........-...-ERL.RK..EF..E..A...Eg.rT...L...V..AK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.T..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A2U9CX34_SCOMX/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....ASIIVHCVEekgkqcng.....................................................................................vripvdttKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-TE...........E...KQRM.RE..EV..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AQCLRY.YVAE......RLS....N.D..............PG.............................................W..K.......N...VT.VL..LSDA......S...........V.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A452QP32_URSAM/1-212                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........-------..-----K.FTER......KIP....S.D..............QF.............................................F..F.......Q...DF.IY..LTQR......-...........E.........--KGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A446RXT0_TRITD/1-247                 ..............................................................MGV..P..S...FY.R..W..L.V.EKY.....PNIVAPAVE.....................................................................................................EEDcp................aggGAAV..YFD.N...LYLDM......NG..IIHPCF.................................HPE........................--DQTA...CPPPA.TF....DEV.F......Q.S.M.FD..Y.MDL.L.L.R.....IV...R.........P....R....R......L..LYLA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FKSAKAAKEEL...........................EEN...........L..mRERF.RA..QG..K..E...V...L...P...R..DD.......................................................................................................................TPREVSDP.N........IIT......P.............G...........TEFMEKL..SAALEY.YVRA......RLS....S.D..............PR.............................................W..K.......D...VK.VI..LSDA......N...........V.........PGEGEHKIM.SFI.R....G....QR....................................................................SM.....E.NY..D.P.STR.....................HCLYG.............L............D...AD.L................I..M.LALA........S.H.E..VHFSILRE-d.........................................................................................................................................................
N4TNZ9_FUSC1/1-228                     ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...VSFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTALDAEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..EI.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SQQLRY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.Q.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A100IIK0_ASPNG/1-259                 ..............................................................MGV..P..A...LF.R..W..L.S.NKY.....PKIISPVIEefpqeing.....................................................................................eevpvdttRPN.....................PNGD..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPS.NE....QEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRSAQEAREAD...........................EKKee.......frK..mLERQ.NG..KK..E..D...E...D...M...Q..EQ.......................................................................................................................VIQKTWDS.N........VIT......P.............G...........TPFMDIL..AAALRY.WIAY......KLN....T.D..............PA.............................................W..E.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................AS.....P.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PYFRVLRE-d.........................................................................................................................................................
A0A6A2YS11_HIBSY/97-187                ........................................................irclvq---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-PSPT.TF....DEV.F......Q.C.I.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SWR...FRAAKDAAEA-...........................-AA...........E...EARL.RE..EF..E..R...E...A...E...D..S-.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------llkrnhs...................................................................................................................................................
A0A0V0XW95_TRIPS/10-264                ..............................................................MGV..P..A...FF.R..W..L.S.RKF.....PSIVTNCIEdtphdvgg.....................................................................................ttvpvdktQPN.....................PHGI..EFD.T...FYLDM......NG..IIHPCC.................................HP-........................----ED...RPAPK.TE....EEM.M......I.A.I.FE..Y.IDR.L.M.C.....IV...R.........P....R....R......L..LYMA...........................V......D..............GV................APR.AKMN.QQ........R.TRR...FRASKEATEK-...........................-EE...........Q...IRQI.RD..EL..R..A...Q...G...I...P..LPa....................................................................................................................esTDKQHFDS.N........CIT......P.............G...........TPFMARL..AICLRY.YIHE......RLN....T.D..............PA.............................................W..Q.......N...LL.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....H....QR....................................................................AC.....A.SH..D.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
C1FYK0_PARBD/1-259                     ..............................................................MGV..P..A...LF.R..W..L.S.SKY.....PKIISSVVEelpqeine.....................................................................................qevpvdttKPN.....................PNGE..EMD.N...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPPPS.NE....EEM.M......L.E.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEAD...........................EKK..........vE...---F.AK..LL..R..K...Q...N...G...K..KScee................................................................................................................iveeVTMKTWDS.N........VIT......P.............G...........TPFMDIL..AAALRY.WVAY......KLN....T.D..............PA.............................................W..E.......K...LK.VI..ISDA......T...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................SC.....P.EH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
M4EGQ8_BRARP/1-249                     ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PKSISDVVE.....................................................................................................EESglgal..........ditrpnPNGF..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.M.FE..Y.IDH.L.F.T.....LV...R.........P....R....K......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................AEE...........E...MLRQ.DF..EA..G..G...Q...I...L...S..AK.......................................................................................................................EKAETSDS.N........VIT......P.............G...........TPFMAVL..SVALQY.YIQS......RLN....R.N..............PG.............................................W..R.......F...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................GL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A178F3J7_TRIRU/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HK-........................--DSDS...PTFRM.TE....DKM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....R......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAELA-...........................-KE...........K...AIK-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMAKL..TKQLKY.FINK......KVS....E.D..............AE.............................................W..Q.......G...VE.VV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.EY..D.P.NMR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A2K2ALK5_POPTR/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVVDVIEeepvvieg.....................................................................................vkipvdtsKPN.....................PNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....GEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASDA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kETSQTFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......K...IK.VV..LSDA......N...........V.........PGEGEHKVM.SYI.R....L....QR....................................................................NL.....P.GY..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A482S7U6_9ARCH/56-268                ..............................................................MGV..P..A...FF.R..W..I.T.EKY.....GKILQEVLEkrpviidg.....................................................................................tvfplnltEPN.....................PIGI..EFD.N...LYVDM......NG..LIHPCS.................................HP-........................----ED...REAPK.TE....EEM.Y......D.N.V.CL..Y.VDR.L.V.A.....AI...R.........P....R....R......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAQEMREKRe.........................iKEQv........lrE...MQDL.GL..VE..G..E...R...R...E...E..ED.......................................................................................................................HSAHDWDS.N........VIT......P.............G...........TVFMHKL..SQYLHR.YVLH......KMN....T.D..............VY.............................................W..K.......D...IQ.VL..LYGY......S...........I.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------cimgiskm..................................................................................................................................................
A0A0D9W034_9ORYZ/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAVEeepvelep....................................................................................gafvpvdlrRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPAPT.TY....DEV.F......K.S.I.FA..Y.IDH.L.F.G.....LV...R.........P....R....K......L..IYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRK.EY..EA..E..G...R...T...L...A..EK.......................................................................................................................VKSEAIDS.N........VIT......P.............G...........TPFMFVL..STALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..IHFSILRE-v.........................................................................................................................................................
A0A179IHW3_CORDF/1-226                 ..............................................................--V..P..K...FF.R..W..L.S.ERY.....PPISQLIA-.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...TTFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALEVEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SRQLQY.FVNK......KVS....E.D..............TD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................SQ.....P.GY..D.S.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFSLLREE..........................................................................................................................................................
A0A0L7KS40_9NEOP/1-165                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSVIVECVEqkp...............................................................................................fdaD-Gqlvhv..........dsslpnPNNV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...RPAPK.DE....DEM.M......V.A.I.FE..C.IDR.L.F.R.....IV...R.........P....R....K......V..LYMA...........................I......D..............GV................---.----.--........R.SRR...FRASKETQEKI...........................E--...........E...IARI.RD..DL..K..V...K...G...A...Y..LPp....................................................................................................................ekPKEAHFDS.N........CIT......P.............G...........TPFMDRL..SK----.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------s.........................................................................................................................................................
G0RD43_HYPJQ/1-260                     ..............................................................MGI..P..A...AF.R..W..L.S.NKY.....PKIISPVIEetpittdd....................................................................................gvtipvdttRPN.....................PNGE..ELD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPA.DE....EEM.M......L.E.V.FR..Y.TDR.V.V.N.....MV...R.........P....R....K......I..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAREAKEKE...........................EDKqa.......liE..lLKRQ.NG..GV..F..E...A...A...D...S..EA.......................................................................................................................VVKKAFDS.N........SIT......P.............G...........TPFMDIL..AVSLRY.WCQY......KLN....T.D..............PA.............................................W..A.......K...LK.II..ISDA......T...........V.........PGEGEHKIM.SFI.R....S....QR....................................................................AS.....P.NY..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A369GFP4_9HYPO/1-228                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISQVIT.....................................................................................................ENR.....................---I.pEFD.C...LYLDM......NG..IIHNCT.................................HKD........................--AGED...ATFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...AIK-.--..--..-..-...-...D...G...I..EM.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TVFMAKL..SKQLRY.FVNK......KIS....E.D..............TE.............................................W..Q.......G...CQ.VV..LSGH......D...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A6G1A6A5_CROCR/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVNCVEekpkecng.....................................................................................vkipvdasKPN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-AV...........E...KQRV.RE..EI..L..A...K...G...G...F..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........A.........PGEGEHKIM.DYI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A446TIN2_TRITD/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PQTVSDAEEeepvelep....................................................................................gafipvdprRPN.....................PNGL..EFD.N...LYLDM......NG..IIHPCF.................................HPE........................-----G...RPSPT.TY....DEV.F......K.S.I.FD..Y.IDH.L.F.C.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADAA...........................AEE...........E...RLRL.EF..EA..E..G...R...N...L...V..RK.......................................................................................................................EKSEAIDS.N........VIT......P.............G...........TPFMFVL..SSALQY.YIQL......RLN....H.S..............PG.............................................W..Q.......S...VK.VI..LSDS......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A6A3BE42_HIBSY/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLIVVDVIEeepvvidg.....................................................................................iaipvdtsKPN.....................PNKL..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.TF....DEV.F......Q.C.I.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDASEA-...........................-AA...........E...EARL.RE..EF..E..R...E...G...R...R..LPp.....................................................................................................................kEESQLFDS.N........VIT......P.............G...........TPFMAVL..SIALQY.YIHL......RLN....H.D..............PG.............................................W..K.......N...TK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A316UMF0_9BASI/1-263                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVQSVEEeeprri........................................................................................pgpngteQ-Elpid............msgknPNGE..EFD.C...LYLDM......NG..IVHPCT.................................HPE........................-----G...KPAPE.TE....EDM.M......L.E.V.FS..Y.TER.V.V.N.....MI...R.........P....R....K......L..LMMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAMEAREK-...........................-EE...........E...KLAA.LE..EW..K..S...M...G...L...P..VTdda.................................................................................................................aagQGKKAWDS.N........AIT......P.............G...........TPFMDLL..AGSLRY.WVTK......KMN....E.D..............PG.............................................W..K.......D...LQ.VI..ISDA......S...........V.........PGEGEHKIM.DHI.R....R....QR....................................................................SH.....P.EH..D.P.NTK.....................HVIYG.............L............D...AD.L................I..M.LSLA........T.H.E..PHFKVLRE-d.........................................................................................................................................................
A0A6A3MSD9_9STRA/1-255                 ..............................................................MGV..P..A...FY.R..W..V.L.EKY.....PKCVVDCVEsrav............................................................................................vlegeR-Hfeltd...........ttgpnPNGF..EVD.N...LYVDM......NG..LIHPCA.................................HP-........................----EN...GEAPK.TE....EEM.Y......R.R.V.MA..Y.VDR.L.M.A.....AV...R.........P....R....R......V..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRAAQEAEQRM...........................--E...........V...EKEA.LE..YM..S..A...L...G...H...K..VP......................................................................................................................sKQEKPWDS.N........VIT......P.............G...........TKFMAKL..AKHLRF.YVRD......RVN....N.N..............AA.............................................W..K.......S...IK.VI..LSDA......G...........V.........PGEGEHKLM.EYV.R....V....QR....................................................................SQ.....P.GY..D.P.NQR.....................HVLHG.............L............D...AD.L................I..M.LGLA........T.H.E..VKFSILREE..........................................................................................................................................................
A0A3Q4G118_NEOBR/1-104                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...FYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FR---------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------l.........................................................................................................................................................
A0A4Q4ZWT8_9PEZI/1-260                 ..............................................................MGI..P..A...AF.R..W..L.S.QKY.....PKIISPVIEdqpiemdd....................................................................................gavipvdttRPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPK.DE....EEM.M......L.A.I.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKE..........................vD--...........-...KEEL.LK..ML..K..K...Q...N...G...G..VLpqe................................................................................................................tlesMTKKAFDS.N........SIT......P.............G...........TPFMDIL..AGSLRY.WCAY......KLN....T.D..............PG.............................................W..A.......K...MK.II..ISDA......T...........V.........PGEGEHKIM.NFI.R....S....QR....................................................................TS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A4W4GA33_ELEEL/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.F......A.D.I.FH..Y.VEV.L.F.R.....IV...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..VL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..QEQLKY.FVHK......KLS....M.D..............RM.............................................W..Q.......G...VR.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EI....................................................................AD.....L.GH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..PHFCLLREE..........................................................................................................................................................
A0A024WNM9_PLAFA/45-259                .............................................................y-GI..P..R...MY.K..W..L.T.SYY.....PTVREELIN.....................................................................................................NEK.....................--QK..SVD.I...FYIDM......NG..VIHHCT.................................HAN........................----KE...KLPIY.DE....HEL.F......S.N.I.LQ..Y.LKN.L.F.Y.....LI...K.........P....K....K......L..IYIG...........................V......D..............GV................SPK.AKMN.QQ........R.KRR...FLSIFKINDN-...........................-DN...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................-TSNLFNP.N........CIT......T.............G...........TDFMYKI..NLSLNK.WFKI......-LK....K.K..............KV.............................................F..E.......-...FD.VI..FSGS......D...........V.........AGEGEHKIL.KYI.R....E....NC....................................................................KR.....D.SN..F.K.NYN.....................HCIYG.............L............D...AD.L................I..M.LSLV........T.H.L..NNIFILRD-k.........................................................................................................................................................
A0A2C9VYU2_MANES/1-254                 ..............................................................MGV..P..A...FY.R..W..L.A.EKY.....PLVVVDVIEeepvvid.......................................................................................gvkipvdT-Sr..................pnPNNI..EYD.N...LYLDM......NG..IIHPCF.................................HP-........................----ED...RPSPT.SF....DEV.F......Q.C.M.FD..Y.IDR.L.F.V.....MV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAADA-...........................-AA...........E...EERL.RE..EF..E..R...E...G...R...K..LPp.....................................................................................................................kEGSQVFDS.N........VIT......P.............G...........TEFMAVL..SIALQY.YIHL......RLN....Y.D..............PG.............................................W..K.......K...IK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GY..N.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..VHFSILRE-i.........................................................................................................................................................
A0A078B6X5_STYLE/1-231                 ..............................................................MGI..P..K...FF.K..W..L.T.RRY.....PQILHNIKV.....................................................................................................EEE.....................-CP-..PID.N...LYLDL......NG..IVHNCI.................................HGN.......................dAKLHER...VSQLN.NF....DEV.W......A.N.I.MK..A.IDE.I.V.H.....TI...K.........P....K....K......V..LFLA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTAKDSQSL-...........................-IE...........K...---L.--..--..I..K...E...G...K...-..--.......................................................................................................................EATKLFDS.N........AIS......P.............G...........TKFMEQL..SKQLDF.FVQY......KQN....I.D..............PL.............................................Y..Q.......Q..lEK.IV..LSDG......F...........V.........PGEGEHKMM.DFI.R....Q....AK....................................................................QN.....P.NH..D.P.NTK.....................HCFYG.............A............D...AD.L................I..M.LSLV........T.H.E..PNFIILREE..........................................................................................................................................................
A0A0V1CMP8_TRIBR/6-260                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVMNCIEdtprdvdg.....................................................................................ttvpvdntQPN.....................PHGI..EFD.T...FYLDM......NG..IIHPCC.................................HP-........................----ED...KPAPK.SE....EEM.M......V.A.I.FE..Y.IDR.L.M.C.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRASKEAAEK-...........................-EE...........Q...IRQI.RE..DL..Q..A...Q...G...I...P..LPa....................................................................................................................esTDKQHFDS.N........CIT......P.............G...........TPFMARL..AVCLRY.YIHE......RLN....T.D..............PA.............................................W..Q.......N...LL.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....H....QR....................................................................AC.....A.SH..D.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
T1KWX8_TETUR/1-227                     ..............................................................MGV..P..K...FY.R..W..M.S.ERY.....P-CLNQVVR.....................................................................................................ESE.....................---I.pEFD.N...LYLDM......NG..IIHACS.................................HP-........................--NDED...VHFRL.PE....EVM.V......K.D.I.FK..Y.IEV.L.F.N.....II...K.........P....R....K......I..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKDAITR-...........................-ET...........E...A---.--..--..-..Q...N...K...G...E..VL.......................................................................................................................PKEARFDS.N........CIT......P.............G...........TDFMARL..QKHLEY.FVAS......KIS....N.D..............EL.............................................W..K.......N...VK.VI..LSGH......E...........T.........PGEGEHKIM.DFI.R....T....QR....................................................................SL.....P.DY..D.A.NTR.....................HCLYG.............L............D...AD.L................I..M.LGMC........S.H.E..PYFALLREE..........................................................................................................................................................
L8Y9A7_TUPCH/2-95                      ...............................................eaavekqrvreeila---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...----.--..--..-..-...-...-...-...-..-Kggf................................................................................................................lppeEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N..lTH.DE..LADS......L...........P.........SAEGE----.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------fiflrlnvlreyle............................................................................................................................................
D2VW45_NAEGR/1-227                     ..............................................................MGV..P..R...LF.K..W..L.S.ERY.....PCIASSLTE.....................................................................................................A-T.....................-IP-..TVD.N...LYLDM......NG..IIHNCT.................................HK-........................---DDE...LKAQL.TE....KEM.I......L.K.I.FR..Y.IDQ.L.F.Q.....LI...K.........P....S....K......H..FFLA...........................L......D..............GV................APR.AKMN.QQ........R.SRR...FRKVFDEQQL-...........................-RK...........-...----.--..KL..E..Q...K...G...E...K..VP.......................................................................................................................ERDNLFDS.N........CIT......P.............G...........TEFMAKL..SMHLKY.FIHS......KMQ....T.D..............IK.............................................W..Q.......Q...CK.VI..LSGH......E...........V.........PGEGEHKIM.NFI.R....G....RK....................................................................ME.....A.GY..Q.P.NER.....................HCLYG.............L............D...AD.L................I..C.LGLV........T.H.E..PHFMLLRE-d.........................................................................................................................................................
A0A0K9QQN2_SPIOL/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLAISNVVEeepreeen....................................................................................gvvypvdvsKPN.....................PNGM..EFD.N...LYLDM......NG..IIHPCF.................................HP-........................----DK...RPAPT.TY....DEV.F......K.T.I.FA..Y.IDH.L.F.L.....LV...R.........P....R....K......I..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAE...........................AE-...........-...EERL.KK..EF..E..S...E...G...Ri.lA..SK.......................................................................................................................ERRETSDS.N........VIT......P.............G...........TEFMFVL..SVALQY.YVQK......ELN....N.H..............AG.............................................W..R.......R...VK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................DL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LALA........T.H.E..LHFSILRE-v.........................................................................................................................................................
A0A2H6KFF3_9APIC/1-255                 ..............................................................MGV..P..T...FY.R..W..L.C.SRY.....PRVVQDVKDdl.................................................................................................neR-Dvdftdve......afgmellmPNPN.gEFD.N...LYVDM......NG..LIHPCC.................................HP-........................----EG...LEQPP.SE....EVM.F......Q.C.I.FD..Y.LDR.L.F.Y.....LV...R.........P....R....K......L..LFLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FKSAAEADLE-...........................-AS...........T...YEKV.SA..EF..A..G...K...N...I...F..VP.......................................................................................................................PKQKRWDS.N........VIT......P.............G...........TPFMHEL..SRRVVS.FIEE......RRR....L.F..............ES.............................................W..S.......R...IH.VI..YSDP......N...........V.........PGEGEHKIM.NFI.R....N....QR....................................................................HS.....P.QH..D.P.NTR.....................HVLHG.............M............D...AD.L................I..M.LGLA........T.H.E..VNFYIIRE-i.........................................................................................................................................................
A0A444EGZ4_ENSVE/29-100                ......................................................vngvqaae---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.----.--........-.---...-----------...........................---...........-...AEKL.RD..EF..E..S...Q...L...E...K..LCn.....................................................................................................................pEEINKMDS.N........VIT......P.............G...........TEFMALL..SSALRY.YICL......RIN....S.D..............PG.............................................W..R.......G...IK.VY..F---......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------..........................................................................................................................................................
W4KGV2_HETIT/1-260                     ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIVTPVVE.....................................................................................................EDEtkveggdgdeiiipvnialpnPNNV..EFD.N...LYLDM......NA..IVHPCT.................................HPE........................-----G...KPAPE.TE....EEM.M......L.E.V.FK..Y.TER.V.V.N.....MI...R.........P....R....K......L..LVMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAKEKE...........................EAR..........rE...SLAL.WE..AM..G..K...T...V...S...E..EE.......................................................................................................................RNKKAWDS.N........AIT......P.............G...........TPFMDLL..TSSLRY.WVVQ......KAN....T.D..............PG.............................................W..K.......Q...LE.VI..ISDA......S...........V.........PGEGEHKIM.DYV.R....R....QR....................................................................SN.....P.GH..D.P.NTQ.....................HVIYG.............L............D...AD.L................I..M.LALA........T.H.E..PHFKVLRE-d.........................................................................................................................................................
A0A673B5C0_9TELE/1-254                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIIVHCVEekgkecng.....................................................................................vripvdttKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......V..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVEL-...........................-AE...........E...KHRM.RE..EI..I..Q...R...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AHCLRY.YIAD......RLS....N.D..............PG.............................................W..K.......N...VT.VF..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
XRN2_NEUCR/1-260                       ..............................................................MGI..P..A...AF.R..W..L.S.TKY.....PKIISPVIEdqpitmpd....................................................................................gtvipvdatKPN.....................PNGE..EFD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPK.DE....EEM.M......V.E.V.FK..Y.TDR.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRAAREAMEKE...........................--E...........D...KQKF.VE..LL..K..K...Q...N...G...K..PQeee................................................................................................................pvevVVKKAFDS.N........SIT......P.............G...........TPFMDIL..AASLRY.WCSY......KLN....T.D..............PA.............................................W..A.......N...IK.VI..ISDA......T...........V.........PGEGEHKIM.EFV.R....S....QR....................................................................GS.....P.NH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
T1HF38_RHOPR/1-226                     ..............................................................MGV..P..K...FY.R..Y..I.S.ERY.....PCLSEKLR-.....................................................................................................EFQ.....................-I-P..EFD.N...LYLDM......NG..IIHVCS.................................HP-........................---DDN...PLQST.PE....ETI.F......K.D.I.FY..Y.IEL.M.F.R.....LI...Q.........P....K....K......L..FMMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRTAKDAEIA-...........................-AA...........R...V---.M-..--..A..-...-...K...S...G..SV.......................................................................................................................DPEERFDS.N........CIT......P.............G...........TEFMDKL..HQQLKY.FIVY......KIS....T.D..............KL.............................................W..Q.......R...PK.II..LSGH......D...........T.........PGEGEHKIM.DYI.R....Y....LR....................................................................SR.....D.DW..Q.P.NTR.....................HCLHG.............L............D...AD.L................V..M.LGLC........S.H.E..LHFSLLREE..........................................................................................................................................................
A0A5N4EIJ1_CAMDR/1-220                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................-..-.----........-.-.-..---------dkitfkydier...............................................................................................................................................
A0A4Q4SVL6_9PEZI/15-241                ............................................................ys--V..P..K...FF.R..W..L.S.ERY.....P-AISQLIA.....................................................................................................ENR.....................---I.pEFD.N...LYLDM......NG..IIHNCT.................................HK-........................--DSHD...TSFRL.SE....DEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEQA-...........................-RE...........K...A--I.R-..--..-..-...-...E...G...V..EL.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMAKL..TRQLKY.FINK......KVS....E.D..............SD.............................................W..Q.......G...CD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.DY..S.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
H2ASF0_KAZAF/1-227                     ..............................................................MGI..P..K...FF.R..Y..I.S.ERW.....P-MISQLIE.....................................................................................................GAQ.....................-IP-..EFD.N...LYLDM......NS..ILHTCT.................................HG-........................--NDDD...VTKRM.TE....EEV.F......A.K.I.FT..Y.IDH.L.F.H.....TI...K.........P....K....K......V..FYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRTAMDAEAA-...........................-LK...........K...AIE-.--..--..-..-...-...K...G...E..EI.......................................................................................................................PKGEPFDS.N........AIT......P.............G...........TEFMAKL..TKNLKY.FIHD......KIS....N.D..............SK.............................................W..R.......E...VD.VI..FSGH......E...........V.........PGEGEHKIM.DFI.R....N....IR....................................................................SQ.....K.DY..N.N.NTR.....................HCIYG.............L............D...AD.L................I..M.LGLS........T.H.A..PHFALLREE..........................................................................................................................................................
A0A364L6X9_9EURO/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....PSISQLIA-.....................................................................................................ENR.....................---I.pEFD.N...LYFDM......NG..IIHNCT.................................HN-........................--DSDS...PTHRM.SE....DQM.F......I.A.I.FN..Y.IEH.L.Y.G.....KI...K.........P....K....K......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRSALDAEVA-...........................-KE...........K...AIA-.--..--..-..-...-...Q...G...I..EM.......................................................................................................................PKEDAFDS.N........CIT......P.............G...........TEFMARL..TKQLKY.FISK......KIS....E.D..............VE.............................................W..Q.......G...VD.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....Q....AK....................................................................AQ.....P.GY..D.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PYFCLLREE..........................................................................................................................................................
A0A401NRB0_SCYTO/2-191                 ..........................................................lsip---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDED...VHFRI.SE....EKI.I......A.D.I.FH..Y.VEV.L.F.R.....II...K.........P....K....K......I..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEEKI...........................K-K...........-...A---.--..--..-..L...E...K...G...E..IL.......................................................................................................................PTESRFDS.N........CIT......P.............G...........TAFMARL..HEQLKY.FINL......KIS....T.E..............KS.............................................W..E.......G...VA.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....A....ET....................................................................TK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................V..C.----........-.-.-..---------im........................................................................................................................................................
M1VHN0_CYAM1/1-264                     ..............................................................MGI..A..S...FF.R..W..V.V.ARY.....PRALQAAVEeapvtdqaa...................................................................................lengnylddN-Dylhvd...........vslpnPNGE..EFS.N...LYFDL......NG..VVHMCT.................................HP-........................----ED...RPPPA.TE....EDM.F......Q.D.V.FR..Y.MDR.I.V.A.....LV...R.........P....R....R......L..IYIA...........................I......D..............GV................APR.AKIN.QQ........R.TRR...FRAAKEAREK-...........................-TE...........E...EEKL.RA..LW..R..E...Q...G...L...R..VP......................................................................................................................pKPKKPFDS.N........VIT......P.............G...........TLFMERL..AVALRR.YIRE......RIR....S.C..............PA.............................................W..R.......S...LV.VI..LSDA......S...........V.........PGEGEHKIA.EFI.R....T....QR....................................................................AQ.....P.GY..D.P.ETR.....................HVLYG.............L............D...AD.L................I..M.LALA........T.H.E..PHFFILRE-r.........................................................................................................................................................
A0A1U7VFS5_NICSY/1-255                 ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSIVDVVEeepkedsh....................................................................................glfvpvdisKPN.....................PNGM..EFD.N...MYLDM......NG..IIHPCF.................................HPE........................-----G...KPAPA.TY....DDV.F......K.S.I.FV..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRAAKDAAEAE...........................AE-...........-...EKRL.RE..EF..E..M...E...A...A...S..LLp.....................................................................................................................tGKPETSDS.N........VIT......P.............G...........TPFMAVL..AVALQY.YIQS......RLN....K.N..............AG.............................................W..R.......F...TK.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..VHFSILRE-v.........................................................................................................................................................
A0A016T3H6_9BILA/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVIS.....................................................................................................DTE.....................-IP-..EFD.N...LYLDM......NG..IIHNCS.................................HP-........................--NDDD...VKFRI.SQ....EQI.F......A.D.I.FA..Y.IDK.L.F.N.....II...R.........P....K....K......V..FFLA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FMSARTAEEQ-...........................-LQ...........A...HL--.--..--..-..-...R...K...G...E..EL.......................................................................................................................PKEKRFDS.N........CIT......P.............G...........TLFMAEL..HNELSK.WLET......KVE....K.D..............QA.............................................W..H.......G...IR.VY..LSGH......D...........C.........PGEGEHKIM.DFI.R....H....ER....................................................................TL.....E.GY..D.S.NTR.....................HCMYG.............L............D...AD.L................L..M.LGIC........S.H.E..PHFSLLREE..........................................................................................................................................................
E9E7Z7_METAQ/1-193                     ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...----M......NG..IIHNCT.................................HKD........................--AGED...VSFRL.SE....EEM.F......I.R.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....Q......L..FFMA...........................I......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAEKA-...........................-RE...........K...AIK-.--..--..-..-...-...E...G...V..EM.......................................................................................................................PKEEPFDS.N........CIT......P.............G...........TEFMAKL..SQQLRY.FVNK......KVS....E.D..............AD.............................................W..Q.......G...CE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....N....AK....................................................................AQ.....P.NY..N.P.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A3Q0EJT8_VIGRR/1-144                 ..............................................................---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..---.-...-----......--..------.................................---........................------...-----.--....---.-......-.-.-.--..-.---.-.-.-.....--...-.........-....-....-......-..----...........................-......-..............--................---.--MN.QQ........R.SRR...FRAAKDKEIHE...........................A--...........E...EERL.RK..QF..E..M...E...G...K...Q..VLp.....................................................................................................................kQESQVEDS.N........VIT......P.............G...........TEFMHEL..SKALKG.YISS......RIN....C.N..............SL.............................................W..K.......D...II.VI..LSDA......N...........V.........PGEGEHKIM.SYI.R....K....QR....................................................................TL.....E.EY..D.P.NTC.....................HCLYG.............S............D...AD.L................I..M.LAMA........T.H.E..PHFSILRE-d.........................................................................................................................................................
A0A0V0XVI0_TRIPS/10-264                ..............................................................MGV..P..A...FF.R..W..L.S.RKF.....PSIVTNCIEdtphdvgg.....................................................................................ttvpvdktQPN.....................PHGI..EFD.T...FYLDM......NG..IIHPCC.................................HP-........................----ED...RPAPK.TE....EEM.M......I.A.I.FE..Y.IDR.L.M.C.....IV...R.........P....R....R......L..LYMA...........................V......D..............GV................APR.AKMN.QQ........R.TRR...FRASKEATEK-...........................-EE...........Q...IRQI.RD..EL..R..A...Q...G...I...P..LPa....................................................................................................................esTDKQHFDS.N........CIT......P.............G...........TPFMARL..AICLRY.YIHE......RLN....T.D..............PA.............................................W..Q.......N...LL.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....H....QR....................................................................AC.....A.SH..D.P.NTH.....................HVLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
Q4QEY1_LEIMA/80-248                    ........................................tssshmsrpegagvvapgsytp---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..MVD.H...VLVDM......NC..VVHSCF.................................RH-........................-----Q...SSENK.TK....KQL.I......Q.E.V.LE..R.LRV.L.V.T....eVV...V.........P....R....Q......S..LSIC...........................F......D..............GP................API.AKLQ.TQ........R.LRR...RKVSLLDTGS-...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--VQQLNT.L........SIT......A.............G...........SLFMIEL..ENAIAS.QF--......KLN....R.G..............RG.............................................FlrR.......A...CP.VY..LYGT......T...........V.........MGEGEAKIS.R--.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------alafla....................................................................................................................................................
XRN2_SCHPO/1-256                       ..............................................................MGV..P..A...LF.R..L..L.S.RKF.....AKVITPVIEapte............................................................................................klpdgT-Eiepd............lslpnPNGV..ECD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPAPE.TE....DEM.M......V.A.V.FE..Y.TDR.I.L.A.....MV...R.........P....R....Q......L..LFIA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRSSREAALK-...........................-EE...........E...LQAF.IE..EA..K..Q...Q...G...I...P..IDe....................................................................................................................naTKKKSWDS.N........CIT......P.............G...........TPFMDTL..AKSLRY.YIIN......KLN....S.D..............PC.............................................W..R.......N...VR.FI..LSDA......S...........V.........PGEGEHKIM.EFI.R....S....QR....................................................................VK.....P.EY..D.P.NTH.....................HVVYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
#=GR XRN2_SCHPO/1-256            SS    ..............................................................--H..H..H...HH.H..H..H.H.HH-.....GGGEEE------E............................................................................................E-TTS--EE---............TTS--TTSS..-EE.E...EEEET......HH..HHHHHH.................................S--........................----SS...S----.SH....HHH.H......H.H.H.HH..H.HHH.H.H.H.....HH...-.........E....E....E......E..EEEE...........................-......-..............--................--H.HHHH.HH........H.HHH...HHHHHHHHHH-...........................-HH...........H...HHHH.HH..HH..H..H...H...T...-...-..B-H....................................................................................................................HHHS-----G.G........GSS......T.............T...........SHHHHHH..HHHHHH.HHHH......HHT....S.-..............GG.............................................G..T.......T...-E.EE..EE-T......T...........S.........-S-HHHHHH.HHH.H....H....HH....................................................................TS.....T.TS..-.T.T--.....................EEEE-.............-............-...TT.H................H..H.HHHH........T.T.-..SSEEEEEE--.........................................................................................................................................................
A0A139H6N7_9PEZI/1-263                 ..............................................................MGV..P..A...LF.R..W..L.S.KKY.....PKIISPVVEeqpa.............................................................................................evanE-Dgsvtkip.......idargpnPNGE..EMD.N...LYLDM......NG..IVHPCS.................................HP-........................----ED...RPPPA.NE....EEM.M......V.A.I.FE..Y.TER.V.V.N.....MV...R.........P....R....K......L..LMIA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FRSAQEAAEKD...........................AMAae.......fhA...RMVA.AG..EA..G..G...D...D...E...K..DS.......................................................................................................................KPKKTWDS.N........SIT......P.............G...........TPFMDLL..AASLRY.WISY......KLT....T.D..............PA.............................................W..E.......K...LK.VI..ISDA......T...........V.........PGEGEHKIM.NFV.R....S....QR....................................................................SS.....P.DH..D.P.NTR.....................HVIYG.............L............D...AD.L................I..M.LGLA........T.H.E..PHFRVLRE-d.........................................................................................................................................................
A0A1V6TF84_9EURO/1-227                 ..............................................................MGV..P..K...FF.R..W..L.S.ERY.....P-AISMLIA.....................................................................................................DSR.....................-IP-..EFD.S...LYLDM......NG..IIHNCT.................................HS-........................--DSDS...PTFRM.TE....DQM.F......I.A.I.FN..Y.IEH.L.F.G.....KI...K.........P....K....K......L..FYMA...........................V......D..............GV................APR.AKMN.QQ........R.ARR...FRTALDAENA-...........................-KE...........K...AIQ-.--..--..-..-...-...Q...G...L..EM.......................................................................................................................PKEDPFDS.N........CIT......P.............G...........TEFMQKL..TKQLKY.FINK......KIS....E.D..............TD.............................................W..Q.......G...VE.IV..LSGH......E...........V.........PGEGEHKIM.EYI.R....C....SK....................................................................AQ.....P.DY..E.S.NVR.....................HCLYG.............L............D...AD.L................I..M.LGLL........S.H.D..PHFCLLREE..........................................................................................................................................................
R1ET42_EMIHU/1-109                     ..............................................................MGV..P..L...LY.R..W..L.S.ERY.....PLINRPAS-.....................................................................................................--S.....................PPFA..EVD.N...LYIDA......NG..ILHNAT.................................HGA.......................nKPPARN...GAAAP.TE....ADM.M......L.A.I.CS..Y.LDT.L.V.Q.....LV...R.........P....Q....R......L..LYVA...........................I......D..............GV................APR.AKMN.QQ........R.QRR...FR---------...........................---...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................--------.-........---......-.............-...........-------..------.----......---....-.-..............--.............................................-..-.......-...--.--..----......-...........-.........---------.---.-....-....--....................................................................--.....-.--..-.-.---.....................-----.............-............-...--.-................-..-.----........-.-.-..---------vl........................................................................................................................................................
R1E942_EMIHU/1-196                     ..............................................................MGV..P..G...LS.E..W..L.K.RHH.....ENCFVATP-.....................................................................................................--R.....................----..SAD.H...IYVDI......NS..MLHGVV.................................RH-........................------...---NA.TE....AAA.L......A.D.L.ER..Q.LNE.M.A.R.....LR...T.........P....R....I......S..LTLA...........................V......D..............GP................APL.AKLK.EQ........R.ERR...VKHSIKEERS-...........................-AS...........-...----.--..--..-..-...-...-...-...-..--.......................................................................................................................THQNRLST.L........CVT......V.............G...........TTFMRDV..DATLRR.WARA......---....-.-..............SG.............................................W..L.......R...AR.IV..VDPS......S...........H.........DGEGEVKLF.RHL.R....L....TN....................................................................--.....-.SG..S.A.AES.....................HLVLG.............G............D...AD.L................A..L.LALA........S.P.A..HRV------lcc.......................................................................................................................................................
A0A0V1AZU5_TRISP/6-261                 ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVMNCIEdtprdvdg.....................................................................................ttvpvdntQPN.....................PHGI..EFD.T...FYLDM......NG..IIHPCC.................................HP-........................----ED...KPAPK.SE....EEM.M......V.A.I.FE..Y.IDR.L.M.C.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.TRR...FRASKEAAEK-...........................-EE...........Q...IRQI.RE..DL..R..A...Q...G...I...P..LPa....................................................................................................................esTDKQHFDS.N........CIT......P.............G...........TPFMARL..AICLRY.YIHE......RLN....T.D..............PA.............................................W..Q.......N...LL.VI..LSDA......S...........V.........PGEGEHKIM.DYI.R....H....QR....................................................................AC.....A.SH..D.P.NTH.....................HVLCG.............A............D..gTD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A3Q0D8B6_MESAU/1-227                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
A0A091K6Q6_COLST/1-202                 ............................................................ip---..-..-...--.-..-..-.-.---.....---------.....................................................................................................---.....................----..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SE....DKI.F......A.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AL--.--..--..-..-...E...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.VY..LSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.HH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFALLREE..........................................................................................................................................................
F6WU61_MACMU/1-227                     ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....P-CLSEVVK.....................................................................................................EHQ.....................--IP..EFD.N...LYLDM......NG..IIHQCS.................................HP-........................--NDDD...VHFRI.SD....DKI.F......T.D.I.FH..Y.LEV.L.F.R.....II...K.........P....R....K......V..FFMA...........................V......D..............GV................APR.AKMN.QQ........R.GRR...FRSAKEAEDK-...........................-IK...........K...AIE-.--..--..-..-...-...K...G...E..TL.......................................................................................................................PTEARFDS.N........CIT......P.............G...........TEFMARL..HEHLKY.FVNM......KIS....T.D..............KS.............................................W..Q.......G...VT.IY..FSGH......E...........T.........PGEGEHKIM.EFI.R....S....EK....................................................................AK.....P.DH..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LGLT........S.H.E..AHFSLLREE..........................................................................................................................................................
V6LYE0_9EUKA/1-218                     ..............................................................MGI..P..Q...FF.R..W..L.Q.KRY.....PNIISDRP-.....................................................................................................--Q.....................---L..PID.N...LYLDL......NG..LVHPCF.................................HP-........................-----P...ERTIL.NE....DQV.F......Q.E.M.FI..L.MDK.V.I.K.....AV...N.........P....Q....K......L..VYIA...........................V......D..............GC................APR.AKLQ.QQ........R.KRR...FISAYEKQQKI...........................--I...........D..lKKDL.GE..EA..L..K...E...-...-...-..--.......................................................................................................................YLDNSMDQ.N........CIT......P.............G...........TEFMVKL..KKALVY.YTST......RYT....-.-..............--.............................................-..-.......-...VN.FI..LDDW......S...........T.........PGEGEHKIM.SFI.R....S....QR....................................................................SK.....P.DY..S.V.KTS.....................HCIYG.............L............D...AD.L................I..M.LALS........S.H.E..PNFFIFRD-y.........................................................................................................................................................
W9QSW6_9ROSA/1-255                     ..............................................................MGV..P..A...FY.R..W..L.A.DRY.....PLSISDVVEeepkedsn....................................................................................gipmpidvsKPN.....................PNGL..EFD.N...LYLDM......NG..LIHPCF.................................HPE........................-----G...KPAPA.TY....NDV.F......K.S.I.FE..Y.IDH.L.F.S.....LV...R.........P....R....K......L..LYLA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRAAKDAAEAA...........................AEE...........E...RLKK.EF..ED..E..E...R...N...L...T..LT.......................................................................................................................EKSETSDS.N........VIT......P.............G...........TQFMAVL..SVALQY.YIQS......RLN....R.N..............PG.............................................W..R.......S...TK.VI..LSDS......N...........V.........PGEGEHKIM.TYI.R....L....QR....................................................................NL.....P.GF..D.P.NTR.....................HCLYG.............L............D...AD.L................I..M.LSLA........T.H.E..IHFSILRE-l.........................................................................................................................................................
A0A0L0VUT5_9BASI/1-218                 ..............................................................---..-..-...--.-..-..M.S.ERY.....PYVLQLVEE.....................................................................................................-NR.....................---I.pQFD.N...LYLDM......NG..IIHHCS.................................HPN........................---EGS...AHFRI.TD....QDI.Y......L.A.I.FS..Y.LEH.L.F.A.....LA...K.........P....Q....K......V..FFLA...........................V......D..............GV................APR.AKMN.QQ........R.SRR...FKTAKENQEL-...........................-IE...........K...AIR-.--..--..-..-...-...K...G...E..KL.......................................................................................................................PDTTGFDS.N........CIT......P.............G...........TAFMARL..SEQLKY.FINK......KVS....E.D..............SA.............................................W..Q.......S...VQ.VI..FSGH......D...........V.........PGEGEHKIM.EYI.R....L....SK....................................................................AQ.....E.DY..N.P.NIR.....................HCVYG.............L............D...AD.L................I..M.LALL........S.H.D..PHFCLLREE..........................................................................................................................................................
A0A448ZS96_9STRA/1-232                 ..............................................................MGV..P..K...FY.R..W..I.S.ERY.....TKINEIVS-.....................................................................................................DSA.....................-LLP..EFD.H...LYLDM......NG..IIHGCT.................................HP-........................--SHMD...ISDVI.SE....RDM.M......L.G.I.MH..Y.LDR.I.I.T....qIV...K.........P....R....V......S..VYMA...........................I......D..............GV................APR.AKLN.QQ........R.SRR...FRSAKDMAEA-...........................-TK...........D...LPK-.--..ER..D..-...-...D...A...G..NI.......................................................................................................................KKPDLFDS.N........CIT......P.............G...........TEFMARV..SETIKY.FIRK......KIK....E.D..............PL.............................................W..R.......D...LK.VI..FSGH......E...........L.........PGEGEHKIM.EHI.R....M....MK....................................................................NE.....P.NY..Q.P.NNR.....................HCIYG.............Q............D...AD.L................I..M.LGLV........T.H.E..PHFTILRE-v.........................................................................................................................................................
V9K859_CALMI/1-254                     ..............................................................MGV..P..A...FF.R..W..L.S.RKY.....PSIVVHCLEervkevng.....................................................................................vkipvdtsKPN.....................PNEV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----EN...KAAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IL...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGVELL...........................A--...........E...KTRM.RE..EV..I..S...K...G...Gf.lS..EE.......................................................................................................................VIKERFDS.N........CIT......P.............G...........TEFMDNL..ARSLRY.YVAD......RLN....N.D..............PG.............................................W..K.......N...LT.VI..LSDA......S...........V.........PGEGEHKIM.DFI.R....R....QR....................................................................AQ.....P.NH..D.P.NTH.....................HCLCG.............A............D...AD.L................I..M.LGLA........T.H.E..PNFTIIREE..........................................................................................................................................................
A0A1Y3B7D1_EURMA/1-226                 ..............................................................MGV..P..K...FY.R..W..L.S.ERY.....P-CINEYVN.....................................................................................................QY-.....................-NIP..EFD.N...FYVDM......NG..VFHICS.................................HP-........................---SDD...VHFRI.PE....SQI.F......E.N.I.AT..Y.VNF.L.F.N.....LV...Q.........P....R....K......V..FFLS...........................V......D..............GV................APR.SKMN.QQ........R.SRR...FKSAQEAIEK-...........................-ET...........K...ARR-.--..--..-..-...-...M...G...Q..TL.......................................................................................................................PSDPRFDS.N........CIT......P.............G...........TEFMNKL..HLFMLE.FIAK......KIQ....N.C..............QE.............................................W..R.......E...VE.IV..YSGY......D...........V.........PGEGEHKIM.DYI.R....Y....CK....................................................................TK.....D.SF..E.P.DTR.....................HCLYG.............L............D...AD.L................I..N.LGLS........T.H.E..PYFSVLREE..........................................................................................................................................................
L8IX99_9CETA/3-229                     .................................................ecngvkipvdask---..-..-...--.-..-..-.-.---.....---------.....................................................................................................-PN.....................PNDV..EFD.N...LYLDM......NG..IIHPCT.................................HP-........................----ED...KPAPK.NE....DEM.M......V.A.I.FE..Y.IDR.L.F.N.....IV...R.........P....R....R......L..LYMA...........................I......D..............GV................APR.AKMN.QQ........R.SRR...FRASKEGMEA-...........................-EI...........E...KQRV.RE..EI..L..A...K...G...G...Y..LPp.....................................................................................................................eEIKERFDS.N........CIT......P.............G...........TEFMDNL..AKCLRY.YIAD......RLN....N.D..............PG.............................................W..K.......N...LT.