GenomeNet

Database: Pfam
Entry: stn_TNFRSF12A
LinkDB: stn_TNFRSF12A
Original site: stn_TNFRSF12A 
#=GF ID   stn_TNFRSF12A
#=GF AC   PF12191.8
#=GF DE   Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Gavin OL;
#=GF SE   pdb_2eqp
#=GF GA   24.90 24.90;
#=GF TC   25.10 25.70;
#=GF NC   24.50 23.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR022316;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family of proteins is found in eukaryotes. Proteins in this
#=GF CC   family are typically between 129 and 184 amino acids in length.
#=GF CC   This is the stn_TNFRSF12A_TNFR domain from the tumour necrosis
#=GF CC   factor receptor. The function of this domain is unknown.
#=GF SQ   73
#=GS A0A2I2YHF2_GORGO/1-35     AC A0A2I2YHF2.1
#=GS G7Q0B1_MACFA/1-122        AC G7Q0B1.1
#=GS I3L1J9_HUMAN/1-80         AC I3L1J9.1
#=GS G3QR16_GORGO/1-129        AC G3QR16.1
#=GS A0A2K5NW60_CERAT/1-59     AC A0A2K5NW60.1
#=GS A0A0D9RD07_CHLSB/1-129    AC A0A0D9RD07.1
#=GS L8YAP9_TUPCH/1-80         AC L8YAP9.1
#=GS G1LFW0_AILME/1-99         AC G1LFW0.1
#=GS G3I023_CRIGR/1-124        AC G3I023.1
#=GS A0A1S3EQL8_DIPOR/73-179   AC A0A1S3EQL8.1
#=GS E1BJH6_BOVIN/1-129        AC E1BJH6.1
#=GS R4GAD6_ANOCA/5-108        AC R4GAD6.1
#=GS G1NVI5_MYOLU/1-129        AC G1NVI5.1
#=GS TNR12_MOUSE/1-129         AC Q9CR75.1
#=GS G1TPB5_RABIT/1-97         AC G1TPB5.2
#=GS A0A1S3ANQ3_ERIEU/5-110    AC A0A1S3ANQ3.1
#=GS A0A2K5K306_COLAP/1-65     AC A0A2K5K306.1
#=GS A0A2I3REV3_PANTR/32-94    AC A0A2I3REV3.1
#=GS A0A1B8XVZ7_XENTR/1-80     AC A0A1B8XVZ7.1
#=GS A0A2K5K2X8_COLAP/32-94    AC A0A2K5K2X8.1
#=GS A0A2K5K2X8_COLAP/1-35     AC A0A2K5K2X8.1
#=GS E9PZT5_MOUSE/32-94        AC E9PZT5.1
#=GS A0A2I3H5J1_NOMLE/32-94    AC A0A2I3H5J1.1
#=GS A0A2I3GUG4_NOMLE/1-61     AC A0A2I3GUG4.1
#=GS G3TH99_LOXAF/1-129        AC G3TH99.1
#=GS I3L539_HUMAN/1-44         AC I3L539.1
#=GS W5NRH8_SHEEP/1-129        AC W5NRH8.1
#=GS A0A1D5RJW8_MACMU/1-64     AC A0A1D5RJW8.1
#=GS A0A2I2Z9Q7_GORGO/1-65     AC A0A2I2Z9Q7.1
#=GS F6W9A6_CALJA/1-129        AC F6W9A6.1
#=GS A0A2I3H5J1_NOMLE/1-35     AC A0A2I3H5J1.1
#=GS A0A2I3REV3_PANTR/1-35     AC A0A2I3REV3.1
#=GS G5B1J3_HETGA/1-124        AC G5B1J3.1
#=GS F6WTQ1_CALJA/1-35         AC F6WTQ1.1
#=GS H2QAF0_PANTR/1-129        AC H2QAF0.1
#=GS I3MET2_ICTTR/1-34         AC I3MET2.2
#=GS A0A2I3TGH1_PANTR/1-64     AC A0A2I3TGH1.1
#=GS I3L3P4_HUMAN/1-64         AC I3L3P4.1
#=GS A0A1U7T4N9_TARSY/218-338  AC A0A1U7T4N9.1
#=GS I3MET2_ICTTR/33-94        AC I3MET2.2
#=GS B7SLY2_PIG/1-129          AC B7SLY2.1
#=GS E2R8M4_CANLF/1-129        AC E2R8M4.1
#=GS M3YUX4_MUSPF/1-129        AC M3YUX4.1
#=GS C3ZG48_BRAFL/2-95         AC C3ZG48.1
#=GS H0VCF2_CAVPO/1-35         AC H0VCF2.2
#=GS A0A2K5K2V6_COLAP/1-129    AC A0A2K5K2V6.1
#=GS A0A2I2YHF2_GORGO/32-94    AC A0A2I2YHF2.1
#=GS G3V6F9_RAT/1-129          AC G3V6F9.1
#=GS H0WYS6_OTOGA/1-129        AC H0WYS6.1
#=GS A0A091D108_FUKDA/1-100    AC A0A091D108.1
#=GS A0A1U7QVB1_MESAU/1-129    AC A0A1U7QVB1.1
#=GS F7BQN6_HORSE/1-128        AC F7BQN6.1
#=GS A0A1A6H9H0_NEOLE/1-129    AC A0A1A6H9H0.1
#=GS M3X1W2_FELCA/1-80         AC M3X1W2.2
#=GS E9PZT5_MOUSE/1-35         AC E9PZT5.1
#=GS G3WYW1_SARHA/1-100        AC G3WYW1.1
#=GS A0A096NL95_PAPAN/1-129    AC A0A096NL95.1
#=GS G1REF5_NOMLE/1-129        AC G1REF5.1
#=GS A0A1B8XW13_XENTR/8-110    AC A0A1B8XW13.1
#=GS H0VCF2_CAVPO/33-94        AC H0VCF2.2
#=GS F6YYA4_ORNAN/1-101        AC F6YYA4.1
#=GS H2NPX0_PONAB/1-129        AC H2NPX0.1
#=GS A0A287D2L0_ICTTR/1-129    AC A0A287D2L0.1
#=GS F6WTQ1_CALJA/32-94        AC F6WTQ1.1
#=GS A0A2K5NW34_CERAT/1-129    AC A0A2K5NW34.1
#=GS V8PCZ0_OPHHA/2-116        AC V8PCZ0.1
#=GS A0A2I3MP48_PAPAN/1-59     AC A0A2I3MP48.1
#=GS I3L0S4_HUMAN/1-86         AC I3L0S4.1
#=GS A0A2I4B7A3_9TELE/1-115    AC A0A2I4B7A3.1
#=GS TNR12_HUMAN/1-129         AC Q9NP84.1
#=GS TNR12_HUMAN/1-129         DR PDB; 2RPJ A; 28-70;
#=GS TNR12_HUMAN/1-129         DR PDB; 2EQP A; 8-50;
#=GS TNR12_HUMAN/1-129         DR PDB; 2KMZ A; 1-53;
#=GS F6ZDH3_MONDO/2-122        AC F6ZDH3.2
#=GS A0A286Y3T5_CAVPO/1-129    AC A0A286Y3T5.1
#=GS K7GI06_PELSI/1-95         AC K7GI06.1
A0A2I2YHF2_GORGO/1-35                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
G7Q0B1_MACFA/1-122                   ....................r--------LLRLLVLGLWLALLRSVAGEQAPGTRDLGVGEPRSGARE.PXXXXXXXXXXXXXXXXXXX..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
I3L1J9_HUMAN/1-80                    .....................-----------------------------------------------.--MDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
G3QR16_GORGO/1-129                   .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A2K5NW60_CERAT/1-59                .....................MARGSLRRLLRLLVLGVWLALLRSVAGEQAPGTRDLGVGEPRSGARE.P-------------------..--.-..-...--------------------.------.--------------------------------dwvpgeqrgtg.......................................
A0A0D9RD07_CHLSB/1-129               .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
L8YAP9_TUPCH/1-80                    .....................-----------------------------------------------.--MDCASCRARPHSDFCRGC..AA.A..P...PAHFQLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGLALIQ..................................................
G1LFW0_AILME/1-99                    .....................------------------------------PGTTPCSRGSSWSADLD.KCMDCASCPARPNSDFCLGC..AA.A..P...PASFPLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
G3I023_CRIGR/1-124                   .....................MAPAWPQPLPQILVLGLGLVLMRAAAGEQAPGTAPCSSG-----DLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
A0A1S3EQL8_DIPOR/73-179              ...............apltpa----------------------------PSPGAAPCARGSSWSADLD.KCMDCASCPARPHSDFCPGC..AA.A..P...PAPFGLLWPILGGALSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
E1BJH6_BOVIN/1-129                   .....................MAPCPLRPLLRLLVLGLGLALLRAAAGERVPGTTPCSRGTSWSADLD.KCMDCASCRARPHSDFCLGC..TA.A..P...PAPFRLLWPILGGALGLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGESCPGVALIQ..................................................
R4GAD6_ANOCA/5-108                   ..............lsflfsf------------------------------PSATACPGGQSWSPDLE.KCMDCAVCRFQNMNDFCSSC..GDpQ..P...PDTFN-LWLFVGVPLAAVFL.LSLTVG.IITYARCRRREKFTTPIEETGGHS--------aqesli............................................
G1NVI5_MYOLU/1-129                   .....................MALAPLRPLPRLLVLGLGLALLSAAAGEPVSGTTPCSRGSSWSEDLD.KCMNCESCPALPHSDFCRGC..AG.A..P...SASFGLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGAALIQ..................................................
TNR12_MOUSE/1-129                    .....................MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAHFRLLWPILGGALSLVLV.LALVSS.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
G1TPB5_RABIT/1-97                    .....................--------------------------------TAPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLVLV.LGLLSA.FLVWRRCRRREKFTTPIEETGGEGCPGAALIQ..................................................
A0A1S3ANQ3_ERIEU/5-110               ................rltaa----------------------------PSPGTTPCSRGSAWSADLD.KCMDCGSCPARPHSDFCLGC..AA.A..P...PTSFRLLWPILGGALGLLLV.LGLLAT.FLVWKRCRRREKFTTPIEETGGEACPGVALIQ..................................................
A0A2K5K306_COLAP/1-65                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDSGVGEPRAGARE.PD------------------..--.-..-...--------------------.------.--------------------------------wvpgeqrgtgetggcg..................................
A0A2I3REV3_PANTR/32-94               ....................g-----------------------------------------------.--------------------..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A1B8XVZ7_XENTR/1-80                .....................-----------------------------------------------.--MECSVCKNSEKSDFCQNCppQT.T..E...QPDFPWIWVIGFSAGGVFLI.TVILSL.TVYLTHCRRKSKFTKPIEETGSHSA-------ealli.............................................
A0A2K5K2X8_COLAP/32-94               ....................g-----------------------------------------------.--------------------..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A2K5K2X8_COLAP/1-35                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
E9PZT5_MOUSE/32-94                   ....................g-----------------------------------------------.--------------------..AA.A..P...PAHFRLLWPILGGALSLVLV.LALVSS.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
A0A2I3H5J1_NOMLE/32-94               ....................g-----------------------------------------------.--------------------..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A2I3GUG4_NOMLE/1-61                .....................MARGSLRRLLRLLVVGLWLALLRSVAGEQAPGTRDSGIGEPRAGARE.PD------------------..--.-..-...--------------------.------.--------------------------------wvsgeqrgtggt......................................
G3TH99_LOXAF/1-129                   .....................MALGPLRPLLRLLVLGLWLALLCAAAGERTPGAAPCPRGTSWSSDLD.KCMDCASCPVRPRSDFCLGC..AT.A..P...PAPFPLLWPILGGALSLALV.VGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
I3L539_HUMAN/1-44                    .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPDP--------------.--------------------..--.-..-...--------------------.------.--------------------------------riaesrpqplt.......................................
W5NRH8_SHEEP/1-129                   .....................MAHCPLRPLLRLLVLGLGLALLRAAAGERVPGTTPCSRGTSWSADLD.KCMDCASCRARPHSDFCLGC..TA.A..P...PAPFRLLWPILGGALGLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGESCPGVALIQ..................................................
A0A1D5RJW8_MACMU/1-64                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDLGVGEPRSGARE.PD------------------..--.-..-...--------------------.------.--------------------------------wvpgeqrgtgetggc...................................
A0A2I2Z9Q7_GORGO/1-65                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDSGIGEPRAGARD.PDW-----------------..--.-..-...--------------------.------.--------------------------------vsgeqrrtrgtggcg...................................
F6W9A6_CALJA/1-129                   .....................MARGSLRPLPLLLVLGLWLALLRAVAGEWAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PTPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGDGCPAVALIQ..................................................
A0A2I3H5J1_NOMLE/1-35                .....................MARGSLRRLLRLLVVGLWLALLRSVAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
A0A2I3REV3_PANTR/1-35                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
G5B1J3_HETGA/1-124                   ..................lhw--------LPRLLVLGLVLALPRATTGEQAPGTAPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.T..P...PAPFQLLWPILGGALSLALV.LALLSG.FLVWRRCHRREKFTTPIEETGGEGCPGVALIQ..................................................
F6WTQ1_CALJA/1-35                    .....................MARGSLRPLPLLLVLGLWLALLRAVAGEWAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
H2QAF0_PANTR/1-129                   .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
I3MET2_ICTTR/1-34                    .....................MALGSLRPMLRLLVLGLGLGLLRAATGEQAPGA--------------.--------------------..--.-..-...--------------------.------.--------------------------------s.................................................
A0A2I3TGH1_PANTR/1-64                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDSGVGEPRAGARE.PD------------------..--.-..-...--------------------.------.--------------------------------wvsgeqrrtggtggc...................................
I3L3P4_HUMAN/1-64                    .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDSGVGEPRAGARE.PD------------------..--.-..-...--------------------.------.--------------------------------wvsgeqrrtggtggc...................................
A0A1U7T4N9_TARSY/218-338             rlglggssgslselevereta----------------------------PSPGTAPCSRGSSWSADLD.KCMDCASCPARPHSDFCRGC..AT.A..P...PVPFRLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEET-GEGCPAVALIQ..................................................
I3MET2_ICTTR/33-94                   .....................-----------------------------------------------.--------------------..AS.A..P...PAPFRLLWPILGGALSLALV.LALLSA.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
B7SLY2_PIG/1-129                     .....................MILTPLRPLLRLLVLGLGLVLLRATAGERVPGTTPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PASFRLLWPILGGALSLVLV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
E2R8M4_CANLF/1-129                   .....................MVLGPLRPLPRLLVLGLGLALLGAAAGERVPGTTPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PASFPLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
M3YUX4_MUSPF/1-129                   .....................MLPGPLRPLPRLLVLGLGLALLGAAGGERVPGTTPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.S..P...PTSFPLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
C3ZG48_BRAFL/2-95                    ...................sd----------------------------------NCQPGFAWDKVLE.DCLSCSLCEEFPATAICQKC..SG.T..PgnnPDNGALPTGTVAGIVVSCVV.VVLVAVfFIVYRKCRRDRDVTT-----------------rpvqvdadpe........................................
H0VCF2_CAVPO/1-35                    .....................MAVGWLRWLLRLLVLGLMLALPRAAAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------t.................................................
A0A2K5K2V6_COLAP/1-129               .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A2I2YHF2_GORGO/32-94               ....................g-----------------------------------------------.--------------------..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
G3V6F9_RAT/1-129                     .....................MAPGWPRPLPQLLVLGFGLVLIHATAGEQAPGNAPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAHFRMLWPILGGALSLALV.LALVSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
H0WYS6_OTOGA/1-129                   .....................MACGSLRPMLRILVLGLGLALLRAASGEQAPGTAPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A091D108_FUKDA/1-100               ....................s------------------------------PGTAPCSRGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.I..P...PTPFQLLWPILGGALSLALV.LALLSA.FLVWRRCHRREKFTTPIEETGGEGCPGVALIQ..................................................
A0A1U7QVB1_MESAU/1-129               .....................MAPAWPRPLPQILVLGVGLVLMRAAAGEQAPGTAPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGTLSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
F7BQN6_HORSE/1-128                   .....................MIPGPLRPRLRFLVLGLGLALLRAAAGEPVPGITPCSRGSSWSADLDnKCIKGRGCPGEGRVPPPM--..TA.A..P...PASFRLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
A0A1A6H9H0_NEOLE/1-129               .....................MAPGWPRPLPQILVLGLGLVLMRAAAGEQXPGTAPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
M3X1W2_FELCA/1-80                    .....................-----------------------------------------------.--MDCASCPARPHSDFCLGC..AA.S..P...PASFPLLWPILGGALSLALV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
E9PZT5_MOUSE/1-35                    .....................MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGAA-------------.--------------------..--.-..-...--------------------.------.--------------------------------a.................................................
G3WYW1_SARHA/1-100                   ....................s------------------------------PAPSPCPQGSSWSPDLD.KCMDCSSCPARPYSDFCPGC..TT.A..P...PPPFPLLWPVLGGTLGLILI.LGLFSG.LLVWRQCRQKEKFTTPIEETGGEGCPGTALIQ..................................................
A0A096NL95_PAPAN/1-129               .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
G1REF5_NOMLE/1-129                   .....................MARGSLRRLLRLLVVGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A1B8XW13_XENTR/8-110               ..............vdplrhc---------------------------------KECPVGRAYSSDLG.KCMECSVCKNSEKSDFCQNCppQT.T..E...QPDFPWIWVIGFSAGGVFLI.TVILSL.TVYLTHCRRKSKFTKPIEETGSHSA-------ealli.............................................
H0VCF2_CAVPO/33-94                   .....................-----------------------------------------------.--------------------..AA.T..P...PAPFQLLWPILGGALSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
F6YYA4_ORNAN/1-101                   .....................------------------------------PASAPCPRGSSWSSDLD.KCMDCSSCPSRPYSDFCLGCesST.V..P...PPSAPLLWPVLGGSLGLALT.LGVLSG.LLVWRRCRRREKFTTPIEETGGEGCPGTALI-r.................................................
H2NPX0_PONAB/1-129                   .....................MARGSLRRLLRLLMLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
A0A287D2L0_ICTTR/1-129               .....................MALGSLRPMLRLLVLGLGLGLLRAATGEQAPGTAPCSSGSSWSADLD.KCMDCASCPARPHSDFCLGC..AS.A..P...PAPFRLLWPILGGALSLALV.LALLSA.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
F6WTQ1_CALJA/32-94                   ....................g-----------------------------------------------.--------------------..AA.A..P...PTPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGDGCPAVALIQ..................................................
A0A2K5NW34_CERAT/1-129               .....................MARGSLRRLLRLLVLGVWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
V8PCZ0_OPHHA/2-116                   .................ltwg------------VILGLLPVLLGSAQGELIA-ETNCPGGQSWSPDLE.KCMDCSVCQRQNKNDFCSTC..GD.P..Q...P-TNTFNWVLVGASLGAVLL.ASIITG.TIIYARCRRREKFTTAGETF--FTCPGV----pg................................................
A0A2I3MP48_PAPAN/1-59                .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTRDLGVGEPRSGARE.P-------------------..--.-..-...--------------------.------.--------------------------------dwvpgeqrgtg.......................................
I3L0S4_HUMAN/1-86                    .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPASDPR-----------.--------------------..--.-..-...--------------------.------.--------------------------------pppqapppapaaapgartwtsawtarlagrdrtatsawaalqhllppsgc
A0A2I4B7A3_9TELE/1-115               ................maltl-------------LCGFLIAAVASLRGAC-AEKSQCPNSEFWSSDLG.FCVPCASCKQYPKTPSCNTC..KF.VeeM...PDVWKLAAITSFSVLAVVLIgAALIIG.IMVHRRKSHKRPLREPIEETAG----------pl................................................
TNR12_HUMAN/1-129                    .....................MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLD.KCMDCASCRARPHSDFCLGC..AA.A..P...PAPFRLLWPILGGALSLTFV.LGLLSG.FLVWRRCRRREKFTTPIEETGGEGCPAVALIQ..................................................
#=GR TNR12_HUMAN/1-129         SS    .....................XXXXXXXXXXXXXXXXXXXXXXXXXXXSSHCSCSSS-SSEEEETTTT.EEEECCCHCC-TT-HHHHHH..SS.-..S...S--SS----XXXXXXXXXXX.XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..................................................
F6ZDH3_MONDO/2-122                   ...............algpla--------------VLLALTVLRLTWGEPASAPSPCPQGSSWSPDLD.KCMDCSSCPARPYSDFCPGC..ST.A..P...PAAFPLLWPVLGGTLGLMLI.IGLLSG.LLVWRQCRRKEKFTTPIEETGGEGCPGTALIQ..................................................
A0A286Y3T5_CAVPO/1-129               .....................MAVGWLRWLLRLLVLGLMLALPRAAAGEQAPGTAPCSRGSSWSADLD.KCMDCASCPTRPHSDFCRGC..AA.T..P...PAPFQLLWPILGGALSLALV.LALLSG.FLVWRRCRRREKFTTPIEETGGEGCPGVALIQ..................................................
K7GI06_PELSI/1-95                    ..................pgp----------------------------------ACPGGHSWSPDLD.KCMDCTICLHLTKNDFCTTC..SG.E..P...RPQDTRQWLVVGGVLGGVAV.LGLVGG.ALLWARCRKKEKFTTPIEETGGH---------sgeesl............................................
#=GC SS_cons                         .....................XXXXXXXXXXXXXXXXXXXXXXXXXXXSSHCSCSSS-SSEEEETTTT.EEEECCCHCC-TT-HHHHHH..SS.-..S...S--SS----XXXXXXXXXXX.XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..................................................
#=GC seq_cons                        .....................Mh.s..p.h.plLVLGlhLsLhpussGE.sPGsssss.GpshSssh-..shpCssC.t.shsshC.sC..uu.s..P...PssFtLLWPILGGALuLshV.LuLLSG.FLVWRRCRRREKFTTPIEETGGEGCPulALIQ..................................................
//
DBGET integrated database retrieval system