KEGG   Pseudomonas synxantha LBUM223: VO64_3729Help
Entry
VO64_3729         CDS       T03769                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00071  Fatty acid degradation
pfb00072  Synthesis and degradation of ketone bodies
pfb00280  Valine, leucine and isoleucine degradation
pfb00310  Lysine degradation
pfb00362  Benzoate degradation
pfb00380  Tryptophan metabolism
pfb00620  Pyruvate metabolism
pfb00630  Glyoxylate and dicarboxylate metabolism
pfb00640  Propanoate metabolism
pfb00650  Butanoate metabolism
pfb00900  Terpenoid backbone biosynthesis
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
pfb01200  Carbon metabolism
pfb01212  Fatty acid metabolism
pfb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VO64_3729
   00630 Glyoxylate and dicarboxylate metabolism
    VO64_3729
   00640 Propanoate metabolism
    VO64_3729
   00650 Butanoate metabolism
    VO64_3729
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VO64_3729
   00072 Synthesis and degradation of ketone bodies
    VO64_3729
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VO64_3729
   00310 Lysine degradation
    VO64_3729
   00380 Tryptophan metabolism
    VO64_3729
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VO64_3729
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VO64_3729
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VO64_3729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfb04147]
    VO64_3729
Enzymes [BR:pfb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VO64_3729
Exosome [BR:pfb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VO64_3729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKA84275
UniProt: A0A0E3MQV4
Position
4209661..4210938
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIIGGNRIPFARSNGPYATASNQAMLTAALEGLIERYNLHGLRMGEVAAGAVL
KHSRDFNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIECGIAGGVDT
TSDAPIGVNEGLRKLLLQANRGKSMGDKLKTLLQLRPQHLKPELPRNGEPRTGLSMGQHC
ELMAQTWQIPRVEQDQLALESHQKMAASYAEGWHNDLLTPFLGLTRDNNLRPDLTLEKLA
SLKPAFERSAKGTLTAGNSTPLTDGASLVLLGSEAWAKERGLPILAYLRDGEAAAVDFVN
GAEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCKTRLGLD
APLGSIDRSRLNVKGSSLAAGHPFAATGGRIVANLAKLLDAAGKGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattgcgccgtgtagcgatcattggcggtaatcgcattcctttcgcccgctcc
aatggcccatacgccacggcgagcaaccaggcgatgctgaccgccgcgctggagggcctg
atcgagcgctacaacctgcacggcctgcgcatgggcgaggtagccgccggcgcggtactc
aagcactcccgagacttcaacctgacccgcgaatgcgtgctcggctcgcgcctgtcgccg
caaacccctgcatacgatatccagcaagcctgcggcaccgggctggaggctgcgttgctg
gtggccaacaaaattgctctgggccagatcgaatgtgggattgccggcggcgtagacacc
acgtccgatgctccgatcggggtgaacgaaggcttgcgcaagcttttgctgcaagccaat
cgcggtaaatccatgggggataaactaaaaaccttgttacaacttcgtccccaacatctc
aagccggaactgccgcgcaatggcgaaccacgcaccggcttgtccatgggccagcattgc
gaactgatggcgcagacctggcagattcctcgcgtcgaacaggaccagcttgcgcttgag
agtcatcagaaaatggccgcgtcctacgccgaaggctggcacaacgacttgctcacgccc
tttcttggcctcacccgcgacaacaacctgcgccccgacctgaccctggagaaactcgcc
agcctcaagccggccttcgagcgcagcgcaaagggcacgctcaccgccggcaactccacg
ccgctcaccgatggcgcatccctggtgctgctgggcagtgaagcctgggccaaggagcgt
ggcctgccgatcctggcgtacctgcgcgatggcgaagcggctgcggtggatttcgtcaac
ggtgccgaggggctgttgatggcgccggtgtatgcggtgccgcgcttgcttgcccgcaac
ggcttgaccctgcaggactttgattactatgagatccacgaagccttcgccgcccaggtg
ttgtgcacgctcaaggcgtgggaagatgcggactattgcaagacccgtctgggcctggat
gcgccgctgggatccatcgaccgcagtcggctcaacgtcaagggaagttccctggcggcg
ggccatccgtttgccgccaccggcgggcgcatcgtcgccaacctcgccaaactgttggat
gcggcgggcaaaggtcgcgggctgatttcgatctgtgctgctggcggccaaggggtgacg
gcgattatcgaacgctga

DBGET integrated database retrieval system