KEGG   Pseudomonas synxantha LBUM223: VO64_2040Help
Entry
VO64_2040         CDS       T03769                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00380  Tryptophan metabolism
pfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    VO64_2040
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     VO64_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AKA82586
UniProt: A0A0E3GYH6
Position
complement(2273712..2274569)
Genome map
AA seq 285 aa AA seqDB search
MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT
SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKAIR
PFLGQSSGFQSFQYREIEFILGNKSPALLRPHAHRPQLLQELQVAIATPSLYDEAINLMI
KAGLAIDPQRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR
FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatgtcccttctctgccgattaccagccaccggaagaatggcataacgccgaa
ctgaatttttccgagtccatgagctatggcgactacctggacctgggcaaagtcctcagc
gcccagcacccgctgtcgcctgaccacaacgagatgctcttcatcatccagcaccagact
tcggagctgtggatgaaactgatgctccacgaactcaaggccgcccgcgaacacgtgcgc
ctgggtgagttgccgccggcgttcaagatgctggcgcgagtctcgcggatcttcgaccaa
ctggtgcacgcctgggcggtgctggcgaccatgactccgtcggagtacaaggcaattcgc
ccgttcctggggcagtcgtcggggttccagtcgttccagtaccgcgagatcgaattcatc
ctcggcaacaagagcccggcattgctgcggccccatgcccatcggccgcaattgttgcag
gaacttcaggtggcgattgccacgccgtcgctatatgacgaggcgatcaacctgatgatc
aaggcggggctggcgattgacccccagcgcgccgagcgcgacccgacggcggccacagtg
catgatgagtcggtggaggcggcgtggcgtgaggtgtatcgcgacccgagccggtattgg
gatttgtatcagttggccgagaagttcatcgacctggaggattcgttccgccaatggcgc
ttccggcatgtgaccacggtggagcggatcatcggcttccagccgggcaccggtggcacc
gaaggcgtgggttacctgcgcaagatgctcgacacggtattgtttcccgaactctggcga
gtacgctcgaccctctaa

DBGET integrated database retrieval system