KEGG   Pseudomonas synxantha LBUM223: VO64_3951Help
Entry
VO64_3951         CDS       T03769                                 

Definition
(GenBank) putative amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pfb  Pseudomonas synxantha LBUM223
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VO64_3951
Enzymes [BR:pfb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     VO64_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF442
Motif
Other DBs
NCBI-ProteinID: AKA84497
UniProt: A0A0E3MNI0
Position
4458633..4459481
Genome map
AA seq 282 aa AA seqDB search
MSFAVIQMVSQSDVLANLTQARRLLEQAAAGGAKLAVLPENFAAMGRRDVADIGRAEALG
EGPILPWLKQAARDLTLWIVAGTLPLPPKDQPHAKSNACSLLINDQGEIVARYDKLHLFD
VDVADARGRYRESDDYAFGSNVVVADTPVGRLGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYLLAAAQGGVHPGPRETHGHAAIVDPWGRVLAQQD
QGEAVLLAERDSSEQASIRARMPVVSHRRFFSQGAQRPASER
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgcagtaatccaaatggtcagccagagtgacgtgctggctaatctcacccag
gcgcgccgcctgctggagcaagcggcggcgggtggcgcgaaactcgcggtactgccggaa
aacttcgctgcgatgggtcgccgtgacgtggccgacatcggccgcgccgaggccctgggt
gaaggcccgatcctgccatggttgaaacaggccgcccgtgacctcaccttatggatagtg
gccggtacattgccgttgccgcccaaggaccaaccccacgccaagtccaacgcttgctcg
ctgctgatcaatgatcagggtgaaattgtcgctcgttacgacaagctgcacctgtttgat
gtggacgttgcggatgctcgtggtcgttatcgcgaatccgacgactatgctttcggaagc
aatgtggtggtggcggatacgccagtggggcgtttggggctgacggtgtgctacgacttg
cgcttccccgagctgtatagcgagttacgcgctgcgggggctgaattgattaccgcgccc
tcggcctttacggcggtgaccggggccgcccattgggatgtgctgattcgggcgcgggcc
atcgaaacccagtgctacctgctggcggccgctcaaggtggcgtgcacccaggcccacgg
gaaacccatggacacgcggcgattgtcgacccttgggggcgggtgctggcacaacaggat
caaggcgaagcggtgttgctggccgaacgcgatagcagtgaacaggcgtcgataagggcg
cgcatgccggtggtcagccatcggcgctttttctcgcagggcgcgcagcggcctgcttca
gaacgatga

DBGET integrated database retrieval system