KEGG   Pseudomonas fluorescens A506: PflA506_0034Help
Entry
PflA506_0034      CDS       T02114                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00260  Glycine, serine and threonine metabolism
pfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01130  Biosynthesis of antibiotics
pfc01230  Biosynthesis of amino acids
Module
pfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PflA506_0034 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PflA506_0034 (trpA)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PflA506_0034 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFJ58855
Position
complement(38713..39522)
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAQLKEQNRAALVTFVTAGDPGYDTSLAILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQNLLKTLQMVREFRQDNNDTPLVLMGYFNPIHKYGVSQFIADAKA
AGVDGLIVVDMPPEHNGELCDPAQAAGIDFIRLTTPTTDDVRLPTVLNGSSGFVYYVSVA
GVTGAGAATLEHVEEAVTRLRRHTDLPISIGFGIRTPDQAAAIARLADGVVVGSALIDHI
ATAKNDQQAIDGVLTLCAALSEGVRNARK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcaaacgcgctttgcgcaacttaaagaacaaaaccgcgccgccctggtg
accttcgtcaccgctggcgaccccggctatgacacctcgctggcgatcctcaagggcttg
ccggccgctggcgccgacgtgatcgaactgggcatgcccttcaccgacccgatggccgac
ggcccggccattcaactggccaatatccgcgcgctggccgccaaacagaacctgttgaaa
accctgcagatggttcgcgagttccgccaggacaacaacgacacgccgctggtgttgatg
ggctatttcaacccgatccataaatatggcgtgtcgcagttcattgccgatgccaaggca
gctggcgtcgacggcctgatcgtggtggacatgccccccgagcacaacggcgagctgtgc
gacccggcccaggccgcaggcatcgactttatccgcctgaccacgccgaccaccgatgat
gtgcgcctgcctactgtgctcaatggcagctccgggtttgtgtattacgtgtcggtcgcc
ggtgttaccggggcgggcgccgccactctggaacacgtcgaagaagccgtgacccgcctg
cgccgtcataccgacctgccgatcagcatcggctttggtatccgcacaccggaccaggca
gcggccatcgcacgcctggcagacggggtggtagtgggttcggcgctgatcgatcacatc
gccacggccaagaacgaccagcaagccattgatggcgtattgaccctgtgcgcggcgctg
tcggaaggtgttcgcaacgcacgcaagtaa

DBGET integrated database retrieval system