KEGG   Pseudomonas synxantha LBUM223: VO64_2007Help
Entry
VO64_2007         CDS       T03769                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00480  Glutathione metabolism
pfb00590  Arachidonic acid metabolism
pfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    VO64_2007
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VO64_2007
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VO64_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: AKA82553
UniProt: A0A0E3MM07
Position
complement(2240706..2241188)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLKALDGQELPLAPFKGQVVLVVNVASKCGLTPQYAALENLYQQYKDQGFSVL
GLPCNQFAGQEPGSEEEIREFCSLNYGVTFPLGSKLEVNGPDRHQLYRLLAGEGAEFPGD
ITWNFEKFLLGKDGRVLARFSPRTAADDPTIVQAIEKALS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttccacgatctgaaactcaaagccttggacggacaagagctaccgctggcg
ccctttaagggccaggttgtgctggtggtcaatgtggcgtctaaatgtggtttgaccccg
caatacgcggcgttggaaaacctctaccagcaatacaaagaccaggggttttcggtgctt
ggtttgccgtgcaaccagtttgcaggccaggagccgggctccgaggaagagatccgcgag
ttctgcagcctgaactacggcgtgacctttcctctgggcagcaagctcgaggtgaacggt
cctgaccgtcaccagttgtaccgtctattggcgggcgagggtgcagagtttccgggggat
atcacttggaacttcgagaagttcctgttgggtaaagacggccgggtattggcgcgcttc
tcgccgcgtaccgctgcggacgacccgacaatcgtgcaggccatcgaaaaagccctgagc
tga

DBGET integrated database retrieval system