KEGG   Pseudomonas synxantha LBUM223: VO64_0898Help
Entry
VO64_0898         CDS       T03769                                 

Definition
(GenBank) Isocitrate dehydrogenase-NADP
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00020  Citrate cycle (TCA cycle)
pfb00480  Glutathione metabolism
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
pfb01200  Carbon metabolism
pfb01210  2-Oxocarboxylic acid metabolism
pfb01230  Biosynthesis of amino acids
Module
pfb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VO64_0898
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VO64_0898
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VO64_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKA81444
UniProt: A0A0E3MJD6
Position
complement(1009694..1010950)
Genome map
AA seq 418 aa AA seqDB search
MGYKKIQVPAVGDKITVNADHSLNVPDQPIIPYIEGDGIGVDISPVMIKVVDAAVEKAYG
GKRKISWMEVYAGEKATQVYDQDTWLPQETLDAVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVRWFEGVPSPVKKPGDVDMTIFRENSEDIYAGIEWKAGSPEAIKVIKF
LKEEMGVTKIRFDQDCGIGVKPVSKEGTKRLARKALQYVVDNDRDSLTIVHKGNIMKFTE
GAFKEWAYEVAAEEFGATLLDGGPWMQFKNPKTGKNVVVKDAIADAMLQQILLRPAEYDV
IATLNLNGDYLSDALAAEVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDQVNPGSLIL
SAEMMLRHMGWVEAADLIIKGTNGAISAKTVTYDFERLMDGATLVSSSGFGDALIKHM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggatacaagaagattcaggttccggcagtcggcgacaaaatcaccgtcaatgcagac
cattctctcaatgttcctgaccaaccgatcattccctacatcgaaggtgacggtattggt
gtcgacatcagcccggtgatgatcaaggtggtcgacgcagctgttgaaaaggcttacggc
ggcaagcgcaagatctcgtggatggaggtttacgccggcgaaaaggctacacaggtctac
gaccaggatacctggctgccccaggaaaccctggatgcggtcaaggattacgtggtgtcc
atcaaggggccgctgaccacaccggtcggtggtggtatccgctcgctgaacgtggcgctg
cgccagcagctcgacctgtatgtgtgcctgcgcccggtgcgctggttcgaaggcgtgccc
agcccggtcaagaaacctggcgacgtggacatgaccatctttcgcgagaactccgaagat
atttacgccggcatcgagtggaaagctggttcgcctgaggcgatcaaggtaatcaagttt
ctcaaggaggaaatgggcgttaccaagatccgtttcgaccaggactgcgggatcggcgtc
aagccggtgtcgaaagaaggcaccaagcgcctggcgcgcaaggccctgcaatatgtcgtg
gataacgaccgcgattcgctgaccatcgtgcacaaaggcaacatcatgaagttcaccgaa
ggtgccttcaaggaatgggcctacgaagtggcggccgaagagttcggtgcgaccctgctg
gacggcggcccgtggatgcagttcaagaaccccaagaccggcaagaacgtagtcgtcaag
gatgccatcgccgacgccatgcttcagcagatactgctgcgcccggctgaatatgacgtt
atcgcgacgcttaacctgaacggcgactatttgtctgacgctttggcggcggaagtgggc
ggtatcggcatcgcgccgggggccaacttgtccgacaccgtggcgatgttcgaagcgacc
cacggtaccgcgcctaaatatgcgggcaaggaccaggtcaacccgggctcattgatcctg
tcggcagaaatgatgctgcgccatatggggtgggtcgaagcggctgacttgattatcaag
ggcaccaacggcgctatttcggccaagaccgtgacctatgacttcgagcgcctgatggat
ggcgctacgctggtgtcgtcgtcgggcttcggtgatgcgctgatcaagcatatgtaa

DBGET integrated database retrieval system