KEGG   Pseudomonas synxantha LBUM223: VO64_4456Help
Entry
VO64_4456         CDS       T03769                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00010  Glycolysis / Gluconeogenesis
pfb00071  Fatty acid degradation
pfb00350  Tyrosine metabolism
pfb00625  Chloroalkane and chloroalkene degradation
pfb00626  Naphthalene degradation
pfb00680  Methane metabolism
pfb01100  Metabolic pathways
pfb01110  Biosynthesis of secondary metabolites
pfb01120  Microbial metabolism in diverse environments
pfb01130  Biosynthesis of antibiotics
pfb01200  Carbon metabolism
pfb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO64_4456
  09102 Energy metabolism
   00680 Methane metabolism
    VO64_4456
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VO64_4456
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VO64_4456
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VO64_4456
   00626 Naphthalene degradation
    VO64_4456
Enzymes [BR:pfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VO64_4456
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     VO64_4456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 CLLAC
Motif
Other DBs
NCBI-ProteinID: AKA85002
UniProt: A0A0E3KH87
Position
4991146..4992258
Genome map
AA seq 370 aa AA seqDB search
MIKSRAAVAFEAKKPLEIVEVDVAMPKAGEVLLRVVASGVCHTDAYTLSGADPEGIFPSI
LGHEGGAVVEAIGEGVTSVAVGDHVIPLYTPECGKCKFCLSGKTNLCQAIRSTQGKGLMP
DGTTRFSYNGQPIFHYMGTSTFSEYTVLPEISVAKISKEAPLEKVCLLGCGVTTGIGAVL
NTAKVKPGDTVAIFGLGGIGLSAVIGAVKAKAGRIIAIDINPAKFEIAKQLGATDCINPK
DYDRPIQDVIVDLTDGGVDFSFECIGNVQLMRAALECCHKGWGESVIIGVAGAGQEIATR
PFQLVTGRVWRGSAFGGVRGRTELPSYVEMAQTGEIPLDTFITHTMGLEDINKAFDLMHE
GKSIRTVIHF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtcccgtgccgccgtagccttcgaagccaagaagccccttgagattgttgaa
gtggatgtcgccatgcccaaggccggcgaagtgctgttgcgggtggtggcgtccggcgtg
tgccataccgatgcctatacgttgtcgggcgcagacccggaaggcattttcccgtcgatc
ctcggccatgaaggcggtgcagtggtggaagccatcggcgaaggcgtgacctccgtcgca
gtcggcgatcatgtgatcccgctgtacaccccggaatgcggcaagtgcaaattctgcctg
tcgggcaagaccaacctgtgccaggccatccgttcgacccaaggcaaaggcctgatgccg
gatggcaccacgcgtttctcctacaacggccagccgattttccactacatgggcacctcg
accttctccgagtacaccgtgctgccggaaatctccgtggccaagatttctaaagaagca
ccactggaaaaagtctgcctgctcggttgcggcgtcaccaccggcatcggcgcggtgctc
aacaccgccaaggtcaagccgggcgataccgtggctatcttcggcctcggcggtatcggc
ctgtcggctgtgattggtgcggtcaaggccaaggccgggcgcatcattgccatcgatatc
aacccggccaagttcgaaatcgccaagcaactgggcgctaccgattgcatcaacccgaaa
gactacgaccgcccgatccaggacgtgattgtcgacctgactgacggcggcgtggacttt
tccttcgagtgcatcggcaatgtgcagctgatgcgtgcggccctcgagtgctgccacaag
ggctggggtgaatcggtgatcatcggtgtagccggtgctggccaggagatcgccacacgt
ccgttccagctggtcaccgggcgcgtctggcgcggttcggcgttcggcggcgtgcgtgga
cgtaccgaattgccaagctatgtggaaatggcccagaccggagaaattccgctggatacc
tttatcacccacaccatgggcctggaagacatcaacaaagcgtttgacctgatgcacgaa
ggcaagagcattcgtaccgtcatccacttctga

DBGET integrated database retrieval system