KEGG   Pseudomonas synxantha LBUM223: VO64_0214Help
Entry
VO64_0214         CDS       T03769                                 

Definition
(GenBank) Histidine ABC transporter, permease protein HisQ
  KO
K10016  histidine transport system permease protein
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VO64_0214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfb02000]
    VO64_0214
Transporters [BR:pfb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    VO64_0214
   Histidine transporter
    VO64_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Holin_9
Motif
Other DBs
NCBI-ProteinID: AKA80760
UniProt: A0A0E3K2E3
Position
251667..252395
Genome map
AA seq 242 aa AA seqDB search
MFETLLGALGLSAFNLHGFGPLLLEGAWMTVKLSLSSLLLSVLLGLIGASAKLSRLKLLR
LPAQLYTTLIRGVPDLVLMLLIFYSLQTWLTVITAALNWEYIEINPFVAGIITLGFIYGA
YFTETFRGAMLAVPRGQVEAATAYGLSRAQRFRFVVFPQMMRFALPGLGNNWMVILKATA
LVSIIGLADLVKAAQDAGKSTYQLFFFLVLAALTYLVITSVSNIFLRCLEKHYAAGSREA
VR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaacactattaggcgcattggggctctctgcattcaacctgcacggcttcggc
cctctgctgctcgaaggcgcttggatgaccgtcaagctttccctgtcttccctgctgctt
agcgtattgcttgggctaatcggcgccagcgccaaactttccaggctaaagctgctgcgt
ttgccggcgcagctctacaccacgctgattcgtggagtgcccgacctcgtactgatgctg
ttgattttctacagcttgcagacctggttgacggtcatcacggcggcattgaattgggag
tacatcgagatcaatcccttcgtcgcagggattatcacccttgggttcatctatggggcc
tacttcaccgaaacgttccgcggcgccatgctggcagtgccccgtggccaggtcgaagct
gctactgcctacgggttaagtcgcgcccagcgttttcgcttcgtggtgttcccgcaaatg
atgcgatttgctctcccgggactaggcaacaattggatggtgattctcaaagccaccgca
ttggtgtcaatcatcggcttggctgacttggtaaaagcggcccaggatgcggggaaaagc
acctatcaattattctttttccttgtgttggcggcactgacatacctggttatcaccagc
gtttctaatatcttcctgcgctgcctggagaagcactatgccgcgggttcacgggaggcg
gtgcgatga

DBGET integrated database retrieval system